Struttura delle proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Struttura delle proteine"

Transcript

1 Struttura delle proteine I II III Copyright by Giorgio Sartor. All rights reserved. Versione /09/ :58

2 Proteine Biomolecole, macromolecole Più del 50% del peso secco di una cellula sono proteine Polimeri lineari di aminoacidi Possono essere trattate come stringhe Macchine molecolari Enzimi Proteine contrattili Actina, miosina Proteine strutturali Tropocollagene, cheratina Effettori Insulina, egf Difesa Immunoglobuline Recettori CD4, ACh Repressori Jun, Fos Chaperonine GroEL Immagazzinamento Ferritina 2

3 TRASDUZINE DEL SEGNALE: comunicazione extracellulare 3

4 TRASDUZINE DEL SEGNALE: comunicazione intracellulare Protein chinasi L attivazione dei recettori di superficie provoca variazioni del grado di fosforilazione di alcune proteine attraverso l attivazione di chinasi. Le chinasi possono far parte del recettore, essere nel citosol, o associate alla membrana plasmatica. Ci sono due tipi di chinasi quelle che fosforilano la tirosina, e quelle che agiscono sulla serina o sulla treonina. L attività catalitica delle chinasi viene modulata da fosforilazioni, dal legame diretto ad altre proteine, da variazioni della concentrazione di secondi messaggeri. All attività delle chinasi si contrappone l attività delle fosfatasi, che rimuovono i gruppi fosfato da specifiche proteine substrato. 4

5 TRASDUZINE DEL SEGNALE: comunicazione intracellulare Proteine segnale intracellulari Proteine che legano il GTP e agiscono come interruttori molecolari nelle vie metaboliche nelle vie della trasduzione del segnale. Esistono due classi con attività GTP-asica: la proteine G trimeriche che sono direttamente accoppiate ad alcuni recettori, e le proteine monomeriche Ras. In tutti e due i tipi di proteine, sono presenti regioni che promuovono l attività di specifiche proteine effettrici per interazione diretta proteina-proteina.i domini si trovano nella loro conformazione attiva soltanto quando la switch protein è legata al GTP. 5

6 Sequenza AA del dominio di legame del DNA contenente Zn ++ del recettore dei glucocorticoidi. gni ione di Zn ++ è legato a 4 residui di cisteina. Uno di questi stabilizza l elica di riconoscimento (in giallo) che fornisce siti di legame ai DNA sequenza specifici mentre nella altra regione contenente Zn ++ è presente un loop (in viola) implicato nella formazione del dimero. Sequenza nucleotidica della regione del DNA legante i glucocorticoidi 6

7 Sequenza AA del dominio di legame del DNA contenente Zn del recettore dei glucocorticoidi. 7

8 8

9 Recettori accoppiati a proteine G e loro effettori 9

10 10

11 11

12 Fig. 1. Comparison of the inactive Gαβγ heterotrimer and the Gαi/q-GRK2-Gβγ complex. V M Tesmer et al. Science 2005;310: v. Published 1.3 by gsartor AAAS

13 13

14 Struttura delle proteine I fondamentali 14

15 Proteina 15

16 Aminoacidi Gli α-aminoacidi (AA) sono molecole che presentano almeno due gruppi funzionali, il gruppo C e il gruppo N 2 Legati al carbonio α R R N 2 N

17 Aminoacidi Gli AA differiscono tra loro per il gruppo R I mammiferi utilizzano 20 AA diversi il cui gruppo R ha diverse proprietà polari e/o acidobase: R alifatico (sei) R aromatico (tre) R idrossilato (due) R contenente zolfo (due) R acido e derivati (quattro) R basico (tre) o R idrofobico (sette) R polare (otto) R carico (quattro) glicina 17

18 Aminoacidi Gli AA differiscono tra loro per il gruppo R I mammiferi utilizzano 20 AA diversi il cui gruppo R ha diverse proprietà polari e/o acidobase: R alifatico(sei) R aromatico(tre) R idrossilato(due) R contenente zolfo(due) Racidoederivati(quattro) Rbasico(tre) o R idrofobico (sette) R polare (otto) R carico (quattro) glicina 18

