Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle"

Transcript

1

2 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

3 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

4 Il dogma centrale della biologia L informazione genica è contenuta nel DNA Questa informazione è perpetuata nelle generazioni future tramite il processo semiconservativo chiamato duplicazione del DNA L espressione della informazione genica è invece un processo che passa attraverso un intermediario transitorio: l RNA messaggero. Questa molecola è sintetizzata sulla base di uno STAMPO sul DNA e l informazione in esso contenuta serve per dirigere la sintesi di proteine. L informazione passa (quasi) sempre dal DNA all RNA e da questo alle proteine. Mantenimento dell informazione Trasferimento dell informazione Ruolo funzionale DNA Trascrizione RNA Traduzione Proteina Retrotrascrizione Informazione contenuta nella Informazione contenuta nella sequenza Effettuata da alcuni virus sequenza a RNA e nella quantità chiamati retrovirus Informazione contenuta nella struttura e nella quantità

5 Il viaggio dell RNA messaggero L RNA messaggero è sintetizzato nel nucleo a partire da uno stampo di DNA. Solo un gene (eucarioti) o pochi geni (procarioti) alla volta vengono copiati su una molecola di RNA Negli eucarioti l RNA messaggero viene processato con L aggiunta del CAP al 5 L aggiunta della coda di polia al 3 L eliminazione degli introni (splicing) L RNA maturo viene trasportato fuori dal nucleo nel citoplasma Nel citoplasma interagisci con gli organelli citoplasmatici deputati alla sintesi proteica (i ribosomi) I ribosomi sintetizzano una catena proteica lineare aggiungendo uno per uno gli aminoacidi necessari sulla base delle istruzioni contenute nella molecola di mrna Esaurito il suo compito l mrna viene degradato rapidamente

6 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

7 Le proteine sono macromolecole polimeriche. I costituenti delle proteine sono gli aminoacidi. Gli aminoacidi sono molecole caratterizzate dalla presenza di un gruppo aminico (basico) ed un gruppo acido che costituiscono la parte costante della molecola e da un residuo variabile che conferisce ad ogni aminoacido caratteristiche diverse. Il gruppo acido di un aminoacido ed il gruppo basico dell aminoacido successivo si uniscono tra loro tramite un legame covalente forte chiamato legame peptidico. La ripetizione lineare di questi legami peptidici costituisce lo scheletro della catena polipeptidica. I residui, che costituiscono la parte variabile, possono interagire tra loro. Residui apprtenenti ad aminoacidi distanti tra loro possono interagire tramite legami deboli portando ad un ripiegamento della catena lineare della proteina. Queste interazioni sono alla base della struttura 3d della proteina.

8 Gli aminoacidi Esistono 20 diversi aminoacidi che combinati tra loro costituiscono tutte le proteine contenute negli organismi viventi. Questi aminoacidi hanno struttura chimica e proprietà diverse.

9 Gli aminoacidi Sulla base delle caratteristiche del loro gruppo R gli aminoacidi possono essere: Idrofobici Polari Acidi Basici Aromatici Piccoli Le interazioni tra gli aminoacidi, e quindi la struttura 3d finale della protena, saranno influenzate dalle caratteristiche chimiche degli stessi. Un aminoacido acido ed uno basico tendono ad interagire tra loro, mentre uno polare ed uno idrofobico no.

10

11 Le sequenze proteiche. L informazione Così come già visto per le sequenze di DNA o RNA, che vengono rappresentate come stringhe composte dal susseguirsi di 4 possibili caratteri che corrispondono ai 4 possibili nucleotidi, anche le sequenze proteiche possono essere rappresentate da stringhe. In questo caso i possibili aminoacidi sono 20 e di conseguenza anche l alfabeto utilizzatò nelle sequenze proteiche è costituito da (almeno) 20 caratteri. HQVKVQGCWGRWRWQEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSL LYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFC PLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFV TADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPKPQLQL TLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPGGGGVGPGPGAAGPMLGGVVELA AASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSA HSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLA RDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHW RSNVSANNNSGSRCPESWDPVSAGCHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLA PAPCLVTPSWTETASSGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEV SAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGG YEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDS AYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPS GLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAA LEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAESQSARNLRSLLKMPSLLSETFCEDL

12 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cennu sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

13 La necessità di codificare l informazione L informazione genica passa del DNA all RNA. L informazione contenuta in queste molecole è simile, ed il meccanismo di trasmissione dell informazione (la complementarietà delle basi) permette di copiare l informazione del DNA sull RNA utilizzando lo stesso alfabeto (con l eccezione dell utilizzo dell U al posto della T) AATGTATTC TTACATAAG AAUGUAUUC TTACATAAG Nel passaggio da RNA a proteina il tipo di informazione cambia notevolmente. Si deve passare da un alfabeto chimico basato su 4 diversi nucleotidi ad un alfabeto chimico basato su 20 diverse aminoacidi. L impossibilità di mantenere una corrispondeza univoca tra nucleotide ed aminoacido impone l utilizzo di una codifica

14 La necessità di codificare l informazione Se ci fosse una corrispondenza 1 a 1 tra nucleotide ed aminoacido si potrebbero utilizzare soltanto 4 aminoacidi per costruire una proteina. Se la corrispondenza fosse 2 ad 1 si potrebbero specificare 16 (4*4) aminoacidi. Sfortunatamente gli aminoacidi sono 20: sono quindi necessari 3 nucleotidi per identificare tutti gli aminoacidi esistenti. Le possibili combinazioni di 3 nucleotidi sono 64 (4*4*4). Poichè gli aminoacidi sono solo 20 esiste una surplus informativo di 44 triplette. La tabella n*m che mette in relazione le 64 possibili triplette di nucleotidi e i 20 aminoacidi è chiamata codice genetico. Il codice genetico è universale: una tripletta codifica lo stesso aminoacido in (quasi) tutti gli organismi viventi. Le triplette di nucleotidi sull mrna vengono chiamate CODONI

15 Il fenomeno per il quale esistono diverse triplette che codificano per lo stesso aminoacido è definito come degenerazione del codice La maggior parte degli aminoacidi è codificata da 2 o più triplette. La metionina è codificata solo dal codone AUG che rappresenta anche il codone di inizio della sintesi proteica. I codoni UGG UAA e UAG sono chiamati codoni di STOP. Ad essi con corrisponde nessun aminoacido ma rappresentano i segnali di terminazione per la sintesi proteica. F I R S T B A S E U C A G UUU UUC UUA UUG CUU CUC CUA CUG U S E C O N D B A S E Phe Leu Leu AUU AUC AUA AUG Met/ Ile start GUU GUC Val GUA GUG C UCU UCC UCA UCG CCU CCC CCA CCG Ser Pro ACU ACC Thr ACA ACG GCU GCC Ala GCA GCG UAU UAC UAA UAG CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG A Tyr Stop His Gln Asn Lys Asp Glu G UGU UGC UGA UGG CGU CGC Arg CGA CGG AGU AGC AGA AGG Cys Stop Trp Ser Arg GGU GGC Gly* GGA GGG U C A G U C A G U C A G U C A G T H I R D B A S E

