scaricato da Proteine semplici costituite dai soli amminoacidi

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi"

Transcript

1 Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico vengono dette APOPROTEINE Glicoproteine - zuccheri Lipoproteine - lipidi Emoproteine gruppo eme Metalloproteine ioni metallici Nucleoproteine acidi nucleici

2 Struttura chimica delle proteine Ciascuna proteina è un polimero (eteropolimero lineare)costituito da una serie di componenti di base, gli aminoacidi legati tra loro (Monomeri) Esistono circa 20 diversi aminoacidi legati tra loro con un legame (che si chiama legame peptidico) Ciascuna proteina e costituita da un numero variabile di aminoacidi. Sono praticamente gli stessi in tutti i viventi MAGIC TWENTY Le più piccole sono costituite da pochi aminoacidi (in reltà quelle più piccole vengono chiamate polipeptidi) Le più grandi possono essere costituite anche da aminoacidi Gli aminoacidi sono i monomeri costituenti le proteine Gruppo Amminico 2 H La struttura generale di un AA consiste in un atomo di C chirale il quale forma 4 legami con: un gruppo amminico (-NH 2 ) un gruppo carbossilico (-COOH) un atomo di idrogeno (-H) un gruppo indicato con R che rappresenta uno dei 20 gruppi laterali che caratterizzano gli AA Le proteine sono costituite da 20 aminoacidi diversi, caratterizzate da diversi gruppi R. Gruppo Carbossilico

3 Gli AA in soluzioni acquose neutre (anche nelle cellule) si trovano come ioni dipolari; il gruppo carbossilico (acido) libera H + mentre il gruppo amminico (basico) lega H +, per cui nel complesso la molecola presenta due parti con cariche opposte (carica totale neutra): ZWITTERIONE Se disciolto in acqua può comportarsi sia come una base (accettore di protoni): H + +H 3 N + CH(R)COO - H 3 N + CH(R) COOH sia come un acido (donatore di protoni): H 3 N + CH(R)COO - H + + H 2 N CH(R) COO - Le sostanze che possiedono questa proprietà sono ANFOTERE e vengono dette: ANFOLITI (elettroliti anfoteri) Le proteine sono ANFOTERE e avendo aa con residui basici o acidi diversi (che avranno diversa tendenza a dissociarsi a seconda della loro natura e dell ambiente in cui si trovano), per ognuna di esse esisterà un diverso valore di ph al quale il numero dei gruppi basici dissociati come cationi sarà uguale al numero dei gruppi acidi dissociati come anioni (cariche + e cariche - si annullano) la carica elettrica totale della proteina sarà = a zero. Questo valore di ph è detto PUNTO ISOELETTRICO della proteina (Isoelectrofocusing-Elettroforesi)

4 I venti aminoacidi differiscono tra loro in quanto: I residui sono carichi oppure elettricamente neutri I primi possono avere carica positiva o negativa Alcuni hanno residui idrofobici mentre altri hanno residui polari I residui hanno ingombri sterici molto diversi Alcuni residui hanno gruppi funzionali peculiari Questa differenza nelle caratteristiche dei Residui Aminoacidici determina sia la struttura tridimensionale della proteina sia le sue funzionalità La porzione comune ad ogni aminoacido è costituita da un C cui sono legati il gruppo R, un idrogeno e due gruppi funzionali: un gruppo aminico NH 2 e un gruppo carbossilico COOH Il legame peptidico Il legame peptidico è un legame covalente e si forma tra il gruppo carbossilico COOH del primo aa e il gruppo aminico NH 2 del secondo amminoacido DISIDRATAZIONE

5 Il legame peptidico La reazione conduce alla formazione di un legame covalente (tra il gruppo COOH del primo AA ed il gruppo NH 2 del secondo AA, con perdita di una molecola di acqua) stabile C-N detto Legame PEPTIDICO questo è un legame particolare con caratteristiche parziali di doppio legame, la sua vera condizione è quella di essere un ibrido di RISONANZA tra la condizione di legame semplice e quella di doppio legame: Il legame peptidico è una struttura risonante tra due formule limite Esso è sede di un orbitale delocalizzato che copre l O, il C e l N. Per verificarsi tutti e tre gli atomi si trovano in ibridazione sp 2 (3 orbitali posti nello stesso piano formanti un angolo di 120 ) la conseguenza di questo orbitale delocalizzato è: 2 aa il legame peptidico risulta essere una struttura planare rigida. Non si possono effettuare rotazioni intorno al legame C-N senza rompere l orbitale delocalizzato 1 aa Le lunghezze dei legami C-O e C-N sono intermedie tra quelle di un singolo ed un doppio legame Tra gli atomi che formano il legame peptidico esiste uno sbilanciamento di cariche, con parziale carica negativa sull O e parziale carica positiva sull H Il legame C-N è pertanto più breve degli altri legami C-N, in quanto presenta caratteristiche di doppio legame (la rotazione non può avvenire) N-C-C-N-C-C-N-C-C-N-C-C- Legame peptidico Le Proteine presentano una direzione indicata dalle estremità. Direzionalità: NH2 (1 aa) COOH (ultimo aa) scaricato da

6 R R Il legame peptidico si realizza tra il gruppo COOH del 1 aa e il gruppo NH2 del secondo aa e così via DIREZIONE NH2 COOH Nelle proteine si riconoscono quattro diversi livelli di struttura, primaria, secondaria, terziaria e in qualche caso, quaternaria La struttura primaria di una proteina è data dalla sequenza degli aminoacidi che la compongono (SPECIFICITA ) Come vedremo più avanti, questa a sua volta è specificata dalla sequenza di nucleotidi del DNA del gene che specifica per quella proteina A causa dei molteplici legami deboli (legami idrogeno) che si formano tra i residui aminoacidici, non appena sono assemblati gli aminoacidi non rimangono allineati ma le catene si ripiegano in modo ordinato ( struttura secondaria) Esistono due modi principali per ripiegarsi: - α Elica - Foglietto β (foglietto pieghettato)

7 Molecole dotate di polarità NH 2 iniziale COOH terminale elica: ogni gruppo -COOH è legato con un legame H ad un gruppo NH del 4 successivo AA della catena polipeptidica; ciascun residuo è spostato di 0,15 nm lungo l asse dell elica. Ogni giro di 360 contiene 3,6 residui di AA e la distanza tra giri successivi è di 0,54 nm. Le catene laterali sono esterne allo scheletro. La -elica ha andamento antiorario ed è stabilizzata sia dai legami H sia dalle forze di van der Waals. Nella struttura beta le catene sono distese (passo infinito) così la catena vista di profilo ha andamento a ZIG-ZAG ed i gruppi carbossilici ed amminici sono rivolti perpendicolarmente rispetto all andamento della catena per cui i legami H sono perpendicolari alla direzione della catena (INTRACATENA) Il fatto che una certa porzione dalla catena polipeptidica assuma l una o l altra struttura secondaria dipende da quali sono i residui aminoacidici e di conseguenza da quali legami deboli si instaurano La struttura secondaria deriva dai legami a idrogeno tra elementi dello scheletro aminoacidico Struttura : i gruppi amminici e quelli carbossilici formano legami H con regioni distanti della stessa catena ripiegata su se stessa (regioni parallele o antiparallele). Anche questa struttura viene stabilizzata sia dai legami H sia dalle forze di van der Waals.

8 Elica di poliprolina forma una spirale levogira molto allungata con soli 3 AA per giro d elica (la poliprolina è un a-imminoacido -NH per cui il legame Ca-N ha un angolo fisso). STRUTTURA TERZIARIA DELLE PROTEINE: E TIPICA DELLE PROTEINE GLOBULARI ED E DETERMINATA DALLA DIVERE INTERAZIONE TRA I GRUPPI R APPARTENENTI A PARTI DIVERSE DELLA CATENA E POSSONO ESSERE DI 4 TIPI. 1. LEGAMI IONICI 2. LEGAMI H 3. INTERAZIONI IDROFOBICHE (TRA GRUPPI R NON POLARI) 4. PONTI DISOLFURO TRA MOLECOLE DI CISTEINA. Pertanto LA SEQUENZA AMMINOACIDICA DETERMINA: (Struttura III) AD UN DATO ph E AD UNA DATA TEMPERATURA LA DISTRIBUZIONE DEI SEGMENTI AD ALFA ELICA, A STRUTTURA BETA ED A "RANDOM COIL" IL NUMERO E LA POSIZIONE DEI LEGAMI DISOLFURO TRA RESIDUI DI CISTEINA LA LOCALIZZAZIONE DEI RESIDUI DI PROLINA LA POSIZIONE A CUI POSSONO LEGARSI IONI METALLICI, LIPIDI E CARBOIDRATI LE POSIZIONI DEI LEGAMI IDROGENO, LE ATTRAZIONI TRA GRUPPI -R CARICHI POSITIVAMENTE E NEGATIVAMENTE, LE FORZE DI VAN DER WAALS L'EFFETTO NETTO DI QUESTI FATTORI E' DI STABILIRE UNA DISTINTA FORMA TRIDIMENSIONALE PER CIASCUNA PROTEINA CON UN UNICA SEQUENZA. QUESTA FORMA TRIDIMENSIONALE E' LA STRUTTURA TERZIARIA

9 DOMINI STRUTTURALI: Molte proteine presentano dei nuclei con struttura relativamente autonoma, essi svolgono funzioni specifiche nella proteina (legame con determinati coenzimi, interazioni con altre proteine etc..) in questo caso i domini strutturali coincidono con i domini funzionali. Alcune proteine mostrano struttura quaternaria in quanto sono composte da più sub-unità distinte e legate tra loro(si osserva solo nelle proteine multimeriche) Si dà il nome di struttura IV di una proteina al modo in cui diverse subunita (struttura terziaria) si associano tra di loro. Essa deriva dalla disposizione tridimensionale delle catene polipeptidiche

10 Se mettiamo la proteina in un solvente apolare oppure ad un ph o una temperatura molto diversi da quelli nei quali si trovano abitualmente, la proteina cambia forma e perde le sue proprietà (denaturazione) DENATURAZIONE DELLE PROTEINE Transizione dalla struttura nativa a quella di gomitolo statistico In qualche caso si può ritornare allo stato originario ripristinando le condizioni iniziali (rinaturazione) ma per lo più avvengono cambiamenti irreversibili che non lo permettono

11 Rappresentazione di un modello di regolazione allosterica Talune proteine vanno incontro a cambiamenti reversibili di conformazione a seconda del loro stato funzionale

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Le proteine o protidi

Le proteine o protidi Le proteine o protidi A differenza di glucidi e lipidi (che di regola non contengono azoto), le proteine sono composti organici quaternari, che possiedono sempre atomi di azoto nella loro molecola (quasi

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Le molecole della vita

Le molecole della vita Le molecole della vita Introduzione: cose da sapere per capire. Gli atomi (es. carbonio, ossigeno, idrogeno) si uniscono a formare molecole Le molecole costituiscono tutta la materia che ci circonda Atomi

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

LA CHIMICA DELLA VITA

LA CHIMICA DELLA VITA LA CHIMICA DELLA VITA L elemento presente in tutte le molecole caratteristiche degli esseri viventi è IL CARBONIO Il carbonio ha numero atomico 6 (Z=6). Ha valenza 4: ai suoi atomi mancano 4 elettroni

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

Introduzione alla Biochimica

Introduzione alla Biochimica Introduzione alla Biochimica Rappresenta più del 70% del peso degli organismi viventi Notevoli Forze di attrazione Bassa tendenza a ionizzarsi I protoni liberi in soluzione non esistono Ione Ossidrile

Dettagli

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici.

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 1 Il carbonio deve acquistare quattro elettroni per essere stabile

Dettagli

Proteine ed acidi nucleici

Proteine ed acidi nucleici Proteine ed acidi nucleici Prof.ssa Flavia Frabetti aa. 2010-11 PRTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,,,

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Biochimica. studio della vita a livello molecolare

Biochimica. studio della vita a livello molecolare Biochimica studio della vita a livello molecolare studio della composizione molecolare dei sistemi viventi studio delle reazioni chimiche cui vanno incontro i sistemi viventi ALCUNI QUESITI DELLA BIOCHIMICA

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

Il carbonio è l elemento più abbondante nelle molecole biologiche

Il carbonio è l elemento più abbondante nelle molecole biologiche Le biomolecole Il carbonio è l elemento più abbondante nelle molecole biologiche Le molecole contenenti carbonio sono chiamate biomolecole. Le biomolecole fanno parte di un gruppo molto ampio di composti

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

Dettagli

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole.

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. 4.1 Angolo di legame e forma delle molecole Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. La forma e le dimensioni delle molecole, la disposizione

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente)

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente) OVERVIEW Atomo: più piccola porzione di un elemento che mantiene le proprietà chimiche dello stesso Teoria atomica e tavola periodica Legami e interazioni degli atomi Acqua e le sue proprietà Acidi e basi

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O rappresentano il 96% della massa della cellula - Altri component frequenti

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Liceo Scientifico Statale" A.ROMITA" CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza.

Liceo Scientifico Statale A.ROMITA CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza. Liceo Scientifico Statale" A.ROMITA" CLASSE: 2C PROGRAMMA DI CHIMICA. ARGOMENTI: LA MOLE. La mole:unità di quantità e di sostanza. La costante di Avogadro. La massa molare. Relazione tra massa di una sostanza

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

Introduzione alla biologia della cellula. Lezione 3 Le biomolecole DNA e RNA

Introduzione alla biologia della cellula. Lezione 3 Le biomolecole DNA e RNA Introduzione alla biologia della cellula Lezione 3 Le biomolecole DNA e RNA Acidi nucleici DNA (acido desossiribonucleico) RNA (acido ribonucleico) Sono polimeri di monomeri detti NUCLEOTIDI Un nucleotide

Dettagli