19 Aminoacidi alifatici Gli AA alifatici sono sei: 3 C N 2 3 C C 3 N 2 N 2 Glicina Gly G Alanina Ala A Valina Val V 3 C C 3 N 2 3 C C 3 N N 2 Leucina Leu L Isoleucina Ile I Prolina Pro P 19

20 Aminoacidi aromatici Gli AA aromatici sono tre: Fenilalanina Phe F N 2 Tirosina Tyr Y N 2 N N 2 Triptofano Trp W 20

21 Aminoacidi idrossilati Gli AA idrossilati sono due: 3 C N 2 N 2 Serina Ser S Treonina Thr T 21

22 Aminoacidi contenenti zolfo Gli AA contenenti zolfo sono due: S N 2 C 3 S N 2 Cisteina Cys C Metionina Met M 22

23 Aminoacidi acidi (e derivati) Gli AA acidi sono due (e due le amidi): Acido aspartico Asp D N 2 Acido glutamico Glu E N 2 N 2 N 2 N 2 N 2 Asparagina Asn N Glutamina Gln Q 23

24 Aminoacidi basici Gli AA basici sono tre: N 2 N 2 N 2 N N N 2 Lisina Lys K Arginina Arg R N N N 2 Istidina is 24

25 Proprietà acido-base degli AA La presenza dei due gruppi funzionali C e N 3+ rende gli AA simili, nel loro comportamento acido-base, ad acidi biprotici A 2 +. A 2 + A + + A R N 3 + R N 3 + R N 2 K a ' + K a '' + Carica +1 Catione Carica 0 Anfoione Carica -1 Anione 25

26 Proprietà acido-base degli AA 26

27 Proprietà acido-base degli AA Si definisce pi (punto isoelettrico) il valore di p al quale l AA ha carica netta 0, nel caso di un AA con catena laterale neutra è dato da: pi 1 = (pk ' + pk '' a ( α C) a 2 ( α -N3 + ) ) 27

28 Proprietà acido-base degli AA acidi In presenza un gruppo acido oltre ai due gruppi funzionali C e N 3+ gli AA si comportano come acidi triprotici A 3 +. A 3 + A A A C N 3 + C N 3 + -C N 3 + -C N Carica +1 Catione K a ' Carica 0 Anfoione K a '' Carica -1 Anione K a ''' Carica -2 Dianione 28

29 Proprietà acido-base degli AA acidi Il pi di un AA acido è dato dalla media dei due valori minori di pk a : 1 pi = (pk ' + pk '' a ( α C) a (R-C) 2 ) 29

30 Proprietà acido-base degli AA basici In presenza un gruppo basico oltre ai due gruppi funzionali C e N 3+ gli AA si comportano come acidi triprotici A A 3 ++ A A A (C 2 ) 4 3 +N N 3 + (C 2 ) 4 3 +N N 3 + N 3 + (C 2 ) 4 N 2 (C 2 ) 4 2 N N Carica +2 Dicatione K a ' Carica +1 Catione K a '' Carica 0 Anfoione K a ''' Carica -1 Anione 30

31 Proprietà acido-base degli AA basici Mentre il di un AA basico è dato dalla media dei due valori maggiori di pk a : pi 1 = (pk '' + pk ''' a + a + 2 ( α N3 ) ( ε N3 ) ) 31

32 Proprietà acido-base degli AA apolari AA pk a pk a pi Gly Ala Val Leu Ile Pro Phe Met Ser Thr Trp

33 Proprietà acido-base degli AA polari AA pk a pk a pk a R pi Cys Tyr Asp Asn Glu Gln is Lys Arg

34 Proprietà acido-base degli AA polari AA pk a pk a pk a R pi Cys Tyr Asp Asn Glu Gln is Lys Arg

35 Istidina is is presenta un valore di pi vicino al p fisiologico a causa della stabilizzazione per risonanza del catione imidazolico. N + N N 3 + pk a = 6.0 N N N N N + N

36 Aminoacidi Gli AA differiscono tra loro per il gruppo R I mammiferi utilizzano 20 AA diversi il cui gruppo R ha diverse proprietà polari e/o acidobase: R alifatico (sei) R aromatico (tre) R idrossilato (due) R contenente zolfo (due) R acido e derivati (quattro) R basico (tre) o R idrofobico (sette) R polare (otto) R carico (quattro) glicina 36