16 Le conseguenze della degenerazione del codice E sempre possibile passare dall informazione contenuta nei nucleotidi alla corrispondente sequenza proteica: ad ogni tripletta può essere associato uno ed un solo aminoacido. Non è mai possibile ottenere, in modo univoco, una sequenza nucleotidica a partire dalla sequenza proteica da essa generata Sequenza proteica MEFGLKEFLLNPSTPEGKLTPQRQTNPVWYACAWA AUG GAG GAA UUU UUC GGA GGC GGG La retrotraduzione non è risolvibile in maniera esatta e non può essere dai sistemi biologici. GGU

17 Il vacillamento della terza base I CODONI CHE RAPPRESENTANO LO STESSO A.A., O A.A. CORRELATI, HANNO SEQUENZE SIMILI. SPESSO LA BASE CHE OCCUPA LA TERZA POSIZIONE DEL CODONE NON E SIGNIFICATIVA, COME DIMOSTRA IL FATTO CHE NEI GRUPPI DI 4 CODONI CHE RAPPRESENTANO LO STESSO A.A., SOLO LA TERZA BASE E DIFFERENTE.

18 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cennu sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

19 La sintesi proteica viene chiamata anche traduzione poiché durante questo processo l informazione contenuta nell RNA messaggero viene tradotta utilizzando il codice genetico in una sequenza di aminoacidi. Durante la traduzione l mrna interagisce con i macchinari molecolari deputati alla sintesi delle proteine: i RIBOSOMI. I ribosomi sono complessi formati da proteine ed RNA ribosomiale. L RNA ribosomiale ha funzione strutturale ma anche catalitica. Nel ribosoma delle particolari molecole di RNA chiamate RNA transfer (trna) traducono l informazione dell RNA messaggero in sequenza aminoacidica. Sono degli accoppiatori molecolari: da una parte hanno le funzioni molecolari per interagire con l RNA mentre dall altra parte trasportano aminoacidi specifici.

20 I Ribosomi IL RIBOSOMA E UNO DEI TANTI MACCHINARI CELLULARI. E costituito da RNA (rrna) E PROTEINE (DETTE, PER L APPUNTO, RIBOSOMALI). I RIBOSOMI CONSTANO DI DUE SUBUNITA : SUBUNITA MAGGIORE (IMPLICATA NELLA FORMAZIONE DEI LEGAMI PEPTIDICI); SUBUNITA MINORE (DOVE I trna SI ADATTANO AI CODONI DELL mrna). CIASCUNA SUBUNITA E UN AGGREGATO DI rrna E PROTEINE RIBOSOMALI.

21 I Ribosomi QUANDO NON STANNO SINTETIZZANDO ATTIVAMENTE PROTEINE, LE DUE SUBUNITA DEI RIBOSOMI SONO SEPARATE. ESSE SI UNISCONO INSIEME SU UNA MOLECOLA DI mrna IN GENERE VICINO ALLA SUA ESTREMITA 5 PER INIZIARE LA SINTESI PROTEICA.

22 I trna Sono molecole adattatrici che legano e trasportano aminoacidi specifici. Due porzioni particolarmente importanti sono: ANTICODONE : sequenza di 3 nucleotidi complementari al codone corrispondente all aminoacido legato al trna. Sito di attacco dell aa. : sequenza 5 - CCA-3, uguale in tutti trna. MET

23 I trna L anticodone si appaia in maniera specifica al codone sull mrna in modo da permettere al trna di trasportare l aminoacido corrispindente quando questo viene richiesto dalla informazione contenuta sul messaggero MET AUG UUAGCUUCGCGAUAUC

24 Quanti sono i trna? UNA LOGICA DEDUZIONE PER QUANTO DETTO FIN ORA E CHE DOVREBBERO ESSERCI 61 trna DIVERSI, UNO PER CIASCUN CODONE; CIO IMPLICHEREB BE DUE COSE: 1. GRANDE CONSUMO ENERGETICO DA PARTE DELLA CELLULA; 2. trna AVENTI ANTICODONI DIFFERENTI DEVONO PORTARE LO STESSO aa. IN REALTA QUESTA CONDIZIONE E VERA SOLO PER ALCUNI trna, PER LA MAGGIORPARTE (NELL UOMO ESISTONO INFATTI SOLO 48 ANTICODONI DIFFERENTI A FRONTE DEI TEORICI 61 POSSIBILI), PERO, SUSSISTE IL FENOMENO DEL VACILLAMENTO DELLA TERZA BASE, PER CUI SI POSSONO FORMARE LEGAMI ANCHE NON ORTODOSSI FRA IL NUCLEOTIDE IN POSIZIONE 5 DEL trna E IL NUCLEOTIDE IN 3 DELL mrna.

25 Le fasi della traduzione 1) Inizio: la subunità minore del ribosoma si lega al messaggero. Il primo trna (quello della fmet) con anticodone complementare alla tripletta AUG, che rappresenta il segnale di inizio, si lega in corrispondeza del codone. Questo scatena il legame della subunità maggiore e l inzio della traduzione. 2) Allungamento: il ribosoma si sposta in direzone 3 sul mrna. I trna si lagano uno dopo l altro ai codoni che via via vengono incontrati dal ribosoma mentre legge il filamento ribonucleotidico. Il ribosoma catalizza di volta in volta il legame tra l aminoacido già presente all interno del sito attivo ed il nuovo aminoacido appena entrato nel ribosoma allungando la catena proteica nascente di un aminoacido alla volta. 3) Terminazione: Quando il ribosoma incontra un segnale di stop nessun trna si lega al sito attivo del ribosoma. Si lagano invece specifici fattori di terminazione proteici che interrompono la traduzione e facilitano la destabilizzazione del complesso.

26 L inizio della traduzione fmet La traduzione inizia col riconoscimento dell mrna da parte della subunità minore. Il legame del trna della fmet (con anticodone complementare ad AUG) permette il legame della subunità maggiore. Large subunit E P A 5 UAC GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA Small mrna subunit 3

27 La fase di allungamento Un nuovo aminoacil trna (complesso tra trna ed il suo aminoacido corrispondente) entra nel sito A del ribosoma. Il suo anticodone è complementare al codone che si trova in corrispondenza del sito A. Il primo aminoacido (la metionina) presente nel sito P si troverà quindi vicino ad un nuovo aminoacido appena trasportato dal suo trna. La subunità maggiore del ribosoma catalizza il legame di questo nuovo aminoacodo con la metionina. Il legame della metionina con il suo trna viene rotto.

28 La fase di allungamento A questo punto abbiamo un trna scarico nel sito P, un trna legato alla catena nascente (di due aminoacidi, al momento) nel sito A. Il ribosoma si sposta a sinistra sull mrna: il trna vuoto viene liberato nel citoplasma, il trna legato a 2 aminoacidi viene spostato nel sito P ed il sito A è di nuovo disponobile per l attacco di un nuovo aminoacil-trna. Il processo viene iterato allungando ogni volta la catena nascente di un aminoacido, seguendo le istruzioni scritte sul messaggero.

29 La fine della traduzione Quando il ribosoma, legato alla catena proteica nascente, raggiunge un codone di stop, invece di un aminoacil-trna, nel sito A si lega un fattore di terminazione. La proteina nascente lascia il suo trna, il ribosoma si destabilizza e la sintesi della proteina finisce.

30 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

31 Le strutture delle proteine Abbiamo visto come le proteine vengono sintetizzate come lunghe catene lineari. La mera sequenza di aminoacidi della proteina viene definita struttura primaria. Ma gli aminoacidi di una proteina possono andare incontro ad interazioni che ne influenzano il ripiegamento nello spazio. La forma di una proteina ne influenzerà la funzione

32 I 4 livelli strutturali delle proteine Struttura primaria: sequenza di aminoacidi Struttura secondaria: formazione di ripiegamenti regolari locali (alfa elica o foglietto beta) Struttura terziaria: formazione di una conformazione tridimensionale definitiva per interazione di più strutture globali Struttura quaternaria: interazione tra diversi polipetidi (subunità) per la formazione di un complesso proteico completo e funzionale.

33 SPESSO IN UN PEPTIDE SI TROVANO DUE SCHEMI REGOLARI DI RIPIEGAMENTO: L α-elica E IL FOGLIETTO β. ENTRAMBI DERIVANO DALLA FORMAZIONE DI LEGAMI H FRA I GRUPPI N-H E C=O DELL OSSATURA POLIPEPTIDICA, SENZA COINVOLGERE LE CATENE LATERALI DEGLI aa.

34 α-elica SI FORMA QUANDO UNA SIGOLA CATENA POLIPEPTIDICA SI AVVOLGE SU SE STESSA PER FORMARE UN CILINDRO RIGIDO: IN PARTICOLARE SI INSTAURA UN LEGAME H FRA UN LEGAME PEPTIDICO E IL QUARTO SUCCESSIVO; SI GENERA COSI UN ELICA REGOLARE DI PASSO UGUALE A 3,6 aa (CIOE 5,4Å). TIPICAMENTE, BREVI REGIONI AD α-elica SONO ABBONDANTI IN PROTEINE POSTE NELLE MEMBRANE CELLULARI (ES.: PROTEINE DI TRASPORTO E RECETTORI); IN ALTRE PROTEINE α-eliche SI AVVOLGONO L UNA INTORNO ALL ALTRA PER FORMARE STRUTTURE STABILI NOTE COME COILED- COIL. (ES.: α-cheratina O MIOSINA). α-elica COILED-COIL

35 FOGLIETTO β (O β-sheet) SI FORMANO PER LEGAMI H TRA GRUPPI PEPTIDICI ADIACENTI APPARTENENTI A CATENE POLIPETIDICHE DIFFERENTI CHE POSSONO DECORRERE PARALLELE OD ANTI-PARALLELE (PARALLELE SE HANNO LO STESSO ORIENTAMENTO N-TERMINALE / C-TERMINALE; ANTIPARALLELE SE UNA DECORN-TERMINALE / C-TERMINALE IN DIREZIONE NORD-SUD O EST-OVEST E L ALTRA N-TERMINALE / C-TERMINALE IN DIREZIONE SUD-NORD O OVEST-EST). I FOGLIETTI BETA COSTITUISCONO IL CORE DI MOLTE STRUTTURE PROTEICHE FOGLIETTO β (O β-sheet)

36 a elica - loop - a elica: è presente in molte proteine che legano il Ca (calmodulina e troponina C). b-turn: due filamenti b antiparalleli uniti da un breve loop di 2-5 residui. chiave greca: per formare questo motivo occorrono (minimo) quattro filamenti b, due brevi loop e un loop più lungo. b-a-b: è costituito da due filamenti b paralleli, intercalati da un'a-elica.

37 La struttura terziaria

38 La struttura quaternaria A VOLTE LE PROTEINE CONSTANO DI PIU SUBUNITA PEPTIDICHE (CIASCUNA GIA RIPIEGATA NELLA SUA STRUTTURA 3D) CHE INTERAGISCONO TRA LORO TRAMITE LEGAMI NON COVALENTI (LEGAMI H ED INTERAZIONI IDROFOBICHE PRINCIPALMENTE) A FORMARE UN UNICA STRUTTURA FUNZIONALE: LA PRO= TEINA AVENTE STRUTTURA QUATERNARIA. Es.:PROTEINA EMOGLOBINA

39 I livelli di organizzazione di una proteina

40 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

41 Il genotipo di un individuo è dato dal suo corredo genetico, è ciò che è "scritto" nel DNA contenuto nel nucleo di tutte le sue cellule ed è quindi immutabile. Il fenotipo, invece, è l'insieme dei caratteri che l'individuo manifesta: dipende dal suo genotipo, dalle interazioni fra geni e anche da fattori esterni; dunque può variare. IL GENOTIPO È l informazione genetica IL FENOTIPO È il modo in cui questa viene espressa

42 Il padre della genetica è Mendel. Nel tempo libero amava fare esperimenti incroviando diverse varietà della pianta dei piselli. Fu lui a definire per la prima volta i concetti di genotipo e fenotipo. Una pianta con seme giallo, incrociata con una pianta con seme giallo dava sempre progenie con seme giallo. Una pianta con seme verde, incrociata con una pianta con seme verde dava sempre progenie con seme verde. Una pianta con seme giallo, incrociata con una pianta con seme verde dava sempre progenie con seme giallo. Il giallo è DOMINANTE

43 Il bello viene adesso: Se incrociamo le piante a seme giallo originate dai genitori misti (seme giallo e seme verde) non otteniamo più solo piante a seme giallo ma anche qualche piantina a seme verde!!!. Le piante a seme giallo che incrociate tra loro danno sempre seme giallo e le piante a seme giallo che incrociate tra loro danno ANCHE piante a seme verde sono FENOTIPICAMENTE IDENTICHE (hanno seme giallo) ma GENOTIPICAMENTE le seconde hanno l informazine per esprimere il carattere seme verde quindi sono GENOTIPICAMETE DIFFERENTI.

