BANCHE DATI DI SEQUENZE PROTEICHE E GENOMICHE E ANALISI DELLE SEQUENZE

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "BANCHE DATI DI SEQUENZE PROTEICHE E GENOMICHE E ANALISI DELLE SEQUENZE"

Transcript

1 Cittaro Davide BANCHE DATI DI SEQUENZE PROTEICHE E GENOMICHE E ANALISI DELLE SEQUENZE Caratterizzazione sequenza ID: BF La ricerca in entrez di BF da i seguenti risultati. IDENTIFIERS dbest Id: EST name: uy66d08.y1 GenBank Acc: BF GenBank gi: CLONE INFO Clone Id: Source: DNA type: PRIMERS Sequencing: PolyA Tail: IMAGE: (5') IMAGE Consortium, LLNL cdna Primer name ambiguous Unknown SEQUENCE TAACTTTGTACTAATTTTGGAGGGGAAACCATCTTTTTTAGATACACTTTAAAATGGAAA AACATTTCTTATGGATTCCATCAGGAGCTGTTTTAGGTGCAGTGAGAAATACCCTGCAGG TTCTGCTCAGCCTCTGCCAGTGGCTGCCTCACGTTCCCACAGCAAGACCTGGGAGGGACC TGCTGTGGAAGCTGTGGGTGCAGGCTGGGATAGATAGGGAGGGCATGCCTCGCTTTGGAT GAGGGATCCATTTAAACACTACCGTTTGGAATTGAGGGCTAGAAGGAGAACATGATTTCC TGCAGGAGGGACAAAGGCTGAGTGTTCACGTGCCAGCAGGCTCCAGAACACACCAGGGTT AAAGTTTAACTTTCTGTATGAATTCATTGTTGGGCCCAAATCCGCATAGGAGCACGGTGA TCCCGCGCTCGGGTTTCTGTAGCCTTTTCACAAGTC Quality: High quality sequence stops at base: 360 Entry Created: Oct Last Updated: Dec COMMENTS This clone is available royalty-free through LLNL ; contact the IMAGE Consortium for further information. MGI: LIBRARY Lib Name: McCarrey Eddy round spermatid Organism: Mus musculus Strain: CD-1 Sex: male Organ: testis Tissue type: round spermatids, pooled from multiple mice Develop. stage: 60 day Lab host: DH10B (phage-resistant) Vector: pbluescript SK+ (Stratagene) R. Site 1: XhoII R. Site 2: EcoRI Description: cdna oligo dt-primed [5'-(GA)10-ACTAGTCTCGAGTTTTTTTTTTTTT-3' ] and directionally cloned using 5' linkers 5'-AATTCGGCACGAG-3' and 5'-CTCGTGCCG-3'. Size selection of >400bp material gives average insert size ranging from 1-2

2 kb. Library was mass excised (from lambda-unizap-xr) and resulting single-stranded phagemids were prepped and tranformed into DH10B. Library contains 98.5% recombinants. References: J. Androl. 20: and Gene 25: Library constructed and donated by J. McCarrey, Ph.D. (Southwest Foundation for Biomedical Research, Dept. of Genetics); excision done by E.M. Eddy, Ph.D. (National Institutes of Health, National Institute of Environmental Health Sciences). Original lambda-based library is available through ATCC, catalog # SUBMITTER Name: Marra M/WashU-NCI Mouse EST Project 1999 Institution: Washington University School of Medicine Address: 4444 Forest Park Parkway, Box 8501, St. Louis, MO 63108, USA Tel: Fax: CITATIONS Title: The WashU-NCI Mouse EST Project 1999 Authors: Year: 1999 Status: Unpublished Marra,M., Hillier,L., Kucaba,T., Martin,J., Beck,C., Wylie,T., Underwood,K., Steptoe,M., Theising,B., Allen,M., Bowers,Y., Person,B., Swaller,T., Gibbons,M., Pape,D., Harvey,N., Schurk,R., Ritter,E., Kohn,S., Shin,T., Jackson,Y., Cardenas,M., McCann,R., Waterston,R., Wilson,R. MAP DATA Il confronto della EST trovata contro la banca dati con blastn ha dato i seguenti risultati: Sequences producing significant alignments: (bits) Value gi dbj AK Mus musculus adult female vagin gi dbj AK Mus musculus adult male colon c gi dbj AK Mus musculus adult male testis gi dbj AK Mus musculus adult male testis gi gb BC Homo sapiens, clone IMAGE: e-07 gi ref NM_ Homo sapiens hypothetical prot e-07 gi emb AL Human DNA sequence from clone RP e-07 gi dbj AK Homo sapiens cdna FLJ25604 fis, e-07 gi gb AC Homo sapiens chromosome 3 clone gi ref XM_ Rattus norvegicus similar to C gi ref XM_ Rattus norvegicus similar to C gi gb AC Homo sapiens chromosome 19 clone gi gb AC AC Homo sapiens chromosome gi gb AC AC Homo sapiens chromosome gi gb AF AF Mus musculus ribosomal pr gi dbj AK Mus musculus 9.5 days embryo pa Dei primi quattro risultati trovati, cioè gli allineamenti con le maggiori performances, riportiamo l allineamento:

3 >gi dbj AK Mus musculus adult female vagina cdna, RIKEN full-length enriched library, clone: l10 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence Length = 3339 Score = 904 bits (456), Expect = 0.0 Identities = 456/456 (100%) Strand = Plus / Plus Query: 1 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 60 Sbjct: 2209 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 2268 Query: 61 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 120 Sbjct: 2269 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 2328 Query: 121 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 180 Sbjct: 2329 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 2388 Query: 181 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 240 Sbjct: 2389 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 2448 Query: 241 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 300 Sbjct: 2449 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 2508 Query: 301 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 360 Sbjct: 2509 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 2568 Query: 361 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 420 Sbjct: 2569 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 2628 Query: 421 tcccgcgctcgggtttctgtagccttttcacaagtc 456 Sbjct: 2629 tcccgcgctcgggtttctgtagccttttcacaagtc 2664 >gi dbj AK Mus musculus adult male colon cdna, RIKEN full-length enriched library, clone: o22 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence Length = 2932 Score = 904 bits (456), Expect = 0.0 Identities = 456/456 (100%) Strand = Plus / Plus

4 Query: 1 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 60 Sbjct: 2233 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 2292 Query: 61 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 120 Sbjct: 2293 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 2352 Query: 121 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 180 Sbjct: 2353 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 2412 Query: 181 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 240 Sbjct: 2413 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 2472 Query: 241 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 300 Sbjct: 2473 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 2532 Query: 301 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 360 Sbjct: 2533 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 2592 Query: 361 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 420 Sbjct: 2593 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 2652 Query: 421 tcccgcgctcgggtttctgtagccttttcacaagtc 456 Sbjct: 2653 tcccgcgctcgggtttctgtagccttttcacaagtc 2688 >gi dbj AK Mus musculus adult male testis cdna, RIKEN full-length enriched library, clone: g01 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence Length = 3346 Score = 904 bits (456), Expect = 0.0 Identities = 456/456 (100%) Strand = Plus / Plus Query: 1 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 60 Sbjct: 2235 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 2294 Query: 61 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 120 Sbjct: 2295 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 2354

5 Query: 121 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 180 Sbjct: 2355 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 2414 Query: 181 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 240 Sbjct: 2415 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 2474 Query: 241 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 300 Sbjct: 2475 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 2534 Query: 301 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 360 Sbjct: 2535 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 2594 Query: 361 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 420 Sbjct: 2595 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 2654 Query: 421 tcccgcgctcgggtttctgtagccttttcacaagtc 456 Sbjct: 2655 tcccgcgctcgggtttctgtagccttttcacaagtc 2690 >gi dbj AK Mus musculus adult male testis cdna, RIKEN full-length enriched library, clone: l04 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence Length = 4398 Score = 904 bits (456), Expect = 0.0 Identities = 456/456 (100%) Strand = Plus / Plus Query: 1 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 60 Sbjct: 2337 taactttgtactaattttggaggggaaaccatcttttttagatacactttaaaatggaaa 2396 Query: 61 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 120 Sbjct: 2397 aacatttcttatggattccatcaggagctgttttaggtgcagtgagaaataccctgcagg 2456 Query: 121 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 180 Sbjct: 2457 ttctgctcagcctctgccagtggctgcctcacgttcccacagcaagacctgggagggacc 2516 Query: 181 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 240 Sbjct: 2517 tgctgtggaagctgtgggtgcaggctgggatagatagggagggcatgcctcgctttggat 2576

6 Query: 241 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 300 Sbjct: 2577 gagggatccatttaaacactaccgtttggaattgagggctagaaggagaacatgatttcc 2636 Query: 301 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 360 Sbjct: 2637 tgcaggagggacaaaggctgagtgttcacgtgccagcaggctccagaacacaccagggtt 2696 Query: 361 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 420 Sbjct: 2697 aaagtttaactttctgtatgaattcattgttgggcccaaatccgcataggagcacggtga 2756 Query: 421 tcccgcgctcgggtttctgtagccttttcacaagtc 456 Sbjct: 2757 tcccgcgctcgggtttctgtagccttttcacaagtc 2792 Alcune osservazioni preliminari possono essere fatte: - L allineamento con le quattro sequenze è totale. - Le quattro sequenze provengono da Mus musculus (da cui proviene anche la EST BF149559) - Le quattro sequenze sono caratterizzate in tre tessuti differenti di topo (tra cui il testicolo, da cui proviene la EST BF149559) Per il momento focalizziamo l attenzione sui due geni espressi nel testicolo (ID: AK e ID: AK029993): LOCUS AK bp mrna linear HTC 05-DEC-2002 DEFINITION Mus musculus adult male testis cdna, RIKEN full-length enriched library, clone: g01 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence. ACCESSION AK VERSION AK GI: KEYWORDS HTC; CAP trapper. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus. [..] FEATURES Location/Qualifiers source /organism="mus musculus" /strain="c57bl/6j" /db_xref="fantom_db: g01" /db_xref="mgi: " /db_xref="taxon:10090" /clone=" g01" /sex="male" /tissue_type="testis" /clone_lib="riken full-length enriched mouse cdna library" /dev_stage="adult" misc_feature /note="ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus] (SPTR Q9ERD6, evidence: FASTY, 90.1%ID,