37 Aminoacidi idrofobici 3 C 3 C C 3 3 C N 2 N 2 N 2 C 3 N 2 Alanina Ala A Valina Val V Fenilalanina Phe F Leucina Leu L 3 C C 3 N 2 N C 3 S N 2 Isoleucina Ile I Prolina Pro P Metionina Met M 37

38 Aminoacidi polari N 2 3 C N 2 N N N 2 N 2 Serina Ser S Treonina Thr T Istidina is Tirosina Tyr Y S N 2 N 2 N 2 N 2 N 2 N N 2 Cisteina Cys C Asparagina Asn N Glutamina Gln Q Triptofano Trp W 38

39 Aminoacidi carichi N 2 N 2 N 3 + N 2 Acido aspartico Asp D Acido glutamico Glu E Lisina Lys K N 2 N 2 + N 2 + N N 2 Arginina Arg R N 2 N N + N N N 2 N + N Istidina is 39

40 Aminoacidi modificati Modificazioni post-traduzionali 4-idrossiprolina N -fosfoserina P N 3 + -fosfotirosina P N 3 + N-Acetillisina 3 C N N

41 Isomeria ottica Tutti gli AA (esclusa la glicina) possiedono almeno un atomo di carbonio asimmetrico, il C α. R C α N 2 41

42 Isomeria ottica Quindi possono esistere due isomeri D ed L N 3 + C 3 N 3 + C 3 D-Alanina L-Alanina In natura gli AA sono fondamentalmente in forma L, gli aminoacidi D si trovano in batteri. 42

43 Isomeria ottica Per quanto riguarda la configurazione assoluta degli L-AA 18 sono S e uno (la cisteina) R. 2 N C 3 3 C C S N 2 43

44 Isomeria ottica Per quanto riguarda la configurazione assoluta degli L-AA 18 sono S e uno (la cisteina) R. 2 N C 2 S SC 2 C R N 2 44

45 STRUTTURA

46 Gerarchia di strutture 46

47 Struttura primaria Si definisce la struttura primaria di un peptide o di una proteina la sequenza a partire dall AA aminoterminale (il primo) all AA carbossiterminale (l ultimo). + 3 N-G-A-S-T-A-A-K-W-K-C N-Gly-Ala-Ser-Thr-Ala-Ala-Lys-Trp-Lys-C

48 Il legame peptidico CNC 2 N Cα 1 N Cα 2 R N R AA 1 (aminoterminale) AA 2 (carbossiterminale) Gli AA si legano tra loro con un legame tra il gruppo carbossilico di un AA e il gruppo aminico dell AA successivo. 48

49 Il legame peptidico CNC 2 N R N R AA 1 (aminoterminale) AA 2 (carbossiterminale) Gli AA si legano tra loro con un legame tra il gruppo carbossilico di un AA e il gruppo aminico dell AA successivo. 49

50 Il legame peptidico Il legame peptidico ha caratteristiche elettroniche che ne regolano la geometria... Cα 1 N Cα 2 Cα 1 N + Cα 2 δ Cα 2 Cα 1 N δ + 50

51 Angoli diedri Angolo diedro A-B-C-D (+) orario (-) antiorario 51

52 Angoli diedri Cα 1 ψ 1 C ω 1 φ N 1 Cα * 2 ψ 2 C R ω 2 N φ φ 2 Cα 3 φ (phi) C -N-Cα-C ψ(psi) N-Cα-C -N ω (omega) Cα-C -N-Cα Cα 1 ψ 1 C ω 1 φ 1 N Cα 2 ψ 2 C R ω 2 N φ φ 2 Cα 3 Cα 1 ψ 1 C ω 1 φ 1 N Cα * 2 ψ 2 C R ω 2 N φ φ 2 Cα 3 52

53 Angoli diedri N Cα C N Cα C ψ N Cα C N Cα C ω N Cα C N Cα C φ 53

54 Il legame peptidico A causa della distribuzione degli elettroni il legame peptidico ha specifiche proprietà geometriche: I legami hanno lunghezze: C α -C 1.52Å Cα 1 ψ ω N φ * Cα 2 C= 1.23Å C-N 1.33Å N-C α 1.45Å Il legame ω generalmente trans (180 ) 54

55 Il legame peptidico A causa della distribuzione degli elettroni il legame peptidico ha specifiche proprietà geometriche: Non vi è libera rotazione intorno al legame C-N Vi è libera rotazione solo intorno ai legami φ e ψ. Cα 1 ψ ω N Cα C 32 φ 55

56 Il legame peptidico 56

57 Il legame peptidico L angolo ωtende ad essere planare Trans(180 ) o Cis(0 ) a causa della delocalizzazione degli elettroni π. Trans è più favorito di Cis: Solo 116 su angoli in 154 strutture (0.36%) sono Cis (Stewart et al. 1990). Alcune coppie di AA sono però spesso Cis: Tyr-Pro (25%), Ser-Pro (11%), X-Pro (6.5%) Questo permette la flessibilità dello scheletro della proteina attraverso gli angoli φ e ψ con la limitazione dell ingombro sterico ψ Cα 1 Cα ω N ψ ω φ N φ Cα 2 Trans Cα 2 Cis 57

58 Prolina Cis: Tyr-Pro (25%), Ser-Pro (11%), X-Pro (6.5%) ψ ω δ Cα 1 φ N γ C Cα 2 β 58

59 Il legame peptidico A causa della distribuzione degli elettroni il legame peptidico ha specifiche proprietà geometriche: È planare. Cα 1 ψ ω N φ Cα C 32 Aminoacidi e proteine 59

60 Il legame peptidico A causa della distribuzione degli elettroni il legame peptidico ha specifiche proprietà elettriche: Cα 2 È dipolare. Cα 1 N

61 φ ω ψ 61

62 χ 2 N N 2 + * 3 C N χ 1 χ 2 χ 4 χ 3 χ 5 N N N C 3 * 62

63 Peptidi e proteine I peptidi e le proteine sono polimeri di AA legati tra loro da un legame peptidico. Fino a 20 AA il polimero è un peptide. N C 63

64 Protein folding Ripiegamento 64

65 Fattori che influenzano la stabilità e l attività delle proteine Interazioni non covalenti Legami idrogeno (donatore/accettore) Legami ionici Forze di Van der Waals Altri legami Interazioni covalenti Ponti disolfuro 65

66 Interazioni non-covalenti Legame idrogeno -C=. N- C= e N: Legame peptidico C= : Glu, Asp, Gln, Asn N : Lys, Arg, Gln, Asn, is : Ser, Thr, Glu, Asp, Tyr 66

67 Interazioni non-covalenti Legami ionici C N C - : Glu, Asp pka < 5 N 3+ : Lys, Arg pka > 10 Forze di Van der Waals Di natura elettrostatica, corta distanza Interazioni dipolo-dipolo, ione-dipolo etc. 67

68 Interazioni non-covalenti Energia: kj mole -1 Dipendono dalla carica e dal momento dipolare Dipendono dalla distanza e dalla costante dielettrica del mezzo D = 80 ( 2 ) D = 2-4 (proteina) 68

69 Legame idrogeno C 3 69

70 Legame idrogeno 70

71 Struttura secondaria La struttura II delle proteine dipende dalla formazione di legami idrogeno tra atomi di ossigeno di un legame peptidico e atomi di azoto di un altro legame peptidico. La formazione dei legami tra atomi avviene a causa: della possibilità di rotazione intorno ai legami che coinvolgono il Cα della distribuzione delle cariche nel legame peptidico che rende l atomo di ossigeno carbonilico con carica parziale negativa e l atomo di idrogeno con parziale carica positiva, ciò rende la condivisione di un atomo di idrogeno tra l ossigeno e l azoto. Cα 1...Cα n δ N δ + δ N Cα 2... δ + Cα n +1 71

72 Struttura secondaria La formazione dei legami tra atomi avviene a causa della possibilità di rotazione intorno al legame tra il Cα e l atomo di azoto che lo precede (angolo φ) ed intorno ai legami tra il Cα e l atomo di carbonio (carbonilico) che lo segue (angolo ψ). R 3 N+ R C 1 N φ C 2 ψ N C 3 C- R 72

73 Struttura secondaria R 3 N+ R C 1 N φ C 2 ψ N C 3 C- R R C 3 C- 3 N+ R C 1 N φ C 2 ψ R N 73

74 Struttura secondaria R 3 N+ R N N C R R N R N N C- R 74

75 Struttura secondaria Poiché non tutte gli angoli di rotazione sono possibili a causa degli ingombri sterici, esistono dei minimi di energia conformazionale che corrispondono a particolari coppie di angoli φ e ψ ed alla formazione di legami con, in alcuni casi, precise periodicità: Esistono diverse strutture II: Eliche Strutture β Ripiegamenti (Turns) 75

76 ELICE

77 Geometria dell α-elica Angoli φ e ψ negativi (-60 e -50 ) Numero di residui per giro = 3.6 Passo dell elica = 5.4 Å 1.5 Å per residuo 77

78 α-elica 78

79 Eliche A: α-elica ideale B: α-elica destrorsa C: α-elica sinistrorsa 79

80 Mano Destra Mano Sinistra 80

81 Ramachandran plot Alanina Glicina MIN MAX Scala di probabilità 81

82 β-sheet e β-strand Ramachandran plot ψ α-elica sinistrorsa Si può rappresentare la distribuzione degli angoli φ e ψ in una qualunque proteina mettendo in grafico gli angoli. α-elica destrorsa φ 82

83 Ramachandran plot Si può rappresentare la distribuzione degli angoli φ e ψ in una qualunque proteina mettendo in grafico gli angoli. 83

84 AA preferiti delle α-eliche 84

85 Caratteristiche Lunghezza media: 10 residui (3 giri di elica) Intervallo: da 4 a 40 residui Comunemente localizzata sulla superficie con un lato esposto l latro verso l interno Le eliche transmembrana sono fatte quasi completamente da AA idrofobici 85

86 Aminoacidi e α-elica 3 C Buoni: N 2 N 2 3 C C 3 N 2 C 3 S N 2 Alanina Ala A Acido glutamico Glu E Leucina Leu L Metionina Met M Cattivi: N N 2 N 2 N 2 Prolina Pro P Glicina Gly G Tirosina Tyr Y Serina Ser S 86

87 Distorsioni α-elica Contatti con altre strutture secondarie; Distribuzione del solvente asimmetrica; Presenza nella sequenza di Pro e Gly 87

88 Elica 3 10 Tre aminoacidi per giro. Il legame forma un ciclo di dieci atomi. ψ e φ 49,

89 Elica

90 Elica π La maggioranza delle eliche π ha una lunghezza di sette residui e non ha una regolarità negli angoli diedri ψ e φ. Se si escludono i residui estremi la somma dell angolo ψ di un AA e quello dell angolo φ del residuo successivo è di circa Spesso un residuo di prolina segue l ultimo AA dell elica π. α elica elica π α elica 90

91 Elica π 91

92 Prolina Cis: Tyr-Pro (25%), Ser-Pro (11%), X-Pro (6.5%) ψ ω δ Cα 1 φ N γ C Cα 2 β 92

93 Poli-prolina tipo II Elica sinistrorsa Angolo ω trans (180 ) Angoli ψ e φ sono circa -75, 150 ; Tre residui per giro (360 /120 = 3) Passo circa di 3.1 Å. Struttura tipica di proteine fibrose (collagene, composto principalmente di prolina, idrossiprolina e glicina) Importante per l interazione proteina-proteina e per l interazione tra domini. Non ci sono legami idrogeno interni poiché l azoto amidico e l ossigeno sono distanti (circa 3.8 Å) e non correttamente orientati. 93

94 Poli-prolina tipo I L elica PPI è meno densa dell elica PPII Angolo ω cis (0 ) Gli angoli ψ e φ sono circa -75 e 160, simili ma non uguali a all elica PPII L elica PPI è destrorsa con 3.3 residui per giro Il passo è più corto rispetto a PPII: circa 1.9 Å. Non ci sono legami idrogeno interni poiché l azoto amidico e l ossigeno sono distanti (circa 3.8 Å) e non correttamente orientati. 94