44 I Sintesi: Il FENOTIPO dipende dal GENOTIPO ma FENOTIPI identici possono avere GENOTIPI diversi!

45 Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

46 Come abbiamo detto le mutazioni sono variazioni della sequenza di basi nel DNA. Le mutazioni possono avere diversi effetti a seconda: Della loro natura (tipo di mutazione) Della loro posizione (dove avvengono)

47 Mutazioni puntiformi Le mutazioni di più piccola entità sono le mutazioni puntiformi: Sono caratterizzate dalla sostituzione di un nucleotide con un altro ACTGTTGCTACTGGCGCGTT Sono definite: ACTGTTGCTAATGGCGCGTT transizioni qualora vi è un scambio di una purina con altra purina (A G) o di una pirimidina con un'altra pirimidina (C T) transversioni quando lo scambio è di una purina con un a pirimidina o viceversa (C/T A/G).

48 Inserzioni e delezioni (indel) Le mutazioni più gravi sono le mutazioni indel: Sono caratterizzate dalla inserzione o delezione di uno o più nucleotidi ACTGTTGCTACTGGCGCGTT ACTGTTGCTACATGGCGCGTT Possono causare uno spostamento della fase di lettura (frameshift): ACTGTTGCTACTGGCGCGTT ACTGTTGCTACATGGCGCGTT Tutta la zona a valle della mutazione verrà influenzata. La probabilità di formare codoni di stop prematuri è elevata (proteina troncata)

49 La posizione della mutazione Le mutazioni possono cadere: In una regione genica (compresa tra l inizio e la fine di un gene) In una regione intergenica La mutazione in una regione intergenica, di solito, non ha nessun effetto sul fenotipo, e sono quindi maggiormente tollerate dalla selezione naturale. Tuttavia in alcuni rari casi le mutazioni possono interferire con il riconoscimento del DNA da alcune proteine regolatrici ed interferire con alcuni processi cellulari essenziali.

50 Mutazioni al interno della regione genica Se la mutazione avviene in questa regione si possono avere diverse eventualità: La mutazione è avvenuta nella regione codificante: l informazione trascritta nell mrna maturo cambia. La mutazione è avvenuta in un introne: l informazione trascritta nell mrna maturo non cambia (almeno, non sempre) La mutazione è avvenuta in una regione regolatrice (promotore, enhancer, silencer): la regolazione (produzione di mrna) può essere influenzata.

51 Mutazioni nella regione codificante L mrna viene alterato. Se si tratta di una mutazione puntiforme un solo codone verrà cambiato in un altro. Esistono tre tipi di mutazioni puntiformi: mutazioni sinonime: quando la mutazione determina un codone diverso ma che codifica per lo stesso amminoacido (questo è possibile grazie alla ridondanza del nostro codice genetico ). Non si avrà alcun cambiamento nel prodotto genico. mutazioni di senso errato: quando un codone viene sostituito con uno che codifica per un altro amminoacido. Se quest'ultimo avrà le stesse caratteristiche chimiche (dimensione, carica...) allora la sostituzione sarà conservativa altrimenti non conservativa. E' chiaro che il secondo caso rende più probabile una variazione nella funzionalità del prodotto. mutazioni non senso: quando la mutazione determina la formazione di un codone di stop all'interno della sequenza. Questo provoca, se il prodotto è una proteina, un'interruzione precoce della sua sintesi nella traduzione. In generale maggiore sarà il frammento non tradotto maggiore sarà il rischio di una mutazione svantaggiosa. Se si tratta di una mutazione indel tutti i codoni a valle delle mutazione verranno cambiati.

52 Mutazioni in un introne Gli introni vengono di solito alterati, quindi la mutazione potrebbe non avere alcun effetto però: Lo splicing alternativo potrebbe considerare come esone l introne in cui è avvenuta la mutazione con conseguente possibilità di variazione nel prodotto proteico (vedi caso precedente) Se la mutazione avviene in corrispondenza dei siti accettore o donatore di splicing questo processo potrebbe non avvenire correttamente.

53 Mutazioni in regione regolatrice La regolazione del gene potrebbe essere alterata: - Mancata produzione di mrna - Ridotta produzione di mrna - Aumentata produzione di mrna

Biologia Molecolare. CDLM in CTF La riparazione del DNA

Biologia Molecolare. CDLM in CTF La riparazione del DNA Biologia Molecolare CDLM in CTF 2010-2011 La riparazione del DNA I tipi di mutazione e le conseguenze Le classi di danno al DNA Meccanismi di riparazione La necessità di codificare l informazione L informazione

Dettagli

Biologia Molecolare. CDLM in CTF 2010-2011 La modificazione dell RNA e la traduzione

Biologia Molecolare. CDLM in CTF 2010-2011 La modificazione dell RNA e la traduzione Biologia Molecolare CDLM in CTF 2010-2011 La modificazione dell RNA e la traduzione La maturazione del trascritto primario I microrna Le componenti del macchinario di traduzione Il meccanismo della traduzione

Dettagli

La sintesi delle proteine

La sintesi delle proteine La sintesi delle proteine Struttura del trna In che modo l informazione contenuta sotto forma di sequenze nucleotidiche nel DNA e nell RNA si traduce nella sequenza amminoacidica delle proteine? Esperimenti

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione rof. Giorgio Sartor Sintesi proteica Copyright 2001-2013 by Giorgio Sartor. All rights reserved. B15 -Versione 1.0 nov2013 Trasmissione dell informazione L informazione è contenuta nel DA ed è trasferita

Dettagli

LE AUGURO BUON LAVORO!

LE AUGURO BUON LAVORO! Nome:. Cognome:...... Pt./137 Nota ESAME DI SCIENZE SPERIMENTALI: BIOLOGIA Indicazioni: 1. Risponda sempre negli spazi indicati; non separi né scriva sul retro dei fogli. 2. Scriva, o, laddove richiesto,

Dettagli

www.fisiokinesiterapia.biz TRASCRIZIONE

www.fisiokinesiterapia.biz TRASCRIZIONE www.fisiokinesiterapia.biz TRASCRIZIONE TRASCRIZIONE Processo mediante il quale una sequenza di DNA (un gene) viene copiata in una sequenza di RNA Dalla trascrizione derivano gli mrna, che verranno tradotti

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

TRADUZIONE. 2. Transfer (legato agli aminoacidi) 3. Ribosomale (associato a proteine nei ribosomi)

TRADUZIONE. 2. Transfer (legato agli aminoacidi) 3. Ribosomale (associato a proteine nei ribosomi) enhancer promotore regione trascritta TATA trascrizione 5 3 splicing mrna 5 3 traduzione Proteina NH2 COOH Funzione biologica TRADUZIONE I tre ruoli svolti dall RNA: 1. Messaggero 2. Transfer (legato agli