7 100%length, match=1797) putative" /db_xref="mgi: " BASE COUNT 951 a 735 c 808 g 852 t ORIGIN 1 gggtggcgga ggccccggcg tcgcctcagc ctctcaggaa tgatgcattt gtggccttgg 61 acatgaagta atcagacctc tgttgctgtt actgtaggct caggggctga tgaggaaagc 121 atggacctaa tgaacgggca ggcaagcagt gttactatcg cagccactgt ttccgagaag 181 agtagcagct ctggcaccct aagcgagaag ggctaccgca cagatgcgta agttgatgct 241 accggtttga tgttcttaag gttacgccag aagaatacgc gggtcagata acactaatgg 301 atgttccagt gtttaaagct attcagccag atgaactttc aagttgtgga tggaataaaa 361 aagaaaaata tagttctgca ccaaatgcag ttgctttcac aagaagattt aatcacgtaa 421 gcttttgggt tgtaagagag attctccatg ctcaaacact gaaaataaga gcagaagttt 481 tgagccacta tattaagact gctaagaaac tatatgaact taacaacctt cacgcactta 541 tggctgtggt ttctggctta cagagtgcgc cgattttccg gttgactaag acgtgggcgt 601 tattaagtcg aaaagacaaa actacctttg aaaaactaga atatgtaatg agtaaagaag 661 ataactacaa aagactcaga gactatataa gcagcttaaa gatgactcct tgcattccct 721 atttaggcat ctatttgtct gacttgacct acattgactc cgcgtaccca tccaccggca 781 gcattctaga aaatgagcaa agatcaaatc tgatgaacaa cattcttcga ataatttctg 841 atttgcagca gtcctgtgaa tatgatattc ccatattgcc tcatgtccaa aaatacctga 901 actctgttca gtatatagaa gaactacaaa agtttgtgga agacgataat tacaagctct 961 ccttaaagat agaaccagga gcaagtactc cacgctcggc tgcctccagg gaggacctag 1021 caggtcctga cataggcgcc tcaccccagg gagggaggaa gagtagtgct gctgctgctg 1081 ccgccgcggc tgccgaggga gccttactgc cacagacgcc accttcccct cggaacctca 1141 ttccacacgg acacaggaag tgccacagcc tgggttacaa tttcattcat aagatgaaca 1201 cagcagagtt taagagcgca acgttcccaa acgcagggcc acggcacctg ctggatgata 1261 gtgtcatgga gccgcacgca ccgtcgcgag gccaggctga gagctctaca ctttccagtg 1321 gaatatccat agggagcagt gatggttctg aactaagcga agagacctca tggccggctt 1381 ttgaaaggaa cagattatac cattctctcg gcccggtgac aagagtgccg cgaaatggct 1441 atcgaagcca cacgaaggcc agcagctctg cggagtcgga agatttggcg gtgcatctgt 1501 accccggagc tgttactatt caaggtgtgc tccggaggaa aaccttgcta aaagaaggca 1561 agaaacccac agtagcatct tggacaaagt attgggcagc cttgtgtgga acacagcttt 1621 tttactatgc cgccaaatct ctgaaggcta cagaaagaaa gcatttcaaa tcaacgtcaa 1681 ataagaatgt gtctgtggtg ggctggatgg tgatgatggc tgacgaccca gagcatccag 1741 acctctttct gctgactgac tccgagaaag gaaattcata caagtttcaa gctggcagca 1801 ggatgaatgc aatgctgtgg tttaaacact tgagcgcggc ctgccagagt aacaagcaac 1861 aggttcctac aaacttgatg acttttgagt aaacgcctga gacagaagag gagtgctatt 1921 gttcccgtgt ggaaccggga cctgccgaga gccccagccg caccatcccg tgccaggaag 1981 agcccccagg ctccagccca gcctccggag ctcagaacca aaagcactaa tttcagggaa 2041 tgaagtgaga tgttcccaga gaaaaacgat ggagttgcaa agcaaactgc catgaacttc 2101 gcttcttctc tccgaactga cctgtggaag ccactgcctt aacagagtgc gaggagagcc 2161 gacaccaaat agtgtgtgtg cgtcttctgg cggtgctgtg cttggaataa attgtagcta 2221 atttgcattt cttttaactt tgtactaatt ttggagggga aaccatcttt tttagataca 2281 ctttaaaatg gaaaaacatt tcttatggat tccatcagga gctgttttag gtgcagtgag 2341 aaataccctg caggttctgc tcagcctctg ccagtggctg cctcacgttc ccacagcaag 2401 acctgggagg gacctgctgt ggaagctgtg ggtgcaggct gggatagata gggagggcat 2461 gcctcgcttt ggatgaggga tccatttaaa cactaccgtt tggaattgag ggctagaagg 2521 agaacatgat ttcctgcagg agggacaaag gctgagtgtt cacgtgccag caggctccag 2581 aacacaccag ggttaaagtt taactttctg tatgaattca ttgttgggcc caaatccgca 2641 taggagcacg gtgatcccgc gctcgggttt ctgtagcctt ttcacaagtc aggtgggtta 2701 tccagccacg ggtgtcccag ggaagaccct ggtgtttctt gtgctgttgc cccttgcagt 2761 gtttaatgtg cagtatgcca gacttatttt ttattgaatt tgtttttgtt cagtatgagg 2821 ttcaaaagca tacttgttta aaaggttctt catgtatatg tatgtatttt attgtaagac 2881 aaagcaattt taagaagaat aaaggcaaag tttgcagttc taggaattga aaatataaaa 2941 ccttttcttg tatgacttca caaaatgtac cagaacattg tattcagaaa gttactgtcg 3001 gtccccagtg tgaaaaccat gtttgttagt aactgaccaa gcattggaga gagctctcct 3061 aggcaataac acatttaatt tttaaaacga atgttggact tgacatagct tagaatttta 3121 accaaaaata acgcttgact gttgagggtc cccactttta cagtggctcc gtgtgcaaag 3181 gccttgactg acagacacct cctagcaaac tgctctttgg gtctcatgta aaatgtctca 3241 cattgtgtcc ttcaagaatt gtatacttta tcagaagtat tttatcacca agcccattga 3301 gcttaactag aaaatactgt ctatacagta attacagtaa ttagct

8 LOCUS AK bp mrna linear HTC 05-DEC-2002 DEFINITION Mus musculus adult male testis cdna, RIKEN full-length enriched library, clone: l04 product:ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus], full insert sequence. ACCESSION AK VERSION AK GI: KEYWORDS HTC; CAP trapper. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus. [..] FEATURES Location/Qualifiers source /organism="mus musculus" /strain="c57bl/6j" /db_xref="fantom_db: l04" /db_xref="taxon:10090" /clone=" l04" /sex="male" /tissue_type="testis" /clone_lib="riken full-length enriched mouse cdna library" /dev_stage="adult" misc_feature /note="ral-a EXCHANGE FACTOR RALGPS2 homolog [Mus musculus] (SPTR Q9ERD6, evidence: FASTY, 90.1%ID, 100%length, match=1797)" BASE COUNT 1249 a 925 c 1045 g 1179 t ORIGIN 1 tcccccgagc gccggcggca ggcgctgaat gagagacgcc gactgctcgg ttgggcgagc 61 gattgcctcg gagccgcggg cgaagcggag gcgacggccg cggctgcaca ggaatgatgc 121 atttgtggcc ttggacatga agtaatcaga cctctgttgc tgttactgta ggctcagggg 181 ctgatgagga aagcatggac ctaatgaacg ggcaggcaag cagtgttact atcgcagcca 241 ctgtttccga gaagagtagc agctctgagt cactaagcga gaagggctct gaattgaaga 301 aaagctttga tgctgtggtg tttgatgttc ttaaggttac gccagaagaa tacgcgggtc 361 agataacact aatggatgtt ccagtgttta aagctattca gccagatgta tccctacatc 421 atcaccctta gaacagtcct tttaagagtg ttggaaccta caagacgtaa gagaagctgt 481 gactcctgtg aattgagtca ttctctcata gggaactttc aagttgtgga tggaataaaa 541 aagaaaaata tagttctgca ccaaatgcag ttgctttcac aagaagattt aatcacgtaa 601 gcttttgggt tgtaagagag attctccatg ctcaaacact gaaaataaga gcagaagttt 661 tgagccacta tattaagact gctaagaaac tatatgaact taacaacctt cacgcactta 721 tggctgtggt ttctggctta cagagtgcgc cgattttccg gttgactaag acgtgggcgt 781 tattaagtcg aaaagacaaa actacctttg aaaaactaga atatgtaatg agtaaagaag 841 ataactacaa aagactcaga gactatataa gcagcttaaa gatgactcct tgcattccct 901 atttaggcat ctatttgtct gacttgacct acattgactc cgcgtaccca tccaccggca 961 gcattctaga aaatgagcaa agatcaaatc tgatgaacaa cattcttcga ataatttctg 1021 atttgcagca gtcctgtgaa tatgatattc ccatattgcc tcatgtccaa aaatacctga 1081 actctgttca gtatatagaa gaactacaaa agtttgtgga agacgataat tacaagctct 1141 ccttaaagat agaaccagga gcaagtactc cacgctcggc tgcctccagg gaggacctag 1201 caggtcctga cataggcgcc tcaccccagg gagggaggaa gagtagtgct gctgctgctg 1261 ccgccgcggc tgccgaggga gccttactgc cacagacgcc accttcccct cggaacctca 1321 ttccacacgg acacaggaag tgccacagcc tgggttacaa tttcattcat aagatgaaca 1381 cagcagagtt taagagcgca acgttcccaa acgcagggcc acggcacctg ctggatgata 1441 gtgtcatgga gccgcacgca ccgtcgcgag gccaggctga gagctctaca ctttccagtg 1501 gaatatccat agggagcagt gatggttctg aactaagcga agagacctca tggccggctt 1561 ttgaaagctc tgcggagtcg gaagatttgg cggtgcatct gtaccccgga gctgttacta 1621 ttcaaggtgt gctccggagg aaaaccttgc taaaagaagg caagaaaccc acagtagcat 1681 cttggacaaa gtattgggca gccttgtgtg gaacacagct tttttactat gccgccaaat 1741 ctctgaaggc tacagaaaga aagcatttca aatcaacgtc aaataagaat gtgtctgtgg

9 1801 tgggctggat ggtgatgatg gctgacgacc cagagcatcc agacctcttt ctgctgactg 1861 actccgagaa aggaaattca tacaagtttc aagctggcag caggatgaat gcaatgctgt 1921 ggtttaaaca cttgagcgcg gcctgccaga gtaacaagca acaggttcct acaaacttga 1981 tgacttttga gtaaacgcct gagacagaag aggagtgcta ttgttcccgt gtggaaccgg 2041 gacctgccga gagccccagc cgcaccatcc cgtgccagga agagccccca ggctccagcc 2101 cagcctccgg agctcagaac caaaagcact aatttcaggg aatgaagtga gatgttccca 2161 gagaaaaacg atggagttgc aaagcaaact gccatgaact tcgcttcttc tctccgaact 2221 gacctgtgga agccactgcc ttaacagagt gcgaggagag ccgacaccaa atagtgtgtg 2281 tgcgtcttct ggcggtgctg tgcttggaat aaattgtagc taatttgcat ttcttttaac 2341 tttgtactaa ttttggaggg gaaaccatct tttttagata cactttaaaa tggaaaaaca 2401 tttcttatgg attccatcag gagctgtttt aggtgcagtg agaaataccc tgcaggttct 2461 gctcagcctc tgccagtggc tgcctcacgt tcccacagca agacctggga gggacctgct 2521 gtggaagctg tgggtgcagg ctgggataga tagggagggc atgcctcgct ttggatgagg 2581 gatccattta aacactaccg tttggaattg agggctagaa ggagaacatg atttcctgca 2641 ggagggacaa aggctgagtg ttcacgtgcc agcaggctcc agaacacacc agggttaaag 2701 tttaactttc tgtatgaatt cattgttggg cccaaatccg cataggagca cggtgatccc 2761 gcgctcgggt ttctgtagcc ttttcacaag tcaggtgggt tatccagcca cgggtgtccc 2821 agggaagacc ctggtgtttc ttgtgctgtt gccccttgca gtgtttaatg tgcagtatgc 2881 cagacttatt ttttattgaa tttgtttttg ttcagtatga ggttcaaaag catacttgtt 2941 taaaaggttc ttcatgtata tgtatgtatt ttattgtaag acaaagcaat tttaagaaga 3001 ataaaggcaa agtttgcagt tctaggaatt gaaaatataa aaccttttct tgtatgactt 3061 cacaaaatgt accagaacat tgtattcaga aagttactgt cggtccccag tgtgaaaacc 3121 atgtttgtta gtaactgacc aagcattgga gagagctctc ctaggcaata acacatttaa 3181 tttttaaaac gaatgttgga cttgacatag cttagaattt taaccaaaaa taacgcttga 3241 ctgttgaggg tccccacttt tacagtggct ccgtgtgcaa aggccttgac tgacagacac 3301 ctcctagcaa actgctcttt gggtctcatg taaaatgtct cacattgtgt ccttcaagaa 3361 ttgtatactt tatcagaagt attttatcac caagcccatt gagcttaact agaaaatact 3421 gtctatacag taattacagt aattagctaa aaaaaagaaa ttagtccaag agaaaatgaa 3481 gagccttttc tgagtgtttc taatttgaat aattcaaaga cgtcatgtga cagaaatacc 3541 ttatttgaga cttcctagac aagcagggaa aggcacatat tgccgtgaga gaatgatttt 3601 tcagataacg gtctaagcta acccgtgttg tgttgagtat acgcagacag atccgcagtg 3661 gccagcgggg ctacagcgca ggctttcccc gtgtgtctta cttttgtctt gcctcttttt 3721 tttttttttt tttaaagcaa ttccttagtt tgttttgctc cagaataatg ttttaaatag 3781 tatgcatact gtttttgaga tactgtgaat gagagccccg tggctgttgt agtactactc 3841 tgtcatgaat atgctaaagc cgttacaatg taggtgaatc aggtctgggg agatgggcag 3901 ctcgcacagg ccagcctcac agttttgcca aagagaaagg gctgagatgg gcgttgtatt 3961 tggtacaccc agctctggac acttacgggt gtgtagagga agaaccggat tcagatttga 4021 tcagccaggc cctattagca ccatggctcc tggctgaaag taaaactatt tttctacctt 4081 gagattgctc taaagatcag tcattgcttt ttaggatgat tttagaaacc gtgagagatg 4141 cattagagta ggtgagttgt tttttatctg taattcacca aatggtatca gattataatt 4201 gaagcaaaga aaacattgcc aaactatatt aaatatttga gtattttact tactggagaa 4261 tgaatcctgt tatgcttacc ctcaggtgta aattagttct caccagctca tttcccacag 4321 acagtaaagc tcatttgttt ctctcatagc caaggagaac tctttcagaa actcgattaa 4381 aatttaaact ttacaagc Per la ricerca delle ORF si è tenuto in considerazione solo il frame di lettura (+) dal momento che ciò che stiamo analizzando è un mrna: sequenza AK Frame Da A Length

10 Sequenza AK Frame Da A Length Le sequenze tradotte delle ORF di maggiori dimensioni ritrovate sopra sono rispettivamente: >AK ORF: Frame +3 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAK KLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCI PYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPILPHVQKYLNSVQYIEEL QKFVEDDNYKLSLKIEPGASTPRSAASREDLAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRN LIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDG SELSEETSWPAFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEHPDLFLLTDSE KGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE >AK ORF: Frame +3 MAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLT YIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKL SLKIEPGASTPRSAASREDLAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHS LGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA FESSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHF KSTSNKNVSVVGWMVMMADDPEHPDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNL MTFE Entrambe le sequenze sono state utilizzate per una ricerca di omologhi in banca dati tramite Blastp. I risultati ottenuti sono identici per le due proteine, eccezion fatta per gli scores ed i relativi E- value. Questa differenza è da imputarsi oltre che ad una diversa lunghezza delle due putative proteine anche al fatto che nella seconda di esse (AK029993) è assente un breve tratto nella sezione C-terminale. Per AK Sequences producing significant alignments: (bits) Value tr!q8bz37 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M tr!q8bzu2 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M tr!q9erd6 Ral-A exchange factor RalGPS2 [ G01RIK] [Mus mus tn!aah47391 Similar to RIKEN cdna G01 gene [Homo sapiens tr!q9d2y M22Rik protein [ G01RIK] [Mus musculus (M tr!q8c134 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M tr!q8bvr9 Similar to RAL guanine nucleotide exchange factor RALG tr!o15059 Hypothetical protein KIAA0351 [KIAA0351] [Homo sapiens e-175 tr!q9h4v2 DJ595C2.1.2 (KIAA0351) (Fragment) [DJ595C2.1] [Homo sa e-133 tr!q9nw78 Hypothetical protein [Homo sapiens (Human)] 442 e-123

11 tr!q9nz16 Ral guanine nucleotide exchange factor RalGPS1A [Homo e-116 tr!q8n7g9 Hypothetical protein FLJ25604 [Homo sapiens (Human)] 416 e tn!aao51688 Similar to Dictyostelium discoideum (Slime mold). Nu e-21 sp!p04821!cc25_yeast Cell division control protein 25 [CDC25] [S e-21 Per AK029993: Sequences producing significant alignments: (bits) Value tr!q8bz37 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M tr!q8bzu2 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M tr!q9erd6 Ral-A exchange factor RalGPS2 [ G01RIK] [Mus mus tn!aah47391 Similar to RIKEN cdna G01 gene [Homo sapiens tr!q9d2y M22Rik protein [ G01RIK] [Mus musculus (M tr!q9h4v2 DJ595C2.1.2 (KIAA0351) (Fragment) [DJ595C2.1] [Homo sa tr!q8c134 RAL-A exchange factor RALGPS2 homolog [Mus musculus (M e-177 tr!o15059 Hypothetical protein KIAA0351 [KIAA0351] [Homo sapiens e-136 tr!q8bvr9 Similar to RAL guanine nucleotide exchange factor RALG e tr!q8t6g6 Ras GTP exchange factor K [GEFK] [Dictyostelium discoi e-15 sp!p04821!cc25_yeast Cell division control protein 25 [CDC25] [S e-14 Dal momento che le due proteine prese in esame identificano medesimi risultati nella ricerca in banca dati, ho ritenuto interessante visualizzare l allineamento tra le due mediante dotplot, al fine di evidenziarne le similitudini. Di seguito è riportato unicamente il Dot-Plot relativo utilizzando una matrice di identità per il confronto. In ascisse è riportata la sequenza relativa a AK019543, in ordinate quella relativa a AK E evidente come nella seconda manchi una parte di sequenza nella regione N-terminale (80 aa) e parte nella regione C-terminale (27 aa). Può essere interessante AK AK notare che la sequenza AK consta di 424 aminoacidi e se a questi si sommano i 107 mancanti si ottiene un totale di 531 aminoacidi, esattamente il numero contenuto nella sequenza AK E ragionevole supporre che mentre la sezione di 27 aa mancante verso il C-terminale sia il risultato di una delezione, gli 80 aa mancanti all Nterminale siano il risultato di una mutazione che ha modificato l ampiezza della ORF originaria eventualmente con l introduzione di un codone di stop prematuro; per verificare queste ipotesi si è proceduto per prima cosa ad effettuare un allineamento pairwise tra le due sequenze nucleotidiche in questione e si è visto che la sequenza nucleotidica AK presenta una inserzione di 105 bp che copre l intervallo , a monte dell inizio della traduzione.

12 Score = 171 bits (89), Expect = 5e-39 Identities = 89/89 (100%) AK019543: 245 gtttgatgttcttaaggttacgccagaagaatacgcgggtcagataacactaatggatgt 304 AK029993: 320 gtttgatgttcttaaggttacgccagaagaatacgcgggtcagataacactaatggatgt 379 AK019543: 305 tccagtgtttaaagctattcagccagatg 333 AK029993: 380 tccagtgtttaaagctattcagccagatg 408 Score = 1982 bits (1031), Expect = 0.0 Identities = 1043/1055 (98%) AK019543: 333 gaactttcaagttgtggatggaatnnnnnnnnnnnntatagttctgcaccaaatgcagtt 392 AK029993: 513 gaactttcaagttgtggatggaataaaaaagaaaaatatagttctgcaccaaatgcagtt 572 AK019543: 393 gctttcacaagaagatttaatcacgtaagcttttgggttgtaagagagattctccatgct 452 AK029993: 573 gctttcacaagaagatttaatcacgtaagcttttgggttgtaagagagattctccatgct 632 AK019543: 453 caaacactgaaaataagagcagaagttttgagccactatattaagactgctaagaaacta 512 AK029993: 633 caaacactgaaaataagagcagaagttttgagccactatattaagactgctaagaaacta 692 AK019543: 513 tatgaacttaacaaccttcacgcacttatggctgtggtttctggcttacagagtgcgccg 572 AK029993: 693 tatgaacttaacaaccttcacgcacttatggctgtggtttctggcttacagagtgcgccg 752 La sequenza inserita in questa posizione provoca la terminazione prematura della traduzione. Di seguito è riportata la traduzione della regione a monte dell ORF trovata in AK029993, in blu è evidenziata la sequenza inserita AK gaagaatacgcgggtcag 362 E E Y A G Q ataacactaatggatgttccagtgtttaaagctattcagccagatgtatccctacatcat 422 I T L M D V P V F K A I Q P D V S L H H cacccttagaacagtccttttaagagtgttggaacctacaagacgtaagagaagctgtga 482 H P - N S P F K S V G T Y K T - E K L - ctcctgtgaattgagtcattctctcatagggaactttcaagttgtggatggaataaaaaa 542 L L - I E S F S H R E L S S C G W N K K gaaaaatatagttctgcaccaaatgcagttgctttcacaagaagatttaatcacgtaagc 602 E K Y S S A P N A V A F T R R F N H V S ttttgggttgtaagagagattctccatgctcaaacactgaaaataagagcagaagttttg 662 F W V V R E I L H A Q T L K I R A E V L agccactatattaagactgctaagaaactatatgaacttaacaaccttcacgcacttatg 722 S H Y I K T A K K L Y E L N N L H A L M gctgtggtttctggcttacagagtgcgccgattttccgg A V V S G L Q S A P I F R

13 AK gaagaatacgcgggtcagataacactaatggat 302 E E Y A G Q I T L M D gttccagtgtttaaagctattcagccagatgaactttcaagttgtggatggaataaaaaa 362 V P V F K A I Q P D E L S S C G W N K K gaaaaatatagttctgcaccaaatgcagttgctttcacaagaagatttaatcacgtaagc 422 E K Y S S A P N A V A F T R R F N H V S ttttgggttgtaagagagattctccatgctcaaacactgaaaataagagcagaagttttg 482 F W V V R E I L H A Q T L K I R A E V L agccactatattaagactgctaagaaactatatgaacttaacaaccttcacgcacttatg 542 S H Y I K T A K K L Y E L N N L H A L M gctgtggtttctggcttacagagtgcgccgattttccgg A V V S G L Q S A P I F R In prossimità delle frecce nere sono i codoni di inizio, in prossimità della freccia verde è il codone di inizio di AK analogo a quello di AK (le sequenze che seguono sono identiche). In prossimità della freccia rossa è il punto in cui si inserisce la sequenza aggiuntiva rispetto ad AK Tale sequenza aggiuntiva, come è possibile vedere, si inserisce senza alterare il frame di lettura (+3) dal momento che è composta da un numero di basi multiplo di 3. I numerosi codoni di stop presenti nella sequenza inserita spiegano come mai le ORF siano così differenti. A questo punto per caratterizzare la sequenza di partenza si considererà unicamente l mrna AK che, teoricamente, codifica per una proteina integra. Riprendendo quindi gli allineamenti significativi ottenuti con Blastp, sono stati considerati solamente i primi tre dal momento che ottengono i migliori risultati. Di seguito i relativi allineamenti: >tr!q8bz37 RAL-A exchange factor RALGPS2 homolog [Mus musculus (Mouse)] Length = 555 Score = 1069 bits (2764), Expect = 0.0 Identities = 531/531 (100%), Positives = 531/531 (100%) Query: 1 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 60 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE Sbjct: 25 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 84 Query: 61 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 120 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK Sbjct: 85 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 144 Query: 121 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 180 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII Sbjct: 145 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 204 Query: 181 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 240 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED Sbjct: 205 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 264 Query: 241 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 300 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM Sbjct: 265 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 324 Query: 301 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 360 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP Sbjct: 325 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 384

14 Query: 361 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 420 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE Sbjct: 385 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 444 Query: 421 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 480 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH Sbjct: 445 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 504 Query: 481 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 531 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE Sbjct: 505 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 555 >tr!q8bzu2 RAL-A exchange factor RALGPS2 homolog [Mus musculus (Mouse)] Length = 590 Score = 1068 bits (2761), Expect = 0.0 Identities = 530/531 (99%), Positives = 531/531 (100%) Query: 1 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 60 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE Sbjct: 60 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 119 Query: 61 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 120 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK Sbjct: 120 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 179 Query: 121 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 180 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII Sbjct: 180 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 239 Query: 181 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 240 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED Sbjct: 240 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 299 Query: 241 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 300 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM Sbjct: 300 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 359 Query: 301 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 360 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP Sbjct: 360 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 419 Query: 361 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 420 AFERNRLYH+LGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE Sbjct: 420 AFERNRLYHTLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 479 Query: 421 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 480 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH Sbjct: 480 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 539 Query: 481 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 531 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE Sbjct: 540 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 590 >tr!q9erd6 Ral-A exchange factor RalGPS2 [ G01RIK] [Mus musculus (Mouse)] Length = 590 Score = 1068 bits (2761), Expect = 0.0 Identities = 530/531 (99%), Positives = 531/531 (100%)

15 Query: 1 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 60 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE Sbjct: 60 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 119 Query: 61 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 120 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK Sbjct: 120 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK 179 Query: 121 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 180 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII Sbjct: 180 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRII 239 Query: 181 SDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 240 SDLQQSCEYDIP+LPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED Sbjct: 240 SDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASRED 299 Query: 241 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 300 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM Sbjct: 300 LAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKM 359 Query: 301 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 360 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP Sbjct: 360 NTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWP 419 Query: 361 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 420 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE Sbjct: 420 AFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKE 479 Query: 421 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 480 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH Sbjct: 480 GKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVVGWMVMMADDPEH 539 Query: 481 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 531 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE Sbjct: 540 PDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAACQSNKQQVPTNLMTFE 590 Le tre proteine suggerite sono praticamente identiche tra di loro, le uniche differenze sono evidenziate in rosso. La prima proteina (Q8BZ37) è lunga solo 555 aminoacidi dal momento che le manca una sequenza di 35 aminoacidi all estremità N-terminale (rispetto alle altre due sequenze mancano gli aminoacidi nell intervallo 20-55). In tabella sono riportate le differenze aminoacidiche nella sequenza. Proteina Posizione 252 (217) Posizione 429 (394) Q8BZ37 Ile Ser Q8BZU2 Ile Thr Q9ERD6 Met Ser La nostra proteina putativa si allinea perfettamente con Q8BZ37 ma rispetto a questa la sequenza è più corta e mancano 25 aminoacidi nella all estremità N-terminale. I rispettivi mrna con relativa traduzione sono riportati di seguito:

16 AK ggacctaatgaacgggcaggcaagcagtgttactatcgcagccactgtttccgagaagag 182 G P N E R A G K Q C Y Y R S H C F R E E tagcagctctggcaccctaagcgagaagggctaccgcacagatgcgtaagttgatgctac Q L W H P K R E G L P H R C V S - C Y cggtttgatgttcttaaggttacgccagaagaatacgcgggtcagataacactaatggat 302 R F D V L K V T P E E Y A G Q I T L M D gttccagtg V P V AK (Q8BZ37) atggacctaatgaacggg 216 M D L M N G caggcaagcagtgttactatcgcagccactgtttccgagggtcagataacactaatggat 276 Q A S S V T I A A T V S E G Q I T L M D gttccagtg V P V Ancora una volta l inserzione di una sequenza interferisce con il meccanismo di traduzione. La presenza di tanti mrna simili che possiedono lunghe inserzioni e delezioni l uno rispetto agli altri suggerisce di verificare se gli mrna fin ora incontrati siano il risultato di splicing alternativo di un unico gene, splicing che evidentemente avviene diversamente nei vari tessuti. In effetti la ricerca del Locus G01 (indicato come cross-reference dopo il primo blastn) nel genoma di topo identifica una regione nel cromosoma I lunga bp. Tale regione risulta comprendere 27 esoni. Analizzando la sequenza nucleotidica per ciascun esone e confrontandola con i 4 mrna trovati all inizio delle analisi, si può dedurre il seguente schema: AK AK AK AK AF In questo schema valgono le seguenti corrispondenze: ID mrna ID proteina Tessuto di origine AK Testicolo AK Testicolo AK Q8BZ37 Vagina AK Q8BZU2 Colon AF Q9ERD6 Testicolo La sequenza AF non risulta dal primo Blastn effettuato ma è stata ottenuta come cross-reference della proteina Q9ERD6, ottenuta con Blastp. Per ogni mrna è riportata la sequenza di esoni di cui è composto. In particolare si nota che la sequenza AK possiede l esone 5 in più rispetto agli altri e non possiede l esone 22. In effetti tali differenze di sequenza giustificano le differenze nella sequenza aminoacidica riscontrate precedentemente (spostamento del codone di inizio più a valle e differenza di 27 aminoacidi al C-terminale). L esone 5 si inserisce senza alterare il frame di lettura e inserisce codoni di stop. L assenza dell esone 3 nella sequenza AK giustifica la differenza di 35 aminoacidi tra la relativa proteina Q8BZ37 e la proteina Q8BZU2 (relativa alla sequenza AK033549).

17 In più viene annotato che l esone 3 della sequenza AK è differente dagli altri nella propria regione al 5 : i primi 75 nucleotidi dell esone in questione non si allineano perfettamente alla sequenza regolare dell esone 3. Esone 3 AK AAGAGTAGCAGCTCTGGCACCCTAAGCGAGAAGGGCTACCGCACAGATGCGTAA Esone 3 regolare AAGAGTAGCAGCTCTGAGTCACTAAGCGAGAAGGGCTCTGAATTGAAGAAAAGC Esone 3 AK GTTGATGCTACCG-GTTTGATG... Esone 3 regolare TTTGATGCTGTGGTGTTTGATG... Gli mrna che presentano lo stesso schema di splicing sono AK e AF312924, entrambi caratterizzati nel testicolo di topo. Le ORF individuate su questi mrna sono una di 531 aa (AK019543, frame +3) e una di 590 aa (AF312924, frame +1, id:q9erd6). La lettura in frame +1 della sequenza AK porta ad una interruzione della traduzione a causa dei codoni di stop presenti sull esone anomalo, quindi la traduzione deve partire più a valle e con un frame di lettura differente (questo perché l esone anomalo è più corto di un nucleotide). Per questo motivo la previsione della proteina relativa a tale sequenza è più corta. Nel procedere a caratterizzare la proteina derivante dalla sequenza AK si è analizzata la stessa parallelamente alla proteina Q9ERD6 tradotta dalla sequenza AF312924, proprio perché caratterizzate entrambe da un simile pattern di splicing e a partire dal medesimo tessuto. La ricerca di motivi in prosite porta agli stessi risultati per entrambe le proteine. In una estesa regione centrale è presente un PH-domain (pleckstrin homology) (ID: PS50003), dominio diffuso in proteine coinvolte nella trasduzione del segnale entro le cellule come anche in proteine facenti parte del citoscheletro. La funzione di questo dominio non è chiara. E stato suggerito che possa servire per il legame con le subunià β/γ di proteine G eterotrimeriche, oppure possa legare lipidi, residui Ser/Thr fosforilati o infine possa servire per ancorare la proteina alla membrana. La ricerca di motivi di Q9ERD6 all interno della banca dati SMART ha dato i seguenti risultati: name begin end E-value low complexity RasGEF e-92 low complexity PH e-09 Il dominio RasGEF indica che siamo in presenza di un fattore di scambio di guaninnucleotide per le GTP-asi Ras-like. Le proteine Ras sono interruttori cellulari che legano GTP (stato attivo) e lo idrolizzano a GDP (stato inattivo). Lo stato di attività delle proteine Ras dipende dall attività di proteine che favoriscono l attività GTPasica e di proteine che permettono il rilascio di GDP e l uptake di GTP. Queste ultime sono i fattori di scambio di guanin-nucleotide. Proteine che agiscono in questo modo sono classificate, sulla base della

18 similarità di sequenza, come CDC24 o CDC25. Il dominio RasGEF è necessario per l attività di queste proteine. Il dominio PH individuato in SMART è il medesimo individuato da Prosite. SMART non è in grado di analizzare la sequenza proposta per AK dal momento che la relativa proteina non è presente in banca dati. In ogni caso la proteina per AK manca di 59 aa all estremità N-terminale rispetto a Q9ERD6 e tra essi 14 fanno parte del dominio RasGEF il che potrebbe comportare una perdita di funzionalità di tale proteina. Tale differenza di sequenza proteica è imputabile prima di tutto ad una differenza nella sequenza nucleotidica che introduce un codone di stop prematuro in AK019543: AF312914: 121 tccgagaagagtagcagctctgagtcactaagcgagaagggct 163 AK019543: 172 tccgagaagagtagcagctctggcaccctaagcgagaagggct 214 Se consideriamo invece la proteina deducibile dall altro mrna estratto da testicolo (ID AK029993) possiamo supporre, in prima istanza, che la mancanza di più di 130 aa all estremità N-terminale rispetto a Q9ERD6 comporti la perdita della funzione di scambio GDP GTP. In questo caso la differenza di sequenza è imputabile al diverso pattern di splicing evidenziato in precedenza. La proteina Q9ERD6 è un piccolo scambiatore GDP GTP (RalGPS2) identificato in topo, agisce come fattore di scambio per proteine Ral il cui meccanismo d azione è del tutto simile alle proteine Ras sopra descritte. Ripetendo la ricerca di omologhi con BLAST si trova che la nostra proteina da AK mostra una certa similarità con alcune proteine CDC25, in particolare con un fattore CDC25 di topo (ID P27671). L omologia è tra la regione N-terminale della nostra proteina e la regione di della CDC25: in questa regione, infatti, è presente il dominio RasGEF (che si estende nella regione tra 1025 e 1259). >sp!p27671!gnrp_mouse Guanine nucleotide releasing protein (GNRP) (Ras-specific nucleotide exchange factor CDC25) (CDC25Mm) [RASGRF1] [Mus musculus (Mouse)] Length = 1262 Score = 132 bits (333), Expect = 1e-30 Identities = 78/232 (33%), Positives = 129/232 (55%), Gaps = 8/232 (3%) Query: 1 MDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAE 60 +D VFK+I +E GW K EKY P + T+ FNHVS ++ EI+ + + RA Sbjct: 1038 LDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSNFIASEIIRNEDISARAS 1097 Query: 61 VLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSK A L+N +A++ + S + + IFRL KTW +S++ K+ +KL+ ++S Sbjct: 1098 AIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVSS 1157 Query: 121 EDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPS-TGSILENEQRSNLMNNILRI K LR+ + + PC+PYLG+YL+DL +I+ P+ T L N I+R Sbjct: 1158 DGRFKNLRESLRNCD-PPCVPYLGMYLTDLVFIEEGTPNYTEDGLVNFSKMRMISHIIRE 1216 Query: 180 ISDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGAST 231 I QQ+ Y I P V +YL ++E E+ Y+ SL IEP T Sbjct: 1217 IRQFQQT-TYKIDPQPKVIQYL-----LDESFMLDEESLYESSLLIEPKLPT 1262 La P27671 presenta un motivo di Prosite tipico delle CDC25, tale motivo è assai simile ad una sottosequenza della proteina in analisi:

19 Prosite ID PS00720: [GAP]-[CT]-V-P-[FY]-x(4)-[LIVMFY]-x-[DN]-[LIVM] P27671 AK PCVPYLGMYLTDL 138 PCiPYLGIYLSDL Come si può vedere la nostra proteina mostra un motivo (all interno del dominio RasGEF) che si distingue dal motivo delle CDC25 per una sostituzione V I. L allineamento di P27671 con la proteina Q9ERD6 risulta assolutamente simile, e Q9ERD6 presenta un motivo per le CDC25 uguale a quello di AK Per fare ipotesi sulla funzionalità delle proteine derivate da AK e AK è stata fatta una ricerca in banca dati per proteine omologhe di cui è nota la struttura e/o le regioni funzionalmente importanti. L unica struttura nota del dominio RasGEF si può trovare nel complesso H-RAS/SOS-1 umano (ID: 1BKD). La proteina SOS-1 contiene un dominio RasGEF. Questa struttura è stata determinata dopo l espressione in E. coli e non è possibile risalire da essa alla regione catalitica della proteina. Nel tentativo di valutare se le delezioni nel dominio RasGEF sono importanti per la funzione della proteina si è tentato allora di effettuare un allineamento multiplo nella speranza che gli aminoacidi mancanti non fossero altamente conservati nel dominio. Questa via non è facilmente applicabile: i fattori GEF caratterizati in swiss-prot presentano il dominio RasGEF nella regione C-terminale (mentre si trova al N-terminale nella nostra proteina) e questo interferisce parecchio con il tentativo di Clustal-W di effettuare un allineamento multiplo. Per evitare di creare enormi gap alllineando correttamente i domini RasGEF, Clustal-W preferisce mettere la nostra query in registro con le altre non allineando correttamente i domini (come schematizzato di seguito). A B Per evitare di creare gaps alle estremità (A) Clustal-W opta per mettere la sequenza query (in blu) in registro con le rimanenti (B), rinunciando all allineamento del dominio RasGEF (in rosso) Di contro l allineamento con sequenze di piccoli fattori GEF, che presentano il dominio RasGEF nella regione N-terminale, non consente di discriminare le regioni importanti dal momento che le sequenze di tali fattori depositate in banca dati sono talmente simili tra di loro da risultare in un multiallineamento quasi perfetto. Tali sequenze, infatti, appartengono essenzialmente al topo, al ratto o all uomo. In più le sequenze di tali fattori sono depositate nella banca dati TrEMBL, e quindi probabilmente diverse dalle sequenze delle proteine mature all interno delle cellule. Per questi motivi si è scelto di recuperare il multiallineamento del dominio RasGEF dalla banca dati Pfam e confrontare la proteina putativa con esso. Dall allineamento multiplo è possibile vedere che la regione N-terminale del dominio RasGEF è piuttosto variabile tra le proteine riportate: vi sono inserzioni/delezioni di aminoacidi e solo pochi di essi sono conservati in tutti i domini. Inoltre sono evidenziate alcune proteine il cui dominio RasGEF è più corto nella regione N-terminale (es. Q9BWF0, Q9QYS6, O616059). Vista la variabilità della regione N-terminale del dominio RasGEF si può supporre che la proteina derivante dalla sequenza AK possa essere funzionale pur mancando di 14 aminoacidi. Diverso è il caso della proteina derivante da AK a cui manca una grossa regione del dominio RasGEF. In effetti nel multiallineamento presentato in Pfam ci sono proteine che presentano così grandi delezioni. Purtroppo tutte queste sequenze non sono associate a proteine di cui sia effetivamente nota la funzionalità e nulla si può dire quindi sulla funzionalità della nostra proteina. Emblematico, a questo proposito, il caso di Q8N858

20 (proteina umana) a cui mancano i medesimi aminoacidi di AK all estremità N- terminale. Un allineamento pairwise tra queste due sequenze trova similarità solo nel dominio RasGEF e null altro. Di seguito è riportato il multiallineamento dei 161 domini RasGEF depositati in Pfam relativamente alla regione N-terminale del dominio stesso, in rosso è evidenziata la proteina relativa a AK019543, inserita ed allineata manualmente. Q9Z1C8 DLVS...AK...D.LAGQLTEHDWNLFNRIHQVELIH YVLGPQ Q8R1R1 DLVS...AK...D.LAGQLTDHDWNLFNRIHQVELIH YVLGPQ Q8VCC8 DLVS...AK...D.LAGQLTDHDWNLFNRIHQVQ EH O95634 DLVS...AK...D.LAGQLTDHDWSLFNSIHQVELIH YVLGPQ O95398 DLVS...AK...D.LAGQLTDHDWSLFNSIHQVELIH YVLGPQ Q8WVN0 DLVS...AK...D.LAGQLTDHDWSLFNSIHQVELIH YVLGPQ Q9Z1C7 ELMS...SK...D.LAYQMTTYDWELFNCVLELELIY HTFGRH Q8VIP9 ELMS...SK...D.LAYQMTTYDWELFNCVHELELIY HTFGRH Q9CW52 ELMS...SK...D.LAYQMTTYDWELFNCVHELELIY HTFGRH Q9EQZ6 ELMS...SK...D.LAYQMTTYDWELFNCVHELELIY HTFGRH Q9Z1P0 ELMS...SK...D.LAYQMTTYDWELFNCVHELELIY HTFGRH O95636 ELMS...SK...D.LAYQMTIYDWELFNCVHELELIY HTFGRH Q8TAA4 ELMS...SK...D.LAYQMTIYDWELFNCVHELELIY HTFGRH Q8WZA2 ELMS...SK...D.LAYQMTIYDWELFNCVHELELIY HTFGRH Q9V9A3 EILS...TK...E.LAYHITLFEWDLFWAVHEYELLY HTFGRH Q92565 LGMN...TW...D.LALELMNFDWSLFNSIHEQELIY FTFSRQ Q9UHV5 HRVE...PE...D.VANHLTAFHWELFRCVHELEFVD YVFHGE YNX5_CAEEL HLID...SQ...E.LAHQLFLFHLQLLRSTDSNELLY QVIGRE Q9Y4G8 LQLS...TV...E.VATQLSMRNFELFRNIEPTEYID DLFKLR Q8NI21 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q8TEU6 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q8TEU7 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q96PC1 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q9UHV4 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q8TEA3 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q8R3E5 LQLS...TI...E.VATQLSMRDFDLFRNIEPTE--Y IDDL Q9VMF3 LHLN...AY...E.LAIQLTLQDFANFRQIESTEYVD ELFELR Q95V18 LHLN...AY...E.LAIQLTLQDFGTFRQIESTEYVD ELFEL- Q21218 LSLN...AQ...V.VAAQLTLQDFSVFSAIEPTEFLD NL Q95NL8 LSLN...AQ...V.VAAQLTLQDFSVFSAIEPTEFLD NL Q95WR8 LSLN...AQ...V.VAAQLTLQDFSVFSAIEPTEFLD NL Q9D3B6 VCSD...PL...V.LAQQLTHIELERVNSIRPED-LM QIISHM Q8TBF1 VCCD...PL...V.LAQQLTHIELDRVSSIYPEDLMQ IVSH Q8N9B8 VCCD...PL...V.LAQQLTHIELDRVSSIYPEDLMQ IVSH Q9D300 VCSD...PY...T.LAQQLTHVELERLRHIGPEEFVQ.Afvn----KDPLAGTKP Q95KH6 VCSD...PY...T.LAQQLTHVELERLRHIGPEEFVQ.Afvn----KDPLASTKP Q8NA49 VCSD...PY...T.LAQQLTHVELERLRHIGPEEFVQ.Afvn----KDPLASTKP Q8N431 VCSD...PY...T.LAQQLTHVELERLRHIGPEEFVQ.Afvn----KDPLASTKP Q96MY8 VCND...PY...T.LAQQLTHIELERLNYIGPEEFVQ.Afvq----KDPLDNDKS Q8JZL7 VCSD...PY...T.LAQQLTHIELERLNYIGPEEFVQ.Afvq----KDPLDNDKS Q8T9J6 MCPS...CA...H.LAHQLTAIELERLSHIGPEEFVQ AFAKDYQQQ Q8SYL9 MCPS...CA...H.LAHQLTAIELERLSHIGPEEFVQ AFAKDYQQQ Q9VNR5 MCPS...CA...H.LAHQLTAIELERLSHIGPEEFVQ AFAKDYQQQ O Q8MLG3 ---S...AF...E.LAHQLYAIEYAYLSQIRLEEFVEiLekd----ELKTCISQT Q95S44 ---S...AF...E.LAHQLYAIEYAYLSQIRLEEFVEiLekd----ELKTCISQT Q9V S...AF...E.LAHQLYAIEYAYLSQIRLEEFVEiLekd----ELKTCISQT Q21758 LCND...AK...T.VAQQLTHIEMERFSMVGVDEIVQsla.s----DPLSEIGRH Q9USU1 YAYT...PE...E.FASQMTLLEFDYLKQIPSREWIF RSWVSR CC25_SACKL LDID...SL...D.YAKQLTIKEHSLFYKISPFECLD RTWGNK CC25_YEAST LDID...PY...T.YATQLTVLEHDLYLRITMFECLD RAWGTK SC25_YEAST LAVD...PV...L.FATQLTILEHEIYCEITIFDCLQ KIWKNK Q12037 LAVD...PV...L.FATQLTILEHEIYCEITIFDCLQ KIWKNK CC25_CANAL MDID...YV...E.LARQLTLREFKLYCKITKFACLA KVWGKK

Una proteina nella rete: Caccia al tesoro bioinformatica

Una proteina nella rete: Caccia al tesoro bioinformatica Una proteina nella rete: Caccia al tesoro bioinformatica Nel corso di questa attivita utilizzeremo alcune delle piu importanti banche dati disponibili in rete per cercare informazioni su una proteina.

Dettagli

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma.

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna è caratteristico degli eucarioti: Sequenze codificanti 1.5% del genoma umano Introni in media 95-97%

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per

Dettagli

DI REGOLAZIONE A DUE COMPONENTI

DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac

Dettagli

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della struttura secondaria: Minimizzazione dell energia Un

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

Introduzione ai Microarray

Introduzione ai Microarray Introduzione ai Microarray Anastasios Koutsos Alexandra Manaia Julia Willingale-Theune Versione 2.3 Versione italiana ELLS European Learning Laboratory for the Life Sciences Anastasios Koutsos, Alexandra

Dettagli

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione nei procarioti Concetti base Nucleoside base purinica o pirimidinica legata alla posizione 1 dell anello pentoso Nucleotide base azotata-pentoso-fosfato Concetti base La trascrizione comporta

Dettagli

RefWorks Guida all utente Versione 4.0

RefWorks Guida all utente Versione 4.0 Accesso a RefWorks per utenti registrati RefWorks Guida all utente Versione 4.0 Dalla pagina web www.refworks.com/refworks Inserire il proprio username (indirizzo e-mail) e password NB: Agli utenti remoti

Dettagli

ALGEBRA I: NUMERI INTERI, DIVISIBILITÀ E IL TEOREMA FONDAMENTALE DELL ARITMETICA

ALGEBRA I: NUMERI INTERI, DIVISIBILITÀ E IL TEOREMA FONDAMENTALE DELL ARITMETICA ALGEBRA I: NUMERI INTERI, DIVISIBILITÀ E IL TEOREMA FONDAMENTALE DELL ARITMETICA 1. RICHIAMI SULLE PROPRIETÀ DEI NUMERI NATURALI Ho mostrato in un altra dispensa come ricavare a partire dagli assiomi di

Dettagli

Il ciclo cellulare e la sua regolazione

Il ciclo cellulare e la sua regolazione Il ciclo cellulare e la sua regolazione Le cellule possono essere classificate in base alla loro capacità di crescere e di dividersi: Cellule che hanno perso la capacità di dividersi (cellule neuronali,

Dettagli

PLANIMETRIA E PROFILO INSIEME

PLANIMETRIA E PROFILO INSIEME PLANIMETRIA E PROFILO INSIEME planimetria profili 11 RELAZIONE TRA PLANIMETRIA E PROFILO La correlazione tra andamento planimetrico e altimetrico è molto stretta; variazioni del primo incidono subito sul

Dettagli

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Se a e b sono numeri interi, si dice che a divide b, in simboli: a b, se e solo se esiste c Z tale che b = ac. Si può subito notare che:

Dettagli

Le pr p in i c n ip i ali ali st s rategie ie i d regola zio i n o e n d e d ll esp s re p ss s ion ion g ni n c i a n e n i i pr p oc o ariot i i

Le pr p in i c n ip i ali ali st s rategie ie i d regola zio i n o e n d e d ll esp s re p ss s ion ion g ni n c i a n e n i i pr p oc o ariot i i Le principali strategie di regolazione dell espressione genica nei procarioti Regolazione metabolica Nel genoma di un microorganismo sono presenti migliaia di geni (3000-6000). Alcuni geni vengono espressi

Dettagli

unità C3. Le cellule crescono e si riproducono

unità C3. Le cellule crescono e si riproducono unità 3. Le cellule crescono e si riproducono Durante l interfase la cellula aumenta di dimensioni sintetizza nuove proteine e nuovi organuli duplica il DN al termine di questi processi la cellula compie

Dettagli

1. Manifestano la loro azione negativa solo in età adulta avanzata

1. Manifestano la loro azione negativa solo in età adulta avanzata Perché invecchiamo? La selezione naturale opera in maniera da consentire agli organismi con i migliori assetti genotipici di tramandare i propri geni alla prole attraverso la riproduzione. Come si intuisce

Dettagli

1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici

1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici 1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici La maturazione consiste in una serie di eventi che avvengono negli organi linfoidi generativi o primari:

Dettagli

Ministero della Salute Direzione Generale della Ricerca Scientifica e Tecnologica Bando Giovani Ricercatori - 2007 FULL PROJECT FORM

Ministero della Salute Direzione Generale della Ricerca Scientifica e Tecnologica Bando Giovani Ricercatori - 2007 FULL PROJECT FORM ALLEGATO 2 FULL PROJECT FORM FORM 1 FORM 1 General information about the project PROJECT SCIENTIFIC COORDINATOR TITLE OF THE PROJECT (max 90 characters) TOTAL BUDGET OF THE PROJECT FUNDING REQUIRED TO

Dettagli

Routing (instradamento) in Internet. Internet globalmente consiste di Sistemi Autonomi (AS) interconnessi:

Routing (instradamento) in Internet. Internet globalmente consiste di Sistemi Autonomi (AS) interconnessi: Routing (instradamento) in Internet Internet globalmente consiste di Sistemi Autonomi (AS) interconnessi: Stub AS: istituzione piccola Multihomed AS: grande istituzione (nessun ( transito Transit AS: provider

Dettagli

Principal Component Analysis (PCA)

Principal Component Analysis (PCA) Principal Component Analysis (PCA) Come evidenziare l informazione contenuta nei dati S. Marsili-Libelli: Calibrazione di Modelli Dinamici pag. Perche PCA? E un semplice metodo non-parametrico per estrarre

Dettagli

Infatti il glucosio viene bruciato in presenza di ossigeno e l'energia liberata, immagazzinata sotto forma di ATP

Infatti il glucosio viene bruciato in presenza di ossigeno e l'energia liberata, immagazzinata sotto forma di ATP I mitocondri sono gli organuli responsabili della produzione di energia necessaria alla cellula per crescere e riprodursi. Queste reazioni, che nel loro insieme costituiscono il processo di "respirazione

Dettagli

Prodotto Isi Web Knowledge

Prodotto Isi Web Knowledge Guida pratica all uso di: Web of Science Prodotto Isi Web Knowledge acura di Liana Taverniti Biblioteca ISG INMP INMP I prodotti ISI Web of Knowledge sono basi di dati di alta qualità di ricerca alle quali

Dettagli

ESAME DI STATO 2002 SECONDA PROVA SCRITTA PER IL LICEO SCIENTIFICO DI ORDINAMENTO

ESAME DI STATO 2002 SECONDA PROVA SCRITTA PER IL LICEO SCIENTIFICO DI ORDINAMENTO ARCHIMEDE 4/ 97 ESAME DI STATO SECONDA PROVA SCRITTA PER IL LICEO SCIENTIFICO DI ORDINAMENTO Il candidato risolva uno dei due problemi e 5 dei quesiti in cui si articola il questionario. PROBLEMA In un

Dettagli

Manipolazione di testi: espressioni regolari

Manipolazione di testi: espressioni regolari Manipolazione di testi: espressioni regolari Un meccanismo per specificare un pattern, che, di fatto, è la rappresentazione sintetica di un insieme (eventualmente infinito) di stringhe: il pattern viene

Dettagli

Appunti sull uso di matlab - I

Appunti sull uso di matlab - I Appunti sull uso di matlab - I. Inizializazione di vettori.. Inizializazione di matrici.. Usare gli indici per richiamare gli elementi di un vettore o una matrice.. Richiedere le dimensioni di una matrice

Dettagli

Da dove prendono energia le cellule animali?

Da dove prendono energia le cellule animali? Da dove prendono energia le cellule animali? La cellula trae energia dai legami chimici contenuti nelle molecole nutritive Probabilmente le più importanti sono gli zuccheri, che le piante sintetizzano

Dettagli

Introduzione a MySQL

Introduzione a MySQL Introduzione a MySQL Cinzia Cappiello Alessandro Raffio Politecnico di Milano Prima di iniziare qualche dettaglio su MySQL MySQL è un sistema di gestione di basi di dati relazionali (RDBMS) composto da

Dettagli

Minimizzazione di Reti Logiche Combinatorie Multi-livello

Minimizzazione di Reti Logiche Combinatorie Multi-livello Minimizzazione di Reti Logiche Combinatorie Multi-livello Maurizio Palesi Maurizio Palesi 1 Introduzione Obiettivo della sintesi logica: ottimizzazione delle cifre di merito area e prestazioni Prestazioni:

Dettagli

1 LA CORRENTE ELETTRICA CONTINUA

1 LA CORRENTE ELETTRICA CONTINUA 1 LA CORRENTE ELETTRICA CONTINUA Un conduttore ideale all equilibrio elettrostatico ha un campo elettrico nullo al suo interno. Cosa succede se viene generato un campo elettrico diverso da zero al suo

Dettagli

Progetto VirtualCED Clustered

Progetto VirtualCED Clustered Progetto VirtualCED Clustered Un passo indietro Il progetto VirtualCED, descritto in un precedente articolo 1, è ormai stato implementato con successo. Riassumendo brevemente, si tratta di un progetto

Dettagli

PROBABILITA, VALORE ATTESO E VARIANZA DELLE QUANTITÁ ALEATORIE E LORO RELAZIONE CON I DATI OSSERVATI

PROBABILITA, VALORE ATTESO E VARIANZA DELLE QUANTITÁ ALEATORIE E LORO RELAZIONE CON I DATI OSSERVATI statistica, Università Cattaneo-Liuc, AA 006-007, lezione del 08.05.07 IDICE (lezione 08.05.07 PROBABILITA, VALORE ATTESO E VARIAZA DELLE QUATITÁ ALEATORIE E LORO RELAZIOE CO I DATI OSSERVATI 3.1 Valore

Dettagli

GEOMETRIA I Corso di Geometria I (seconda parte)

GEOMETRIA I Corso di Geometria I (seconda parte) Corso di Geometria I (seconda parte) anno acc. 2009/2010 Cambiamento del sistema di riferimento in E 3 Consideriamo in E 3 due sistemi di riferimento ortonormali R e R, ed un punto P (x, y, z) in R. Lo

Dettagli

La funzione è continua nel suo dominio perchè y = f(x) è composizione di funzioni continue. Il punto x = 0 è un punto isolato per D f.

La funzione è continua nel suo dominio perchè y = f(x) è composizione di funzioni continue. Il punto x = 0 è un punto isolato per D f. FUNZIONI CONTINUE - ALCUNI ESERCIZI SVOLTI SIMONE ALGHISI 1. Continuità di una funzione Dati un insieme D R, una funzione f : D R e x 0 R, si è detto che f è continua in x 0 se sono soddisfatte le seguenti

Dettagli

Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000 L alta incidenza relativa di Emofilia A è

Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000 L alta incidenza relativa di Emofilia A è Emofilia Malattia ereditaria X cromosomica recessiva A deficit del fatt VIII B deficit del fatt IX Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000

Dettagli

Come scrivere un articolo scientifico La bibliografia: citare da Internet

Come scrivere un articolo scientifico La bibliografia: citare da Internet scrivere in medicina Come scrivere un articolo scientifico La bibliografia: citare da Internet L emergere di Internet come fonte preziosa di informazioni, ha reso necessaria la definizione di alcune regole

Dettagli

Condivisione delle risorse e Document Delivery Internazionale: Principi e linee guida per le procedure.

Condivisione delle risorse e Document Delivery Internazionale: Principi e linee guida per le procedure. Condivisione delle risorse e Document Delivery Internazionale: Principi e linee guida per le procedure. TRADUZIONE A CURA DI ASSUNTA ARTE E ROCCO CAIVANO Prima versione dell IFLA 1954 Revisioni principali

Dettagli

RETTE, PIANI, SFERE, CIRCONFERENZE

RETTE, PIANI, SFERE, CIRCONFERENZE RETTE, PIANI, SFERE, CIRCONFERENZE 1. Esercizi Esercizio 1. Dati i punti A(1, 0, 1) e B(, 1, 1) trovare (1) la loro distanza; () il punto medio del segmento AB; (3) la retta AB sia in forma parametrica,

Dettagli

Analisi Costi e Benefici Laura Vici laura.vici@unibo.it LEZIONE 5

Analisi Costi e Benefici Laura Vici laura.vici@unibo.it LEZIONE 5 Analisi Costi e Benefici Laura Vici laura.vici@unibo.it LEZIONE 5 Rimini, 26 aprile 2006 1 The Inter temporal Effects of International Trade Valore in $ del consumo di beni oggi G D F H 1/(1+r) G Valore

Dettagli

DICHIARAZIONE DEI DIRITTI SESSUALI

DICHIARAZIONE DEI DIRITTI SESSUALI DICHIARAZIONE DEI DIRITTI SESSUALI Riconoscendo che i diritti sessuali sono essenziali per l ottenimento del miglior standard di salute sessuale raggiungibile, la World Association for Sexual Health (WAS):

Dettagli

DISCIPLINA IVA NEL SUBAPPALTO

DISCIPLINA IVA NEL SUBAPPALTO DISCIPLINA IVA NEL SUBAPPALTO L articolo 35, comma 5, D.L. n. 223/2006 ha aggiunto il seguente comma all articolo 17, D.P.R. n. 633/72: Le disposizioni di cui al comma precedente si applicano anche alle

Dettagli

Parking su Sedo. Manuale d uso e lettura delle statistiche

Parking su Sedo. Manuale d uso e lettura delle statistiche Parking su Sedo Manuale d uso e lettura delle statistiche Indice Introduzione 1. Statistics 1.1 Select Domains 1.1.1 Selezione attraverso le lettere inziali 1.1.2 Domain contains 1.2 Domain List 1.3 Creazione

Dettagli

Indice generale. Modulo 1 Algebra 2

Indice generale. Modulo 1 Algebra 2 Indice generale Modulo 1 Algebra 2 Capitolo 1 Scomposizione in fattori. Equazioni di grado superiore al primo 1.1 La scomposizione in fattori 2 1.2 Raccoglimento a fattor comune 3 1.3 Raccoglimenti successivi

Dettagli

LA MEMBRANA PLASMATICA

LA MEMBRANA PLASMATICA LA MEMBRANA PLASMATICA 1. LE FUNZIONI DELLA MEMBRANA PLASMATICA La membrana plasmatica svolge le seguenti funzioni: 1. tenere concentrate tutte le sostanze indispensabili alla vita: è proprio la membrana

Dettagli

Rilevazione degli apprendimenti. Anno Scolastico 2006 2007 PROVA DI MATEMATICA. Scuola Secondaria di II grado. Classe Terza Tipo A. Codici. Scuola:...

Rilevazione degli apprendimenti. Anno Scolastico 2006 2007 PROVA DI MATEMATICA. Scuola Secondaria di II grado. Classe Terza Tipo A. Codici. Scuola:... Ministero della Pubblica Istruzione Rilevazione degli apprendimenti Anno Scolastico 2006 2007 PROVA DI MATEMATICA Scuola Secondaria di II grado Classe Terza Tipo A Codici Scuola:..... Classe:.. Studente:.

Dettagli

Il business risk reporting: lo. gestione continua dei rischi

Il business risk reporting: lo. gestione continua dei rischi 18 ottobre 2012 Il business risk reporting: lo strumento essenziale per la gestione continua dei rischi Stefano Oddone, EPM Sales Consulting Senior Manager di Oracle 1 AGENDA L importanza di misurare Business

Dettagli

Regolamento d esecuzione del Trattato di cooperazione in materia di brevetti. (testo in vigore al 1º luglio 2014)

Regolamento d esecuzione del Trattato di cooperazione in materia di brevetti. (testo in vigore al 1º luglio 2014) Regolamento d esecuzione del Trattato di cooperazione in materia di brevetti (testo in vigore al 1º luglio 2014) Nota dell editore: Per ottenere i dettagli delle modifiche del Regolamento d Esecuzione

Dettagli

Analisi dei requisiti e casi d uso

Analisi dei requisiti e casi d uso Analisi dei requisiti e casi d uso Indice 1 Introduzione 2 1.1 Terminologia........................... 2 2 Modello del sistema 4 2.1 Requisiti hardware........................ 4 2.2 Requisiti software.........................

Dettagli

Compito di SISTEMI E MODELLI. 19 Febbraio 2015

Compito di SISTEMI E MODELLI. 19 Febbraio 2015 Compito di SISTEMI E MODELLI 9 Febbraio 5 Non é ammessa la consultazione di libri o quaderni. Le risposte vanno giustificate. Saranno rilevanti per la valutazione anche l ordine e la chiarezza di esposizione.

Dettagli

Materiale di approfondimento: numeri interi relativi in complemento a uno

Materiale di approfondimento: numeri interi relativi in complemento a uno Materiale di approfondimento: numeri interi relativi in complemento a uno Federico Cerutti AA. 2011/2012 Modulo di Elementi di Informatica e Programmazione http://apollo.ing.unibs.it/fip/ 2011 Federico

Dettagli

QUICK GUIDE ESAMI DI STATO

QUICK GUIDE ESAMI DI STATO QUICK GUIDE ESAMI DI STATO Le operazioni da eseguire sono semplici e lineari, ma è opportuno ricordarne la corretta sequenza nella quale vanno eseguite. Flusso delle operazioni da eseguire: 1. Inserimento

Dettagli

2. Cos è una buona pratica

2. Cos è una buona pratica 2. Cos è una buona pratica Molteplici e differenti sono le accezioni di buona pratica che è possibile ritrovare in letteratura o ricavare da esperienze di osservatori nazionali e internazionali. L eterogeneità

Dettagli

Traduzione di TeamLab in altre lingue

Traduzione di TeamLab in altre lingue Lingue disponibili TeamLab è disponibile nelle seguenti lingue nel mese di gennaio 2012: Traduzioni complete Lingue tradotte parzialmente Inglese Tedesco Francese Spagnolo Russo Lettone Italiano Cinese

Dettagli

Guida all'installazione ed uso dell'app RXCamLink

Guida all'installazione ed uso dell'app RXCamLink Guida all'installazione ed uso dell'app RXCamLink Questa guida riporta i passi relativi all'installazione ed all'utilizzo dell'app "RxCamLink" per il collegamento remoto in mobilità a sistemi TVCC basati

Dettagli

la Banca Centrale esercita in autonomia (indipendenza dal Governo) la politica monetaria.

la Banca Centrale esercita in autonomia (indipendenza dal Governo) la politica monetaria. Politica monetaria Obiettivi principali della politica monetaria stabilità monetaria interna (controllo dell inflazione) stabilità monetaria esterna (stabilità del cambio e pareggio della BdP) ma può avere

Dettagli

Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico

Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico Le NIPT utilizzano DNA libero. Campione di sangue materno DNA

Dettagli

Citochine dell immunità specifica

Citochine dell immunità specifica Citochine dell immunità specifica Proprietà biologiche delle citochine Sono proteine prodotte e secrete dalle cellule in risposta agli antigeni Attivano le risposte difensive: - infiammazione (immunità

Dettagli

Introduzione all elettronica

Introduzione all elettronica Introduzione all elettronica L elettronica nacque agli inizi del 1900 con l invenzione del primo componente elettronico, il diodo (1904) seguito poi dal triodo (1906) i cosiddetti tubi a vuoto. Questa

Dettagli

Web of Science SM QUICK REFERENCE GUIDE IN COSA CONSISTE WEB OF SCIENCE? General Search

Web of Science SM QUICK REFERENCE GUIDE IN COSA CONSISTE WEB OF SCIENCE? General Search T TMTMTt QUICK REFERENCE GUIDE Web of Science SM IN COSA CONSISTE WEB OF SCIENCE? Consente di effettuare ricerche in oltre 12.000 riviste e 148.000 atti di convegni nel campo delle scienze, delle scienze

Dettagli

Analisi statistica di dati biomedici Analysis of biologicalsignals

Analisi statistica di dati biomedici Analysis of biologicalsignals Analisi statistica di dati biomedici Analysis of biologicalsignals II Parte Verifica delle ipotesi (a) Agostino Accardo (accardo@units.it) Master in Ingegneria Clinica LM in Neuroscienze 2013-2014 e segg.

Dettagli

Le funzioni di una rete (parte 1)

Le funzioni di una rete (parte 1) Marco Listanti Le funzioni di una rete (parte 1) Copertura cellulare e funzioni i di base di una rete mobile Strategia cellulare Lo sviluppo delle comunicazioni mobili è stato per lungo tempo frenato da

Dettagli

DBMS (Data Base Management System)

DBMS (Data Base Management System) Cos'è un Database I database o banche dati o base dati sono collezioni di dati, tra loro correlati, utilizzati per rappresentare una porzione del mondo reale. Sono strutturati in modo tale da consentire

Dettagli

Finanziamenti on line -

Finanziamenti on line - Finanziamenti on line - Manuale per la compilazione dei moduli di Gestione dei Progetti Finanziati del Sistema GEFO Rev. 02 Manuale GeFO Pagina 1 Indice 1. Introduzione... 4 1.1 Scopo e campo di applicazione...

Dettagli

Guida all uso. Come ricevere ed inviare Fax ed Sms tramite E-mail in 3 semplici passi.

Guida all uso. Come ricevere ed inviare Fax ed Sms tramite E-mail in 3 semplici passi. Guida all uso Come ricevere ed inviare Fax ed Sms tramite E-mail in 3 semplici passi. Legenda Singolo = Fax o SMS da inviare ad un singolo destinatario Multiplo = Fax o SMS da inviare a tanti destinatari

Dettagli

Istituto per l Energia Rinnovabile. Autori: David Moser, PhD; Daniele Vettorato, PhD. Bolzano, Gennaio 2013

Istituto per l Energia Rinnovabile. Autori: David Moser, PhD; Daniele Vettorato, PhD. Bolzano, Gennaio 2013 Istituto per l Energia Rinnovabile Catasto Solare Alta Val di Non Relazione Versione: 2.0 Autori: David Moser, PhD; Daniele Vettorato, PhD. Coordinamento e Revisione: dott. Daniele Vettorato, PhD (daniele.vettorato@eurac.edu)

Dettagli

Manuale Utente SCELTA REVOCA MEDICO ON LINE. Versione 1.0.0

Manuale Utente SCELTA REVOCA MEDICO ON LINE. Versione 1.0.0 Manuale Utente SCELTA REVOCA MEDICO ON LINE Versione 1.0.0 INDICE 1. INTRODUZIONE... 3 2. USO DEL SERVIZIO E FUNZIONALITÀ... 3 2.1 Funzionalità di Revoca del proprio medico... 4 2.2 Funzionalità di scelta/revoca

Dettagli

Interfaccia Web per customizzare l interfaccia dei terminali e

Interfaccia Web per customizzare l interfaccia dei terminali e SIP - Session Initiation Protocol Il protocollo SIP (RFC 2543) è un protocollo di segnalazione e controllo in architettura peer-to-peer che opera al livello delle applicazioni e quindi sviluppato per stabilire

Dettagli

Elettroforesi su gel. L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico.

Elettroforesi su gel. L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico. Elettroforesi su gel L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico. La mobilità della particella dipende dalla forza elettrostatica netta che agisce

Dettagli

Analisi delle Corrispondenze Multiple Prof. Roberto Fantaccione

Analisi delle Corrispondenze Multiple Prof. Roberto Fantaccione Analisi delle Corrispondenze Multiple Prof. Roberto Fantaccione Consideriamo il nostro dataset formato da 468 individui e 1 variabili nominali costituite dalle seguenti modalità : colonna D: Age of client

Dettagli

Esperienza 3: clonaggio di un gene in un plasmide

Esperienza 3: clonaggio di un gene in un plasmide Esperienza 3: clonaggio di un gene in un plasmide Il clonaggio molecolare è una delle basi dell ingegneria genetica. Esso consiste nell inserire un frammento di DNA (chiamato inserto) in un vettore appropriato

Dettagli

Principali caratteristiche piattaforma web smsmobile.it

Principali caratteristiche piattaforma web smsmobile.it SmsMobile.it Principali caratteristiche piattaforma web smsmobile.it Istruzioni Backoffice Post get http VERSION 2.1 Smsmobile by Cinevision srl Via Paisiello 15/ a 70015 Noci ( Bari ) tel.080 497 30 66

Dettagli

DI D AGRA R MM M I M A BLOCC C H C I TEORI R A E D D E SERC R I C ZI 1 1

DI D AGRA R MM M I M A BLOCC C H C I TEORI R A E D D E SERC R I C ZI 1 1 DIAGRAMMI A BLOCCHI TEORIA ED ESERCIZI 1 1 Il linguaggio dei diagrammi a blocchi è un possibile formalismo per la descrizione di algoritmi Il diagramma a blocchi, o flowchart, è una rappresentazione grafica

Dettagli

Sopra ogni aspettativa

Sopra ogni aspettativa Sopra ogni aspettativa Pipette elettroniche Eppendorf Xplorer e Eppendorf Xplorer plus »Un modo intuitivo di lavorare.«chi dà il massimo ogni giorno, merita anche il massimo in termini di strumenti ed

Dettagli

Manuale installazione KNOS

Manuale installazione KNOS Manuale installazione KNOS 1. PREREQUISITI... 3 1.1 PIATTAFORME CLIENT... 3 1.2 PIATTAFORME SERVER... 3 1.3 PIATTAFORME DATABASE... 3 1.4 ALTRE APPLICAZIONI LATO SERVER... 3 1.5 ALTRE APPLICAZIONI LATO

Dettagli

Maurizio Vichi Sapienza Università di Roma

Maurizio Vichi Sapienza Università di Roma Percorsi didattici, interdisciplinari ed innovativi per la Statistica Maurizio Vichi Sapienza Università di Roma Presidente Federazione Europea delle Società Nazionali di Statistica Scuola Estiva di Matematica

Dettagli

Rilevazione degli apprendimenti. Anno Scolastico 2006 2007 PROVA DI MATEMATICA. Scuola Secondaria di II grado. Classe Terza Tipo A. Codici. Scuola:...

Rilevazione degli apprendimenti. Anno Scolastico 2006 2007 PROVA DI MATEMATICA. Scuola Secondaria di II grado. Classe Terza Tipo A. Codici. Scuola:... Ministero della Pubblica Istruzione Rilevazione degli apprendimenti Anno Scolastico 2006 2007 PROVA DI MATEMATICA Scuola Secondaria di II grado Classe Terza Tipo A Codici Scuola:..... Classe:.. Studente:.

Dettagli

ED.FISICA Il doping. STORIA Gli anni 20 negli Usa

ED.FISICA Il doping. STORIA Gli anni 20 negli Usa SCIENZE La genetica ED.FISICA Il doping TECNOLOGIA L automobile e la Ford ED.ARTIST. Il cubismo e Braque STORIA Gli anni 20 negli Usa GEOGRAFIA Gli Usa ITALIANO Il Decadentis mo e Svevo INGLESE ED.MUSICA

Dettagli

Dati importati/esportati

Dati importati/esportati Dati importati/esportati Dati importati Al workspace MATLAB script Dati esportati file 1 File di testo (.txt) Spreadsheet Database Altro Elaborazione dati Grafici File di testo Relazioni Codice Database

Dettagli

Esercizi svolti sui numeri complessi

Esercizi svolti sui numeri complessi Francesco Daddi - ottobre 009 Esercizio 1 Risolvere l equazione z 1 + i = 1. Soluzione. Moltiplichiamo entrambi i membri per 1 + i in definitiva la soluzione è z 1 + i 1 + i = 1 1 + i z = 1 1 i. : z =

Dettagli

Geometria nel piano complesso

Geometria nel piano complesso Geometria nel piano complesso Giorgio Ottaviani Contents Un introduzione formale del piano complesso 2 Il teorema di Napoleone 5 L inversione circolare 6 4 Le trasformazioni di Möbius 7 5 Il birapporto

Dettagli

FONDAMENTI TEORICI DEL MOTORE IN CORRENTE CONTINUA AD ECCITAZIONE INDIPENDENTE. a cura di G. SIMONELLI

FONDAMENTI TEORICI DEL MOTORE IN CORRENTE CONTINUA AD ECCITAZIONE INDIPENDENTE. a cura di G. SIMONELLI FONDAMENTI TEORICI DEL MOTORE IN CORRENTE CONTINUA AD ECCITAZIONE INDIPENDENTE a cura di G. SIMONELLI Nel motore a corrente continua si distinguono un sistema di eccitazione o sistema induttore che è fisicamente

Dettagli

PRESENTAZIONE DI UN SMS AL GATEWAY

PRESENTAZIONE DI UN SMS AL GATEWAY Interfaccia Full Ascii Con questa interfaccia è possibile inviare i dati al Server utilizzando solo caratteri Ascii rappresentabili e solo i valori che cambiano tra un sms e l altro, mantenendo la connessione

Dettagli

Zeroshell come client OpenVPN

Zeroshell come client OpenVPN Zeroshell come client OpenVPN (di un server OpenVpn Linux) Le funzionalità di stabilire connessioni VPN di Zeroshell vede come scenario solito Zeroshell sia come client sia come server e per scelta architetturale,

Dettagli

Equazione della Circonferenza - Grafico di una Circonferenza - Intersezione tra Circonferenza e Retta

Equazione della Circonferenza - Grafico di una Circonferenza - Intersezione tra Circonferenza e Retta Equazione della Circonferenza - Grafico di una Circonferenza - Intersezione tra Circonferenza e Retta Francesco Zumbo www.francescozumbo.it http://it.geocities.com/zumbof/ Questi appunti vogliono essere

Dettagli

19. Inclusioni tra spazi L p.

19. Inclusioni tra spazi L p. 19. Inclusioni tra spazi L p. Nel n. 15.1 abbiamo provato (Teorema 15.1.1) che, se la misura µ è finita, allora tra i corispondenti spazi L p (µ) si hanno le seguenti inclusioni: ( ) p, r ]0, + [ : p

Dettagli

FORM Il sistema informativo di gestione della modulistica elettronica.

FORM Il sistema informativo di gestione della modulistica elettronica. Studio FORM FORM Il sistema informativo di gestione della modulistica elettronica. We believe in what we create This is FORM power La soluzione FORM permette di realizzare qualsiasi documento in formato

Dettagli

Sistemi Operativi. Interfaccia del File System FILE SYSTEM : INTERFACCIA. Concetto di File. Metodi di Accesso. Struttura delle Directory

Sistemi Operativi. Interfaccia del File System FILE SYSTEM : INTERFACCIA. Concetto di File. Metodi di Accesso. Struttura delle Directory FILE SYSTEM : INTERFACCIA 8.1 Interfaccia del File System Concetto di File Metodi di Accesso Struttura delle Directory Montaggio del File System Condivisione di File Protezione 8.2 Concetto di File File

Dettagli

Gli eventi sono stati definiti come i possibili risultati di un esperimento. Ogni evento ha una probabilità

Gli eventi sono stati definiti come i possibili risultati di un esperimento. Ogni evento ha una probabilità Probabilità Probabilità Gli eventi sono stati definiti come i possibili risultati di un esperimento. Ogni evento ha una probabilità Se tutti gli eventi fossero ugualmente possibili, la probabilità p(e)

Dettagli

UN CASO CONCRETO DI VALUTAZIONE DELLA SODDISFAZIONE DEL CLIENTE

UN CASO CONCRETO DI VALUTAZIONE DELLA SODDISFAZIONE DEL CLIENTE Tratto dal corso Ifoa UN CASO CONCRETO DI VALUTAZIONE DELLA SODDISFAZIONE DEL CLIENTE Recentemente, si sono sviluppati numerosi modelli finalizzati a valutare e a controllare il livello di soddisfazione

Dettagli

Rappresentazione dei numeri in un calcolatore

Rappresentazione dei numeri in un calcolatore Corso di Calcolatori Elettronici I A.A. 2010-2011 Rappresentazione dei numeri in un calcolatore Lezione 2 Università degli Studi di Napoli Federico II Facoltà di Ingegneria Rappresentazione dei numeri

Dettagli

Contesti ceramici dai Fori Imperiali

Contesti ceramici dai Fori Imperiali Contesti ceramici dai Fori Imperiali a cura di BAR International Series 2455 2013 Published by Archaeopress Publishers of British Archaeological Reports Gordon House 276 Banbury Road Oxford OX2 7ED England

Dettagli

Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN)

Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN) Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN) System Overview di Mattia Bargellini 1 CAPITOLO 1 1.1 Introduzione Il seguente progetto intende estendere

Dettagli

MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.)

MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.) Diss. ETH Nr. 13793 MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.) A dissertation submitted to the SWISS FEDERAL INSTITUTE OF TECHNOLOGY ZÜRICH For the degree

Dettagli

GUIDA RAPIDA emagister-agora Edizione BASIC

GUIDA RAPIDA emagister-agora Edizione BASIC GUIDA RAPIDA emagister-agora Edizione BASIC Introduzione a emagister-agora Interfaccia di emagister-agora Configurazione dell offerta didattica Richieste d informazioni Gestione delle richieste d informazioni

Dettagli

TASSI DI ASSENZA, MAGGIOR PRESENZA E ASSENTEISMO NETTO DEL PERSONALE DIPENDENTE DIVISO PER AREE DIRIGENZIALI (compresi i Dirigenti)

TASSI DI ASSENZA, MAGGIOR PRESENZA E ASSENTEISMO NETTO DEL PERSONALE DIPENDENTE DIVISO PER AREE DIRIGENZIALI (compresi i Dirigenti) CAMERA DI COMMERCIO NUMERO UNITA' DI PERSONALE 333 333 333 329 332 332 329 328 363 365 360 358 1.256 996 896 1.691 879 1.089 1.736 3.368 1.157 817 1.049 1.543 B) GIORNI LAVORATI COMPLESSIVI 5.709 5.962

Dettagli

BPEL: Business Process Execution Language

BPEL: Business Process Execution Language Ingegneria dei processi aziendali BPEL: Business Process Execution Language Ghilardi Dario 753708 Manenti Andrea 755454 Docente: Prof. Ernesto Damiani BPEL - definizione Business Process Execution Language

Dettagli

Sistemi avanzati di gestione dei Sistemi Informativi

Sistemi avanzati di gestione dei Sistemi Informativi Esperti nella gestione dei sistemi informativi e tecnologie informatiche Sistemi avanzati di gestione dei Sistemi Informativi Docente: Email: Sito: Eduard Roccatello eduard@roccatello.it http://www.roccatello.it/teaching/gsi/

Dettagli

Ambienti di sviluppo integrato

Ambienti di sviluppo integrato Ambienti di sviluppo integrato Un ambiente di sviluppo integrato (IDE - Integrated Development Environment) è un ambiente software che assiste i programmatori nello sviluppo di programmi Esso è normalmente

Dettagli

Calc è il programma per la gestione di fogli di calcolo della suite OpenOffice.org.

Calc è il programma per la gestione di fogli di calcolo della suite OpenOffice.org. Calc è il programma per la gestione di fogli di calcolo della suite OpenOffice.org. Nuovo documento Anteprima di stampa Annulla Galleria Apri Controllo ortografico Ripristina Sorgente dati Salva Controllo

Dettagli

Esercizi di calcolo combinatorio

Esercizi di calcolo combinatorio CORSO DI CALCOLO DELLE PROBABILITÀ E STATISTICA Esercizi di calcolo combinatorio Nota: Alcuni esercizi sono tradotti, più o meno fedelmente, dal libro A first course in probability di Sheldon Ross, quinta

Dettagli