95 STRUTTURE β

96 β-sheet e β-strand L angolo φ è negativo e ψ è positivo. Le strutture β sono caratterizzate dalla formazione di legami idrogeno tra catene adiacenti e non necessariamente orientate nello stesso verso. 96

97 Diversi tipi di β-sheet I legami che si formano dipendono dall orientazione relativa delle catene 97

98 β-sheet antiparalleli Il foglietto β, al contrario dell α elica, che è costituita da un unica regione continua, risulta dalla combinazione di più regioni della catena polipeptidica. Queste regioni, dette filamenti βhanno di solito la lunghezza di 5-10 residui e una conformazione quasi completamente distesa. 98

99 β-sheet paralleli 99

100 Urato ossidasi Catecolo -Metiltransferasi 100

101 Diversi tipi di β-sheet I legami che si formano dipendono dall orientazione relativa delle catene 101

102 β-sheet Solo il 20% dei filamenti contenuti nei foglietti β delle proteine di cui sia nota la struttura presenta un associazione parallela da un lato e antiparallela dall altro. 102

103 Ramachandran plot β-sheet e β-strand ψ φ 103

104 TURNS

105 Turns I turns sono strutture composte di pochi AA, In genere fungono da collegamento tra eliche o strands. β-hairpin Turns Reverse Turns 105

106 β -hairpin loop Un tipo di loop che interviene tra due β- strand antiparallele. β -hairpin 106

107 β -hairpin loop La struttura della maggior parte delle proteine risulta dalla combinazione di più elementi di struttura secondaria, α eliche e filamenti β, collegati da regioni loop di lunghezza e forma irregolare. Il core idrofobo, stabile, della molecola è costituito da una combinazione di elementi di struttura secondaria, mentre le regioni loop si trovano alla superficie della molecola. I gruppi C = ed N della catena principale presenti in questi loop, che in genere tra loro non formano legami a, si trovano esposti al solvente e possono formare legami a con molecole di acqua. 107

108 Il ripiegamento β di tipo I ha nelle proteine una frequenza doppia rispetto al tipo II. Il tipo β II ha sempre una Gly alla terza posizione. Circa il 6% dei legami peptidici in cui e coinvolto l atomo di azoto imminico della prolina è in configurazione cis e molti di questi presenti nei ripiegamenti β. 108

109 β -hairpin Turns Residuo 1 ψ Residuo 2 Tipo II Tipo I Residuo 2 Residuo 1 φ 109

110 Reverse Turns i + 1 Tipo II ψ i + 2 Tipo I i + 1 i + 2 sempre glicina φ 110

111 Strutture secondarie Struttura Angolo φ (medio) Angolo ψ (medio) Angolo ω α-elica destrorsa β-sheet parallelo antiparallelo α-elica sinistrorsa elica destrorsa elica π destrorsa Eliche di tipo II PPII Poliprolina e poliglicina PPI

112 112

113 Preferenze degli aminoacidi Strutture ad elica: Met (M) - Ala (A) - Leu (L) - Glu (E) Gln (Q) - Lys (K) Strutture estese: Thr (T) - Ile (I) - Val (V) - Phe (F) - Tyr (Y) Trp (W) Strutture disordinate : Gly (G) - Ser (S) - Pro (P) - Asp (N) Asp (D) Nessuna: Cys (C) - is ()- Arg (R) 113

114 Ramachandran plot Alanina Glicina MIN MAX Scala di probabilità 114

115 Ramachandran plot Si può rappresentare la distribuzione degli angoli φ e ψ in una qualunque proteina mettendo in grafico gli angoli. 115

116 Ramachandran plot 116

117 Ramachandran plot Caso generale Glicina 117

118 Ramachandran plot Caso generale Prolina 118

119 Effetti globali Interazioni a lungo raggio (repulsive o attrattive) tra parti distanti della stessa proteina che possono sovrapporsi a effetti locali: Sequenze di aminoacidi sono in struttura ad elica in una regione e la stessa sequenza è in beta in un altra. Conversione di struttura (elica strand) nella stessa proteina (prioni). 119