Dettagli

La traduzione: dall mrna alle proteine

La traduzione: dall mrna alle proteine La traduzione: dall mrna alle proteine Le infezioni batteriche sono una grave causa di malattie e morte in Europa e negli USA. Le infezioni batteriche si curano con antibiotici che colpiscono l espressione

Dettagli

TRADUZIONE LA TRADUZIONE E QUEL PROCESSO ATTRAVERSO CUI SI PASSA DAL LINGUAGGIO RIBONUCLEOTIDICO DELL RNA A QUELLO AMINOACIDICO DELLE PROTEINE. IL CODICE GENETICO E L INSIEME DI CODONI (TRIPLETTE NUCLEOTIDICHE)

Dettagli

LA TRADUZIONE E IL CODICE GENETICO

LA TRADUZIONE E IL CODICE GENETICO LA TRADUZIONE E IL CODICE GENETICO La traduzione La traduzione è il processo di sintesi di una catena polipeptidica, un polimero costituito da amminoacidi legati insieme da legami peptidici Le molecole

Dettagli

Struttura e funzione dei geni. Paolo Edomi - Genetica

Struttura e funzione dei geni. Paolo Edomi - Genetica Struttura e funzione dei geni 1 Il DNA è il materiale genetico La molecola di DNA conserva l informazione genetica: topi iniettati con solo DNA di batteri virulenti muoiono 2 Proprietà del DNA Il DNA presenta

Dettagli

Produzione di proteine eterologhe. Cosa occorre per l espressione l livello di una proteina nella cellula? Trascrizione/traduzione/stabilità

Produzione di proteine eterologhe. Cosa occorre per l espressione l livello di una proteina nella cellula? Trascrizione/traduzione/stabilità Cosa occorre per l espressione l ad alto livello di una proteina nella cellula? Trascrizione/traduzione/stabilità Promotore forte (trascrizione) Presenza di segnali per il riconoscimento dell mrna da parte

Dettagli

Dal DNA alle proteine: La trascrizione e la traduzione

Dal DNA alle proteine: La trascrizione e la traduzione Dal DNA alle proteine: La trascrizione e la traduzione DNA RNA Trascrizione RNA PROTEINE Traduzione Dove avvengono? GLI EUCARIOTI I PROCARIOTI Cambell, Reece Biologia ZANICHELLI Trascrizione Sintesi di

Dettagli

V. TRASCRIZIONE E TRADUZIONE DEL DNA

V. TRASCRIZIONE E TRADUZIONE DEL DNA V. TRASCRIZIONE E TRADUZIONE DEL DNA 0) CONCETTI BASE La trasformazione delle informazioni genetiche in proteine richiede due passaggi: la trascrizione del DNA in mrna e la traduzione dell mrna in una

Dettagli

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza

Dettagli

SINTESI PROTEICA. Replicazione. Trascrizione. Traduzione

SINTESI PROTEICA. Replicazione. Trascrizione. Traduzione Replicazione SINTESI PROTEICA Trascrizione Traduzione 61 codoni codificanti 3 triplette non senso (STOP) AUG codone di inizio codone per Met Caratteristiche del codice genetico Specificità Il codice genetico

Dettagli

SAGGIO DI LEGAME AI RIBOSOMI: SE L AMMINOACIL-tRNA RICONOSCE LA TRIPLETTA, VI SI LEGA E NON RIESCE A PASSARE IL FILTRO CHE, COSì, DIVIENE RADIOATTIVO.

SAGGIO DI LEGAME AI RIBOSOMI: SE L AMMINOACIL-tRNA RICONOSCE LA TRIPLETTA, VI SI LEGA E NON RIESCE A PASSARE IL FILTRO CHE, COSì, DIVIENE RADIOATTIVO. TRADUZIONE LA TRADUZIONE E QUEL PROCESSO ATTRAVERSO CUI SI PASSA DAL LINGUAGGIO RIBONUCLEOTIDICO DELL RNA A QUELLO AMINOACIDICO DELLE PROTEINE. IL CODICE GENETICO E L INSIEME DI CODONI (TRIPLETTE NUCLEOTIDICHE)

Dettagli

Trascrizione e maturazione degli RNA

Trascrizione e maturazione degli RNA Trascrizione e maturazione degli RNA Trascrizione e traduzione: espressione dell informazione genica L RNA veicola l informazione genica contenuta nel DNA (nucleo) in modo che possa esprimersi per dare

Dettagli

Traduzione dell informazione genetica (1)

Traduzione dell informazione genetica (1) Traduzione dell informazione genetica (1) 1 Traduzione dell informazione genetica (2) Il processo negli eucarioti richiede: 70 diverse proteine ribosomiali >20 enzimi che attivano i precursori degli amminoacidi

Dettagli

Alcune domande di carattere evolutivo

Alcune domande di carattere evolutivo Alcune domande di carattere evolutivo 1. Perché tutti gli organismi viventi (a parte le solite, rare, eccezioni usano lo stesso insieme di 20 aminoacidi? Interrelazioni tra organismi 2. Perché gli amino

Dettagli

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE?

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE? DNA E PROTEINE NUMEROSI DATI SUGGERISCONO CHE IL DNA SVOLGA IL SUO RUOLO GENETICO CONTROLLANDO LA SINTESI DELLE PROTEINE, IN PARTICOLARE DETERMINANDONE LA SEQUENZA IN AMINOACIDI E NECESSARIO RISPONDERE

Dettagli

Replicazione del DNA

Replicazione del DNA Replicazione del DNA la replicazione del DNA viene effettuata da ENZIMI: DNA-polimerasi (catalizza la formazione del legame fosfodiestere) ogni filamento fa da stampo (enzima diretto dallo stampo) le DNA-polimerasi

Dettagli

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine)

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine) TRADUZIONE I RIBOSOMI I Ribosomi hanno un diametro di circa 15-30 nm, sono costituiti da proteine ed rrna e sia nei Procarioti che negli Eucarioti, sono costituiti da una subunità maggiore e da una subunità

Dettagli

Elementi di Bioinformatica. Genomica. Introduzione

Elementi di Bioinformatica. Genomica. Introduzione Corso di Elementi di Bioinformatica Ingegneria Biomedica AA 2013-14 Elementi di Bioinformatica Genomica Introduzione Genomica Genomica (genomics) Riguarda lo studio del genoma degli organismi viventi e,

Dettagli

Sintesi e degradazione delle proteine

Sintesi e degradazione delle proteine Prof. Giorgio Sartor Sintesi e degradazione delle proteine Copyright 2001- by Giorgio Sartor. All rights reserved. B15 - Versione 1.4.1 may Trasmissione dell informazione L informazione è contenuta nel

Dettagli

Il Codice Genetico. La decodifica della sequenza nucleotidica in. sequenza aminoacidica

Il Codice Genetico. La decodifica della sequenza nucleotidica in. sequenza aminoacidica Il Codice Genetico La decodifica della sequenza nucleotidica in sequenza aminoacidica La sequenza del mrna viene letta a gruppi di 3 nucleotidi, senza interruzioni e senza sovrapposizioni; 4 3 = 64 ---------64

Dettagli

La regolazione genica nei eucarioti

La regolazione genica nei eucarioti La regolazione genica nei eucarioti Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri Differenziamento negli eucarioti pluricellulari Negli eucarioti le cellule specializzate dei vari tessuti contengono

Dettagli

Si tratta di corpiccioli di natura ribonucleoproteica che nel citoplasma di tutte le cellule presiedono ai processi di sintesi proteica.

