scaricato da Proteine semplici costituite dai soli amminoacidi

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi"

Transcript

1 Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico vengono dette APOPROTEINE Glicoproteine - zuccheri Lipoproteine - lipidi Emoproteine gruppo eme Metalloproteine ioni metallici Nucleoproteine acidi nucleici

2 Struttura chimica delle proteine Ciascuna proteina è un polimero (eteropolimero lineare)costituito da una serie di componenti di base, gli aminoacidi legati tra loro (Monomeri) Esistono circa 20 diversi aminoacidi legati tra loro con un legame (che si chiama legame peptidico) Ciascuna proteina e costituita da un numero variabile di aminoacidi. Sono praticamente gli stessi in tutti i viventi MAGIC TWENTY Le più piccole sono costituite da pochi aminoacidi (in reltà quelle più piccole vengono chiamate polipeptidi) Le più grandi possono essere costituite anche da aminoacidi Gli aminoacidi sono i monomeri costituenti le proteine Gruppo Amminico 2 H La struttura generale di un AA consiste in un atomo di C chirale il quale forma 4 legami con: un gruppo amminico (-NH 2 ) un gruppo carbossilico (-COOH) un atomo di idrogeno (-H) un gruppo indicato con R che rappresenta uno dei 20 gruppi laterali che caratterizzano gli AA Le proteine sono costituite da 20 aminoacidi diversi, caratterizzate da diversi gruppi R. Gruppo Carbossilico

3 Gli AA in soluzioni acquose neutre (anche nelle cellule) si trovano come ioni dipolari; il gruppo carbossilico (acido) libera H + mentre il gruppo amminico (basico) lega H +, per cui nel complesso la molecola presenta due parti con cariche opposte (carica totale neutra): ZWITTERIONE Se disciolto in acqua può comportarsi sia come una base (accettore di protoni): H + +H 3 N + CH(R)COO - H 3 N + CH(R) COOH sia come un acido (donatore di protoni): H 3 N + CH(R)COO - H + + H 2 N CH(R) COO - Le sostanze che possiedono questa proprietà sono ANFOTERE e vengono dette: ANFOLITI (elettroliti anfoteri) Le proteine sono ANFOTERE e avendo aa con residui basici o acidi diversi (che avranno diversa tendenza a dissociarsi a seconda della loro natura e dell ambiente in cui si trovano), per ognuna di esse esisterà un diverso valore di ph al quale il numero dei gruppi basici dissociati come cationi sarà uguale al numero dei gruppi acidi dissociati come anioni (cariche + e cariche - si annullano) la carica elettrica totale della proteina sarà = a zero. Questo valore di ph è detto PUNTO ISOELETTRICO della proteina (Isoelectrofocusing-Elettroforesi)

4 I venti aminoacidi differiscono tra loro in quanto: I residui sono carichi oppure elettricamente neutri I primi possono avere carica positiva o negativa Alcuni hanno residui idrofobici mentre altri hanno residui polari I residui hanno ingombri sterici molto diversi Alcuni residui hanno gruppi funzionali peculiari Questa differenza nelle caratteristiche dei Residui Aminoacidici determina sia la struttura tridimensionale della proteina sia le sue funzionalità La porzione comune ad ogni aminoacido è costituita da un C cui sono legati il gruppo R, un idrogeno e due gruppi funzionali: un gruppo aminico NH 2 e un gruppo carbossilico COOH Il legame peptidico Il legame peptidico è un legame covalente e si forma tra il gruppo carbossilico COOH del primo aa e il gruppo aminico NH 2 del secondo amminoacido DISIDRATAZIONE

5 Il legame peptidico La reazione conduce alla formazione di un legame covalente (tra il gruppo COOH del primo AA ed il gruppo NH 2 del secondo AA, con perdita di una molecola di acqua) stabile C-N detto Legame PEPTIDICO questo è un legame particolare con caratteristiche parziali di doppio legame, la sua vera condizione è quella di essere un ibrido di RISONANZA tra la condizione di legame semplice e quella di doppio legame: Il legame peptidico è una struttura risonante tra due formule limite Esso è sede di un orbitale delocalizzato che copre l O, il C e l N. Per verificarsi tutti e tre gli atomi si trovano in ibridazione sp 2 (3 orbitali posti nello stesso piano formanti un angolo di 120 ) la conseguenza di questo orbitale delocalizzato è: 2 aa il legame peptidico risulta essere una struttura planare rigida. Non si possono effettuare rotazioni intorno al legame C-N senza rompere l orbitale delocalizzato 1 aa Le lunghezze dei legami C-O e C-N sono intermedie tra quelle di un singolo ed un doppio legame Tra gli atomi che formano il legame peptidico esiste uno sbilanciamento di cariche, con parziale carica negativa sull O e parziale carica positiva sull H Il legame C-N è pertanto più breve degli altri legami C-N, in quanto presenta caratteristiche di doppio legame (la rotazione non può avvenire) N-C-C-N-C-C-N-C-C-N-C-C- Legame peptidico Le Proteine presentano una direzione indicata dalle estremità. Direzionalità: NH2 (1 aa) COOH (ultimo aa) scaricato da