120 Ribbon diagrams of P22 Cro (left) and λ Cro (right) illustrating the conserved N-terminal DNArecognition subdomain (residues 1 33; gray) and the highly divergent C-terminal dimerization subdomain (residues 34-end; red). Anderson W J et al. Protein Engineering, Design and Selection 2011;protein.gzr027 The Author Published by xford University Press. All rights reserved. For Permissions, v. please gsartor

121 121

122 Disordered protein of the Bcl-2 family (green) linked to a cell membrane, which acquires structure by binding to its molecular target, in this case a structured protein (red) belonging to the same family. Protein names are shown. Source: [2] Barrera-Vilarmau, S., bregón, P., de Alba, E. Intrinsic order and disorder in the Bcl-2 member arakiri: Insights into its proapoptotic activity. PLoS NE. 6, e21413 (2011). 122

123 Crediti e autorizzazioni all utilizzo Questo materiale è stato assemblato da informazioni raccolte dai seguenti testi di Biochimica: CAMPE Pamela, ARVEY Richard, FERRIER Denise R. LE BASI DELLA BICIMICA [ISBN ] Zanichelli NELSN David L., CX Michael M. I PRINCIPI DI BICIMICA DI LENINGER - Zanichelli GARRETT Reginald., GRISAM Charles M. BICIMICA con aspetti molecolari della Biologia cellulare - Zanichelli VET Donald, VET Judith G, PRATT Charlotte W FNDAMENTI DI BICIMICA [ISBN ] - Zanichelli E dalla consultazione di svariate risorse in rete, tra le quali: Kegg: Kyoto Encyclopedia of Genes and Genomes Brenda: Protein Data Bank: Rensselaer Polytechnic Institute: Il materiale è stato inoltre rivisto e corretto dalla Prof. Giancarla rlandini dell Università di Parma alla quale va il mio sentito ringraziamento. Questo ed altro materiale può essere reperito a partire da: oppure da gsartor.org/ Il materiale di questa presentazione è di libero uso per didattica e ricerca e può essere usato senza limitazione, purché venga riconosciuto l autore usando questa frase: Materiale ottenuto dal Prof. Giorgio Sartor Università di Bologna a Ravenna Giorgio Sartor - 123

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

MOVIMENTO. Motori molecolari. IV Movimento Miosina e actina. Prof. Giorgio Sartor. P04 - Versione 2.0 oct 2013

MOVIMENTO. Motori molecolari. IV Movimento Miosina e actina. Prof. Giorgio Sartor. P04 - Versione 2.0 oct 2013 Prof. Giorgio Sartor Motori molecolari IV Movimento Miosina e actina Copyright 2001-2013 by Giorgio Sartor. All rights reserved. P04 - Versione 2.0 oct 2013 MOVIMENTO Miosina Actina P04 v. 2.0 gsartor

Dettagli

Prof. Giorgio Sartor. Invertebrati marini. I nutrienti. Fonti di carbonio ed energia. Fonte di carbonio. Fonte di energia. Composti organici.

Prof. Giorgio Sartor. Invertebrati marini. I nutrienti. Fonti di carbonio ed energia. Fonte di carbonio. Fonte di energia. Composti organici. Prof. Giorgio Sartor Invertebrati marini I nutrienti Copyright 2001-2008 by Giorgio Sartor. All rights reserved. Versione 1.1 nov 2008 Fonti di carbonio ed energia Organismo Fonte di carbonio Fonte di

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Aminoacidi e proteine

Aminoacidi e proteine Prof. Giorgio Sartor Aminoacidi e proteine Copyright 2001-2012 by Giorgio Sartor. Versione 1.7.1 mar 2012 All rights reserved. Le cellule V.1.7.1 gsartor 2001-2012 Aminoacidi e proteine -2- Aminoacidi

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Prof. Giorgio Sartor. Il metabolismo. Metabolismo. È il processo che permette di ricavare energia da legami chimici (sottoforma di

Prof. Giorgio Sartor. Il metabolismo. Metabolismo. È il processo che permette di ricavare energia da legami chimici (sottoforma di Prof. Giorgio Sartor Il metabolismo Copyright 2001-2008 by Giorgio Sartor. All rights reserved. Versione 1.4 oct 2008 Metabolismo È il processo che permette di ricavare energia da legami chimici (sottoforma