Si tratta di corpiccioli di natura ribonucleoproteica che nel citoplasma di tutte le cellule presiedono ai processi di sintesi proteica. I R I BOSOM I I RIBOSOMI sono organuli citoplasmatici presenti in tutte le cellule, sia procariotiche che eucariotiche. Sono visibili al M.O. solo quando presenti in gran numero, (come capita nelle cellule

Dettagli

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi Sommario Introduzione Cenni di biologia Modello di Adleman Modello

Dettagli

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA.

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. In genere si ottengono trattando il DNA con agenti chimici (es.

Dettagli

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario Il DN e la duplicazione cellulare Il DN, materiale ereditario Struttura del DN Replicazione del DN Dal DN alla proteina Il odice genetico iclo cellulare Mitosi Meiosi Da Figura 8-11 ampbell & Reece cidi

Dettagli

esperto prof. Ciro Formica

esperto prof. Ciro Formica esperto prof. Ciro Formica Immagini e testi tratti dai website di: genome.wellcome.ac.uk, dnaftb.org, unipv.it, unimi.it, wikipedia.it, unibs.it, unisi.it, unina.it, uniroma2.it, nih.gov, zanichelli.it,

Dettagli

L mrna ED IL CODICE GENETICO

L mrna ED IL CODICE GENETICO L mrna ED IL CODICE GENETICO LA SEQ. NUCLEOTIDICA DI UN GENE, PER MEZZO DELL mrna, E TRADOTTA NELLA SEQ. AMINOACIDICA DI UN PEPTIDE SEGUENDO REGOLE NOTE COME CODICE GENETICO. LA SUCCESSIONE CONSECUTIVA

Dettagli

Trascrizione e maturazione degli RNA

Trascrizione e maturazione degli RNA Trascrizione e maturazione degli RNA L RNA è sisntetizzato a partire dal DNA nel processo della trascrizione L RNA veicola l informazione genica contenuta nel DNA (nucleo) in modo che possa esprimersi

Dettagli

all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA

all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA Il Codice Genetico The genetic code consists of 64 triplet codons (A, G, C, U) 4 3 = 64 all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA AUG (methionine)

Dettagli

Il Codice Gene,co. Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del DNA

Il Codice Gene,co. Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del DNA Corso di Laurea in Chimica e Tecnologie Farmaceu,che a.a. 2014-2015 Università di Catania Il Codice Gene,co Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del

Dettagli

RNA polimerasi operone. L operatore è il tratto

RNA polimerasi operone. L operatore è il tratto La regolazione genica nei procarioti Alcune proteine vengono prodotte dalla cellula ad un ritmo relativamente costante e l attività dei geni che codificano queste proteine non è regolata in modo sofisticato.

Dettagli

Dal DNA all RNA. La trascrizione nei procarioti e negli eucarioti

Dal DNA all RNA. La trascrizione nei procarioti e negli eucarioti Dal DNA all RNA La trascrizione nei procarioti e negli eucarioti DOGMA CENTRALE DELLA BIOLOGIA MOLECOLARE Gene Regione di DNA che porta l informazione (= che CODIFICA) per una catena polipeptidica o per

Dettagli

IL FLUSSO DELL INFORMAZIONE GENETICA. DNA à RNA. RNA à PROTEINA. DNA à RNA à PROTEINA. Dogma centrale della biologia molecolare di Francis Crick, 1957

IL FLUSSO DELL INFORMAZIONE GENETICA. DNA à RNA. RNA à PROTEINA. DNA à RNA à PROTEINA. Dogma centrale della biologia molecolare di Francis Crick, 1957 IL FLUSSO DELL INFORMAZIONE GENETICA DNA à RNA à PROTEINA Dogma centrale della biologia molecolare di Francis Crick, 1957 DNA/RNA (seq polinucleotidica) DNA à RNA mrna trna rrna RNA à PROTEINA Proteina

Dettagli

INTERAZIONE TRA mrna, trna e RIBOSOMI

INTERAZIONE TRA mrna, trna e RIBOSOMI INTERAZIONE TRA mrna, trna e RIBOSOMI mrna: porta l'informazione della sequenza degli aminoacidi di una determinata proteina. trna: ogni trna è specifico per il trasporto di un determinato aminoacido Ribosoma:

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Le idee della chimica

Le idee della chimica G. Valitutti A.Tifi A.Gentile Seconda edizione Copyright 2009 Zanichelli editore Capitolo 25 Le basi della biochimica 1. I carboidrati 2. I lipidi 3. Gli amminoacidi, i peptidi e le proteine 4. La struttura

Dettagli

C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP.

C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP. Soluzioni ai problemi del Capitolo 13 Domande concettuali C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP. C2. Quando si dice che il

Dettagli

Corso di Biologia Molecolare

Corso di Biologia Molecolare Corso di Biologia Molecolare Dott.ssa Renata Tisi Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 renata.tisi@unimib.it Acidi nucleici Il ruolo degli acidi nucleici è quello di custodire e trasmettere

Dettagli

Lezione 1. Le molecole di base che costituiscono la vita

Lezione 1. Le molecole di base che costituiscono la vita Lezione 1 Le molecole di base che costituiscono la vita Le molecole dell ereditarietà 5 3 L informazione ereditaria di tutti gli organismi viventi, con l eccezione di alcuni virus, è a carico della molecola

Dettagli

DOGMA CENTRALE DELLA BIOLOGIA

DOGMA CENTRALE DELLA BIOLOGIA DOGMA CENTRALE DELLA BIOLOGIA REPLICAZIONE DEL DNA (SINTESI o DUPLICAZIONE) MODELLO SEMICONSERVATIVO Meselson e Stahl (1958) DNA POLIMERASI CROMOSOMA NON DUPLICATO CROMOSOMA DUPLICATO (CROMATIDI FRATELLI)

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA

TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA TRADUZIONE La traduzione e il processo con cui viene sintetizzata un data proteina, attraverso reazioni chimiche di polimerizzazione di amminoacidi, in una