6 R R Il legame peptidico si realizza tra il gruppo COOH del 1 aa e il gruppo NH2 del secondo aa e così via DIREZIONE NH2 COOH Nelle proteine si riconoscono quattro diversi livelli di struttura, primaria, secondaria, terziaria e in qualche caso, quaternaria La struttura primaria di una proteina è data dalla sequenza degli aminoacidi che la compongono (SPECIFICITA ) Come vedremo più avanti, questa a sua volta è specificata dalla sequenza di nucleotidi del DNA del gene che specifica per quella proteina A causa dei molteplici legami deboli (legami idrogeno) che si formano tra i residui aminoacidici, non appena sono assemblati gli aminoacidi non rimangono allineati ma le catene si ripiegano in modo ordinato ( struttura secondaria) Esistono due modi principali per ripiegarsi: - α Elica - Foglietto β (foglietto pieghettato)

7 Molecole dotate di polarità NH 2 iniziale COOH terminale elica: ogni gruppo -COOH è legato con un legame H ad un gruppo NH del 4 successivo AA della catena polipeptidica; ciascun residuo è spostato di 0,15 nm lungo l asse dell elica. Ogni giro di 360 contiene 3,6 residui di AA e la distanza tra giri successivi è di 0,54 nm. Le catene laterali sono esterne allo scheletro. La -elica ha andamento antiorario ed è stabilizzata sia dai legami H sia dalle forze di van der Waals. Nella struttura beta le catene sono distese (passo infinito) così la catena vista di profilo ha andamento a ZIG-ZAG ed i gruppi carbossilici ed amminici sono rivolti perpendicolarmente rispetto all andamento della catena per cui i legami H sono perpendicolari alla direzione della catena (INTRACATENA) Il fatto che una certa porzione dalla catena polipeptidica assuma l una o l altra struttura secondaria dipende da quali sono i residui aminoacidici e di conseguenza da quali legami deboli si instaurano La struttura secondaria deriva dai legami a idrogeno tra elementi dello scheletro aminoacidico Struttura : i gruppi amminici e quelli carbossilici formano legami H con regioni distanti della stessa catena ripiegata su se stessa (regioni parallele o antiparallele). Anche questa struttura viene stabilizzata sia dai legami H sia dalle forze di van der Waals.

8 Elica di poliprolina forma una spirale levogira molto allungata con soli 3 AA per giro d elica (la poliprolina è un a-imminoacido -NH per cui il legame Ca-N ha un angolo fisso). STRUTTURA TERZIARIA DELLE PROTEINE: E TIPICA DELLE PROTEINE GLOBULARI ED E DETERMINATA DALLA DIVERE INTERAZIONE TRA I GRUPPI R APPARTENENTI A PARTI DIVERSE DELLA CATENA E POSSONO ESSERE DI 4 TIPI. 1. LEGAMI IONICI 2. LEGAMI H 3. INTERAZIONI IDROFOBICHE (TRA GRUPPI R NON POLARI) 4. PONTI DISOLFURO TRA MOLECOLE DI CISTEINA. Pertanto LA SEQUENZA AMMINOACIDICA DETERMINA: (Struttura III) AD UN DATO ph E AD UNA DATA TEMPERATURA LA DISTRIBUZIONE DEI SEGMENTI AD ALFA ELICA, A STRUTTURA BETA ED A "RANDOM COIL" IL NUMERO E LA POSIZIONE DEI LEGAMI DISOLFURO TRA RESIDUI DI CISTEINA LA LOCALIZZAZIONE DEI RESIDUI DI PROLINA LA POSIZIONE A CUI POSSONO LEGARSI IONI METALLICI, LIPIDI E CARBOIDRATI LE POSIZIONI DEI LEGAMI IDROGENO, LE ATTRAZIONI TRA GRUPPI -R CARICHI POSITIVAMENTE E NEGATIVAMENTE, LE FORZE DI VAN DER WAALS L'EFFETTO NETTO DI QUESTI FATTORI E' DI STABILIRE UNA DISTINTA FORMA TRIDIMENSIONALE PER CIASCUNA PROTEINA CON UN UNICA SEQUENZA. QUESTA FORMA TRIDIMENSIONALE E' LA STRUTTURA TERZIARIA