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine I II III Copyright 2001-2015 by Giorgio Sartor. All rights reserved. Versione 1.2.1 oct 2015 Proteine Biomolecole, macromolecole Piùdel 50% del peso secco di una cellula sono proteine

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Prof. Giorgio Sartor. Il metabolismo. Metabolismo. È il processo che permette di ricavare energia da legami chimici (sottoforma di

Prof. Giorgio Sartor. Il metabolismo. Metabolismo. È il processo che permette di ricavare energia da legami chimici (sottoforma di Prof. Giorgio Sartor Il metabolismo Copyright 2001-2017 by Giorgio Sartor. All rights reserved. Versione 1.6.1 Mar-17 Metabolismo È il processo che permette di ricavare energia da legami chimici (sottoforma

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

20/12/ tipi di amino acidi: parecchie combinazioni

20/12/ tipi di amino acidi: parecchie combinazioni 20 tipi di amino acidi: parecchie combinazioni Le proteine sono polimeri di amino acidi 1 SEMPLICI : costituite solo da amino acidi PROTEINE CONIUGATE Apoproteina = parte proteica Gruppo prostetico = parte

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Dettagli

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi

Dettagli

PROTIDI: LE PROTEINE E GLI AMMINOACIDI

PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 3 GLI AMMINOACIDI PROTEICI Le

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine I II III Copyright 2001-2015 by Giorgio Sartor. All rights reserved. Versione 1.0.2 oct 2015 Struttura quaternaria Èil livello di organizzazione per il quale si formano strutture

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali):

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali): AMINOAIDI. Proteine (gr. pròtos = primo) > 50% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida (o alcalina) α-aminoacidi Struttura generale degli α-aminoacidi primari (standard,

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel.

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel. Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276104 Fax.:+39-049-8073310 E-mail: fulvio.ursini@unipd.it Funzioni delle

Dettagli

Alberts et al., L ESSENZIALE DI BIOLOGIA MOLECOLARE DELLA CELLULA, Zanichelli editore S.p.A. Copyright 2005

Alberts et al., L ESSENZIALE DI BIOLOGIA MOLECOLARE DELLA CELLULA, Zanichelli editore S.p.A. Copyright 2005 La conversione dell informazione da una forma ad un altra è il punto critico della trasmissione e prende il nome di: TRASDUZIONE DEL SEGNALE Nella comunicazione cellulare: Molecola segnale Proteina recettore

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni Biochimica Matricole dispari 1 1^ lezione Prof. Spina LA BIOCHIMICA 15 20 miliardi di anni fa l universo comparve sotto forma di eruzioni d l f d inimmaginabili di particele subatomiche ricche di energia

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Metabolismo dei nucleotidi

Metabolismo dei nucleotidi rof. Giorgio Sartor Metabolismo dei nucleotidi 1: introduzione 2: biosintesi de-novo delle purine 3: biosintesi de-novo delle pirimidine 4: catabolismo delle purine 5: catabolismo delle pirimidine 6: sintesi

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

MIOSINA. Motori molecolari. II Strutture per il movimento Miosina, Kinesina e Dineina. Una struttura per il movimento. Prof.

MIOSINA. Motori molecolari. II Strutture per il movimento Miosina, Kinesina e Dineina. Una struttura per il movimento. Prof. Prof. Giorgio Sartor Motori molecolari II Strutture per il movimento Miosina, Kinesina e Dineina Copyright 2001-2013 by Giorgio Sartor. All rights reserved. P02 - Versione 2.0 oct 2013 MIOSINA Una struttura

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare quattro legami covalenti. Questi

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Aminoacidi. Struttura generale Sono 20 e formano le

Aminoacidi. Struttura generale Sono 20 e formano le Aminoacidi Struttura generale Sono 20 e formano le proteine. Oltre a questi ne esistono altri meno comuni Alcuni subiscono modificazioni dopo essere stati inseriti nelle proteine Altri stanno nell organismo

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

materiale didattico disponibile su tozzini/didattica.html

materiale didattico disponibile su  tozzini/didattica.html materiale didattico disponibile su http://homepage.sns.it/ tozzini/didattica.html Sommario Proteine Funzioni principali Legame peptidico Struttura primaria Struttura secondaria Struttura terziaria Struttura

Dettagli