Dettagli

26/11/2014 CITOSOL (3) Citosol Ribosomi Sintesi delle proteine nei ribosomi CITOSOL (2) CITOSOL (1)

26/11/2014 CITOSOL (3) Citosol Ribosomi Sintesi delle proteine nei ribosomi CITOSOL (2) CITOSOL (1) CITOSOL (3) Citosol Ribosomi Sintesi delle proteine nei ribosomi http://hyperphysics.phy astr.gsu.edu/hbase/biology/ribosome.html http://www.accessexcellence.org/rc/vl/gg/ecb/ecb_images/01_24_organelles.jpg

Dettagli

L mrna ED IL CODICE GENETICO

L mrna ED IL CODICE GENETICO L mrna ED IL CODICE GENETICO LA SEQ. NUCLEOTIDICA DI UN GENE, PER MEZZO DELL mrna, E TRADOTTA NELLA SEQ. AMINOACIDICA DI UN PEPTIDE SEGUENDO REGOLE NOTE COME CODICE GENETICO. LA SUCCESSIONE CONSECUTIVA

Dettagli

IL DOGMA CENTRALE DELLA BIOLOGIA RNA

IL DOGMA CENTRALE DELLA BIOLOGIA RNA La traduzione IL DOGMA CENTRALE DELLA BIOLOGIA Trascrizione DNA Passaggio dell informazione contenuta nel DNA mediante la sintesi di RNA RNA Proteine Duplicazione DNA Traduzione Costruzione della catena

Dettagli

Codoni di STOP: UAA UAG UGA

Codoni di STOP: UAA UAG UGA PARTECIPANO ALLA TRADUZIONE: trna e aminoacidi Aminoacil-tRNA sintetasi Ribosomi mrna, che contiene una Open Reading Frame (ORF) CODONE DI INIZIO CODONE DI STOP 5 Cap NNNNNN AUG AAA GCA AUU----(n codoni)----uga

Dettagli

FORMAZIONE DEL LEGAME PEPTIDICO

FORMAZIONE DEL LEGAME PEPTIDICO AMINOACIDI FORMAZIONE DEL LEGAME PEPTIDICO SEQUENZA AMINOACIDICA DELL INSULINA STRUTTURA SECONDARIA DELLE PROTEINE STRUTTURA TERZIARIA DELLE PROTEINE STRUTTURA QUATERNARIA DELLE PROTEINE Definizione Processi

Dettagli

LA GENETICA: DNA e RNA LA GENETICA. DNA e RNA. Prof. Daniele Verri

LA GENETICA: DNA e RNA LA GENETICA. DNA e RNA. Prof. Daniele Verri LA GENETICA DNA e RNA Prof. Daniele Verri L'acido desossiribonucleico o deossiribonucleico (DNA) è un acido nucleico che contiene le informazioni necessarie per la formazione di RNA e proteine. LA GENETICA:

Dettagli

Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza

Dettagli

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani LE MOLECOLE INFORMAZIONALI Lezioni d'autore Treccani Introduzione (I) I pionieri della biologia molecolare, scoperta la struttura degli acidi nucleici, pensarono di associare al DNA una sequenza di simboli,

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

LA SINTESI PROTEICA LE MOLECOLE CHE INTERVENGONO IN TALE PROCESSO SONO:

LA SINTESI PROTEICA LE MOLECOLE CHE INTERVENGONO IN TALE PROCESSO SONO: LA SINTESI PROTEICA La sintesi proteica è il processo che porta alla formazione delle proteine utilizzando le informazioni contenute nel DNA. Nelle sue linee fondamentali questo processo è identico in

Dettagli

Allineamento dei 2 RNA

Allineamento dei 2 RNA La traduzione 2 codone Allineamento dei 2 RNA anticodone Studi Molecolari hanno dimostrato che: 3 residui nucleotidici del mrna sono necessari per codificare ciascun amminoacido Il linguaggio contenuto

Dettagli

Genetica dei microrganismi

Genetica dei microrganismi Genetica dei microrganismi Dott.ssa Silvia Preziuso Dipartimento di Scienze Veterinarie Università di Camerino Sezione di Patologia Animale, Profilassi e Igiene degli Alimenti Argomenti trattati Gli acidi

Dettagli

proteasi (distrugge le proteine) batteri virulenti del ceppo S e del ceppo R

proteasi (distrugge le proteine) batteri virulenti del ceppo S e del ceppo R unità 1. La funzione del DN negli organismi La funzione del DN L acido desossiribonucleico o DN (dall inglese deoxyribonucleic acid) è la molecola informazionale delle cellule. Essa contiene e trasmette

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

Sintesi e degradazione delle proteine

Sintesi e degradazione delle proteine Prof. Giorgio Sartor Sintesi e degradazione delle proteine Copyright 2001-2012 by Giorgio Sartor. All rights reserved. B15 - Versione 1.4.2 may 2012 Trasmissione dell informazione L informazione è contenuta

Dettagli

Prof.ssa Gamba Sabrina. Lezione 7: IL DNA. Duplicazione e sintesi delle proteine

Prof.ssa Gamba Sabrina. Lezione 7: IL DNA. Duplicazione e sintesi delle proteine Prof.ssa Gamba Sabrina Lezione 7: IL DNA Duplicazione e sintesi delle proteine concetti chiave della lezione Costituzione fisico-chimica del DNA Basi azotate Duplicazione Concetto di geni Rna Trascrizione

Dettagli

IPOTESI UN GENE-UN ENZIMA

IPOTESI UN GENE-UN ENZIMA IPOTESI UN GENE-UN ENZIMA DNA: contiene tutte le informazioni per definire lo sviluppo e la fisiologia della cellula: ma come svolge questa funzione? Beadle e Tatum (1941): studiando mutanti della comune

Dettagli

ESPRESSIONE GENICA DOGMA CENTRALE DELLA BIOLOGIA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA)

ESPRESSIONE GENICA DOGMA CENTRALE DELLA BIOLOGIA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA) ESPRESSIONE GENICA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA) DOGMA CENTRALE DELLA BIOLOGIA ORGANIZZAZIONE GENE EUCARIOTICO PER UN mrna PROMOTORE TRASCRIZIONE 1) RNA POLIMERASI

Dettagli

Il flusso dell informazione genetica il ruolo dei polimeri di nucleotidi

Il flusso dell informazione genetica il ruolo dei polimeri di nucleotidi Il flusso dell informazione genetica il ruolo dei polimeri di nucleotidi trascrizione traduzione DNA RNA Proteina replicazione DNA replicazione: sintesi del DNA trascrizione: sintesi del RNA traduzione:

Dettagli

Il metabolismo dell RNA. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

Il metabolismo dell RNA. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie Il metabolismo dell RNA I vari tipi di RNA Il filamento di DNA che dirige la sintesi dello mrna è chiamato filamento stampo o filamento antisenso. L altro filamento che ha sequenza identica a quella dello

Dettagli

Dall RNA alle proteine. La traduzione nei procarioti e negli eucarioti

Dall RNA alle proteine. La traduzione nei procarioti e negli eucarioti Dall RNA alle proteine La traduzione nei procarioti e negli eucarioti Codice genetico La sequenza dell mrna viene decodificata a gruppi di tre nucleotidi, e tradotta in una sequenza di amminoacidi 4 x

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

Citosol Ribosomi Sintesi proteica

Citosol Ribosomi Sintesi proteica CITOSOL (1) Citosol Ribosomi Sintesi proteica Biotecnologie_2012 Tutta la porzione non strutturata che costituisce la parte liquida del citoplasma. In esso si trovano in soluzione tutte le molecole necessarie

Dettagli

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

C2. Il rilascio del fattore sigma marca il passaggio alla fase di allungamento della trascrizione.

C2. Il rilascio del fattore sigma marca il passaggio alla fase di allungamento della trascrizione. Soluzioni ai problemi del Capitolo 12 Domande concettuali C1. A. I geni dei trna codificano molecole di trna e i geni degli rrna le molecole di rrna che si trovano nei ribosomi. Esistono anche dei geni

Dettagli

RNA non codificanti ed RNA regolatori

RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori Piccoli RNA non codificanti RNA regolatore microrna RNAi e sirna Piccoli RNA non codificanti Gli RNA non codificanti (ncrna)

Dettagli

TEST Lo Studente Ricercatore edizione 2011

TEST Lo Studente Ricercatore edizione 2011 TEST Lo Studente Ricercatore edizione 2011 1. A chi soffre di colesterolo elevato è sconsigliato mangiare i crostacei, che ne contengono una quantità elevata. Dovrà pertanto eliminare dal suo menù soprattutto

Dettagli

07/01/2015. Come si ferma una macchina in corsa? Il terminatore. Terminazione intrinseca (rho-indipendente)

07/01/2015. Come si ferma una macchina in corsa? Il terminatore. Terminazione intrinseca (rho-indipendente) Come si ferma una macchina in corsa? Il terminatore Terminazione intrinseca (rho-indipendente) Terminazione dipendente dal fattore Rho (r) 1 Operoni: gruppi di geni parte di una unica unità trascrizionale

Dettagli

LA TRASCRIZIONE. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene

LA TRASCRIZIONE. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene LA TRASCRIZIONE Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene GLI ACIDI RIBONUCLEICI Nelle cellule nucleate la sintesi proteica avviene nel citoplasma, mentre il DNA si

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

E. Giordano 16/09/2010

E. Giordano 16/09/2010 GRUPPO NAZIONALE DI BIOINGEGNERIA XXIX Scuola Annuale BIOLOGIA SINTETICA Bressanone 13-17 settembre 2010 1/41 COSTITUENTI MOLECOLARI DELLO CHASSIS CELLULARE Emanuele GIORDANO II Facoltà di Ingegneria Dipartimento

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione

Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione CdL Tecnici di Lab Biomedico AA. 2011-12 - Prof.ssa Frabetti Come si esprime l informazione? Per i geni classici vedremo:

Dettagli

Dott.ssa Renata Tisi. Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 renata.tisi@unimib.it

Dott.ssa Renata Tisi. Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 renata.tisi@unimib.it Dott.ssa Renata Tisi Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 renata.tisi@unimib.it Il ruolo degli acidi nucleici è quello di custodire e trasmettere l informazione genetica nelle cellule,

Dettagli

Il flusso dell informazione genetica. DNA -->RNA-->Proteine

Il flusso dell informazione genetica. DNA -->RNA-->Proteine Il flusso dell informazione genetica DNA -->RNA-->Proteine Abbiamo visto i principali esperimenti che hanno dimostrato che il DNA è la molecola depositaria dell informazione genetica nella maggior parte

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA Email: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Il dogma centrale della biologia. molecolare

Il dogma centrale della biologia. molecolare Il dogma centrale della biologia Cell molecolare Transcription Translation Ribosome DNA mrna Polypeptide (protein) L informazione per la sintesi delle proteine è contenuta nel DNA. La trascrizione e la

Dettagli

Gerarchia della struttura delle proteine

Gerarchia della struttura delle proteine Si indica con CONFORMAZIONE la disposizione tridimensionale degli atomi di una molecola, cioè la loro organizzazione spaziale. Gerarchia della struttura delle proteine struttura primaria: sequenza degli

Dettagli

Il DNA: la molecola della vita

Il DNA: la molecola della vita Il DNA: la molecola della vita Gli acidi nucleici comprendono il DNA (acido desossiribonucleico) e l RNA (acido ribonucleico). Sono costituiti da molecole molto grandi, formate da unità dette nucleotidi,

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136)

ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) Il gene implicato nella SCA17 è il gene TATA box-binding protein (TBP) che fa parte del complesso della RNA polimerasi II ed è essenziale per dare inizio

Dettagli

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine MFN0366-A1 (I. Perroteau) -traduzione delle proteine trna Traduzione: mrna -------> proteine mrna MFN0366-A1 (I. Perroteau) -traduzione

Dettagli

mrna + 20 aminoacidi In vitro nulla

mrna + 20 aminoacidi In vitro nulla La sintesi proteica mrna + 20 aminoacidi In vitro nulla Il codice genetico I geni controllano la struttura delle proteine: in che modo? 4 nucleotidi A, T, C, G 20 aminoacidi Esiste un codice che converte

Dettagli

Risposta: 2. Uracile. Risposta: 2. legami idrogeno. Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA.

Risposta: 2. Uracile. Risposta: 2. legami idrogeno. Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA. Risposta: 2. Uracile Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA. La Timina si trova soltanto nel DNA; l Uracile si sostituisce alla Timina nelle molecole dell RNA. Risposta: 2. legami

Dettagli

trna-ribosoma Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano

trna-ribosoma Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano trna-ribosoma Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Struttura Acidi Nucleici RNA, DNA acidi nucleici = polinucleotidi (polimeri di nucleotidi) in cui

Dettagli

DNA non codificante ncdna

DNA non codificante ncdna DNA non codificante ncdna Teorie sul ruolo genetico RNAi e mirna Liberamente tratto dalla tesina del Dr. Emiliano Mancini ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti

Dettagli

Struttura ed espressione del Gene

Struttura ed espressione del Gene Struttura ed espressione del Gene PowerPoint Lectures for Essential Biology, Third Edition Neil Campbell, Jane Reece, and Eric Simon Essential Biology with Physiology, Second Edition Neil Campbell, Jane

Dettagli