9 DOMINI STRUTTURALI: Molte proteine presentano dei nuclei con struttura relativamente autonoma, essi svolgono funzioni specifiche nella proteina (legame con determinati coenzimi, interazioni con altre proteine etc..) in questo caso i domini strutturali coincidono con i domini funzionali. Alcune proteine mostrano struttura quaternaria in quanto sono composte da più sub-unità distinte e legate tra loro(si osserva solo nelle proteine multimeriche) Si dà il nome di struttura IV di una proteina al modo in cui diverse subunita (struttura terziaria) si associano tra di loro. Essa deriva dalla disposizione tridimensionale delle catene polipeptidiche

10 Se mettiamo la proteina in un solvente apolare oppure ad un ph o una temperatura molto diversi da quelli nei quali si trovano abitualmente, la proteina cambia forma e perde le sue proprietà (denaturazione) DENATURAZIONE DELLE PROTEINE Transizione dalla struttura nativa a quella di gomitolo statistico In qualche caso si può ritornare allo stato originario ripristinando le condizioni iniziali (rinaturazione) ma per lo più avvengono cambiamenti irreversibili che non lo permettono

11 Rappresentazione di un modello di regolazione allosterica Talune proteine vanno incontro a cambiamenti reversibili di conformazione a seconda del loro stato funzionale

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente)

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente) OVERVIEW Atomo: più piccola porzione di un elemento che mantiene le proprietà chimiche dello stesso Teoria atomica e tavola periodica Legami e interazioni degli atomi Acqua e le sue proprietà Acidi e basi

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

LA CHIMICA DELLA VITA

LA CHIMICA DELLA VITA LA CHIMICA DELLA VITA L elemento presente in tutte le molecole caratteristiche degli esseri viventi è IL CARBONIO Il carbonio ha numero atomico 6 (Z=6). Ha valenza 4: ai suoi atomi mancano 4 elettroni

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O rappresentano il 96% della massa della cellula - Altri component frequenti

Dettagli

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Liceo Scientifico Statale" A.ROMITA" CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza.

Liceo Scientifico Statale A.ROMITA CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza. Liceo Scientifico Statale" A.ROMITA" CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza. La costante di Avogadro. La massa molare. Relazione tra massa di una sostanza

Dettagli

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Corso di BIOCHIMICA Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Materiale didattico e esercizi su: http://moodle2.units.it/ Password: BioFarma

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Acqua e macromolecole

Acqua e macromolecole Acqua e macromolecole La polarità della molecola dell acqua ha un enorme conseguenza, è responsabile della coesività della capacità di stabilizzare la temperatura delle proprietà di solvente dell

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

ELETTRONEGATIVITA CAPACITA DI UN ATOMO DI ATTIRARE UNA COPPIA DI ELETTRONI DI LEGAME DETERMINANDO COSI IL TIPO DI LEGAME CHE SI VIENE A FORMARE. DERIVA DA ALTRE DUE GRANDEZZE I. Energia di ionizzazione:

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

Cos è un trasformazione chimica?

Cos è un trasformazione chimica? Chimica Lezione 1 Cos è un trasformazione chimica? Una reazione chimica è una trasformazione della materia che avviene senza variazioni misurabili di massa, in cui uno o più reagenti iniziali modificano

Dettagli

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte.

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. L organizzazione biologica si basa su una gerarchia di livelli strutturali Si parte dall atomo tessuti organi molecola organismo

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara ATOMI E MOLECOLE Psicobiologia Lezione nr. 1 Prof. Lasaponara La struttura dell atomo I legami chimici e le molecole I componenti elementari della materia vivente 20 miliardi di anni fa Caratteristiche

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

FORZE INTERMOLECOLARI

FORZE INTERMOLECOLARI FORZE INTERMOLECOLARI Le forze intermolecolari sono forze di attrazione che si stabiliscono tra le molecole che costituiscono una sostanza Determinano la tendenza delle molecole ad avvicinarsi. Per ogni

Dettagli

Legame chimico: covalente polare Legame covalente polare

Legame chimico: covalente polare Legame covalente polare Legame chimico: covalente polare Legame covalente polare Il passaggio dal legame covalente al legame ionico è il risultato di una distribuzione elettronica non simmetrica. Il simbolo δ (lettera greca delta

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli