Dimensione: px
Iniziare la visualizzazioe della pagina:




2 IL CARCINOMA MAMMARIO MASCHILE (CMM)» Il CMM è una neoplasia rara:» circa 0.6% di tutti i carcinomi mammari» meno 1% di tutti i tumori maschili (Italia 0.2%)»Biologicamente il CMM è simile al carcinoma mammario femminile» il CMM è più frequentemente di tipo duttale infiltrante» ER+/PR+ e HER2-. (Ottini et al Crit Rev Oncol Hematol. 2010)

3 EGFR, HER2 E PIK3CA ECD TD LR CR LR CR Ligand Ligand Ligand X X PTK ICD Tyrosine phosphorilation sites HER1 HER2 HER3 HER4 PIK3CA

4 EGFR, HER2 E PIK3CA NEL CARCINOMA MAMMARIO (CM) MUTAZIONI SOMATICHE 1.7% EGFR 4.3% HER2 8-40% PIK3CA 8-20% EGFR AMPLIFICAZIONE DEL GENE 25-30% HER2 6% PIK3CA OVER-ESPRESSIONE DELLA PROTEINA 30-48% EGFR 30% HER2 (Bae et al 2007, Toyama et al, 2008, Lee et al 2006, Campbell et al, 2004; Levine et al, 2005; Li et al, 2006; Dunlap et al, 2009).

5 RUOLO DI EGFR, HER2 E PIK3CA NEL CM Alto grado tumorale EGFR (Over-espressione) Mutazioni BRCA1, tipo basal cell-like Alto grado tumorale, MIB1+, aneuploidia HER2 (Over-espressione) ER-/PR- ER-/PR- Mutazioni del gene p53 ER+/PR+ PIK3CA (Mutazioni somatiche) N1, T>2 cm (Uberall et al, 2008, Bianchi et al, 2006 Hayes & Thor, 2002; Masood & Bui, 2002, Bachman et al, 2004; Saal et al, 2005; Maruyama et al, 2007)

6 OBIETTIVI Analizzare la presenza e il ruolo di alterazioni in linea somatica (mutazioni, amplificazione ed espressione) di EGFR, HER2 e PIK3CA Identificare sottogruppi di CMM con specifiche caratteristiche patologiche e biologiche, mediante valutazione di possibili associazioni tra Espressione ER, PR, HER2, MIB1 ALTERAZIONI DI PIK3CA, EGFR E HER2 vs GRADO TUMORALE (G) Mutazioni BRCA1/BRCA2

7 CASISTICA ESAMINATA 102 campioni tumorali di pazienti affetti da CMM: Per ciascun caso è stato ottenuto consenso informato allo studio; sezioni consecutive da blocchetti di preparati istologici di tumori primari inclusi in paraffina o congelati; due o più campioni di sangue fresco; informazioni dettagliate relative alla storia personale e familiare di cancro; referti patologici.

8 ANALISI DI ALTERAZIONI SOMATICHE DI PIK3CA Analisi mutazionale PIK3CA G1633A (E545K):in 3 casi (3%) 1659delT(S553X): in 1 caso (1%) G1658C(S553T):in 1 caso (1%) T C A C T A A G C G A T G G A G T C A C A G G A C C A C A G G A T * PIK3CA 1633G>A (E545K) (freccia) Mutazione PIK3CA 1659delT (freccia) e variante missenso 1658G>C (S553T) (asterisco).

9 ANALISI DELLA VARIANTE 1658G>C (S553T) Sequenziamento diretto degli alleli (A) e (B) isolati mediante clonaggio per la mutazione 1659delT e per la variante 1658G>C (A) Analisi in silico SIFT POLYPHEN Pmut A-GVGD S 553T Tolerated Benign Neutral Class 55 Tutti e quattro i programmi hanno evidenziato un ruolo neutro per questa variante delt G (B) Analisi comparativa tra omologhi di PIK3CA mediante EXPRESSO(3DCoffee) Regular Human SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Mouse SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Rat SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Chicken SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVK Bovine SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Chimpanzee SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Hamster SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Entrambe le alterazioni sono presenti sullo stesso allele (B) Il codone S553 è conservato in tutte le specie considerate (uomo, ratto, topo, toro, scimpanzé e criceto) come del resto tutta la sequenza amminoacidica della proteina PIK3CA.

10 RQ ANALISI DI ALTERAZIONI SOMATICHE DI PIK3CA Amplificazione genica Casi CMM Il gene PIK3CA risulta amplificato in 6/74 (8.1%) campioni tumorali di CMM

11 ANALISI DI ALTERAZIONI SOMATICHE DI EGFR Analisi mutazionale Legame EGF Legame EGF TM interazione di HER2 esone 2-4 esone 5-6 esone 7-12 esone Dominio tirosin-chinasico PIK3C2B c-cbl G2547A(Q787Q): in 15 casi C2934T(N916N): in 1 caso aa745 ATP G2547A(Q787Q) C2934T (N916N) 2547G A G Variante EGFR 2547 G A (Q787Q) riscontrata in 15 casi

12 RQ ANALISI DI ALTERAZIONI SOMATICHE DI EGFR Amplificazione genica Casi CMM Il gene EGFR risulta amplificato in 5/70 (7.1%) campioni tumorali di CMM

13 Immunoistochimica di HER2 71,7% 27,5% Analisi immunoistochimica di HER2 (Paget) Analisi IHC condotta su 91casi di CMM:» 27.5% (25/91) esprimono HER2» 71.7% (66/91) non esprimono HER2 HER2: non sono state riscontrate mutazioni patogenetiche

14 ALTERAZIONI DI PIK3CA, EGFR E HER2 vs ER, PR, HER2, MIB1, G E MUTAZIONI BRCA1/2 Associazioni statisticamante significative tra: amplificazione PIK3CA e HER2+ (p=0.04) MIB1+ (p=0.04) amplificazione di EGFR e ER- (p=0.04) HER2+ (p=0.018) MIB1+ (p=0.05) over-espressione di HER2 e PR- (p=0.03) MIB1+ (p=0.048) G3 (p=0.001) mutazioni di BRCA2 (p=0.01) Tutti i tumori mutati per PIK3CA sono risultati ER/PR+

15 CONCLUSIONI (1) I risultati ottenuti dall analisi dell associazione tra alterazioni di PIK3CA, EGFR e HER2 e caratteristiche immunofenotipiche suggeriscono che: PIK3CA potrebbe avere un ruolo nella progressione tumorale del CMM Alterazioni di EGFR e HER2 potrebbero essere associate ad un fenotipo aggressivo nel CMM

16 CONCLUSIONI (2)»I risultati ottenuti in questo studio indicano che PIK3CA, EGFR e HER2 giocano un ruolo nel CMM a livelli paragonabili a quelli osservati nel CM femminile e che la presenza di alterazioni di PIK3CA, EGFR e HER2 permette di identificare un sottogruppo di casi di CMM con specifiche caratteristiche patologiche e biologiche suscettibili di terapie mirate

17 Ringraziamenti Dipartimento di Patologia Umana e Oncologia, Azienda Ospedaliero-Universitaria Careggi, Dipartimento di Medicina Molecolare Sapienza Università di Roma Firenze. Dott.ssa Simonetta Bianchi Prof.ssa Laura Ottini Dott.ssa Valentina Silvestri Dott. Mario Falchetti Dott.ssa Veronica Graziano Dott.ssa Anna Sara Navazio Unità di Epidemiologia Molecolare e Nutrizionale, ISPO, Firenze Dott. Domenico Palli Dott.ssa Ines Zanna

I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese

I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese Daniela Furlan U.O. Anatomia Patologica, Ospedale di Circolo e Fondazione Macchi, Varese Il


Il test genetico BRCA1/BRCA2

Il test genetico BRCA1/BRCA2 L identificazione Il test genetico BRCA1/BRCA2 M.G.Tibiletti UO Anatomia Patologica Ospedale di Circolo-Università dell Insubria Varese IL CARCINOMA MAMMARIO FORME SPORADICHE FORME EREDITARIE FORME FAMIGLIARI





Espressione di geni specifici per un determinato tumore

Espressione di geni specifici per un determinato tumore Espressione di geni specifici per un determinato tumore Paziente A: Non ha il cancro Espressione dei geni: Nessuna Biopsia Geni associati al cancro allo stomaco Paziente B: Ha un tumore allo stomaco Bassa


Ruolo della biologia molecolare nel carcinoma ovarico

Ruolo della biologia molecolare nel carcinoma ovarico Carcinoma ovarico avanzato: quali novità per il 2015? Ruolo della biologia molecolare nel carcinoma ovarico Anna Pesci Ospedale SC Don Calabria, Negrar TIPO I TIPO II Basso stadio



Gallarate 11 giugno 2011 ASSOCIAZIONE ITALIANA TECNICI di ISTOLOGIA e CITOLOGIA SEZIONE LOMBARDA Aggiornamenti 2011 Corso di aggiornamento per Tecnici di Laboratorio Gallarate 11 giugno 2011 ASSOCIAZIONE ITALIANA TECNICI di ISTOLOGIA e CITOLOGIA Azienda Ospedaliera S. Antonio Abate


Cancro della mammella nelle teen-agers

Cancro della mammella nelle teen-agers Cancro della mammella nelle teen-agers Società Triveneta di Chirurgia Padova 12 dicembre 2014 Dott.ssa E. Goldin Dott. A. Marchet Dott. A. Varotto Prof. D. Nitti U.O. Clinica Chirurgica I Padova CASO CLINICO





Her-2 nel carcinoma mammario

Her-2 nel carcinoma mammario Her-2 nel carcinoma mammario Piera Balzarini U.O. Anatomia Patologica Università degli Studi di Brescia Spedali Civili di Brescia Il gene ERBB2 dà origine ad un recettore tirosin-chinasico appartenente


Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families

Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families Modena 18-19 novembre 2010 Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families Dr. Laura La Paglia FOUNDER MUTATIONS in BRCA1/2 NELLA POPOLAZIONE EUROPEA e NON POPOLAZIONE


CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010

CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 TEST FUNZIONALE EX VIVO DI SPLICING PER LA DIAGNOSTICA MOLECOLARE DEL CARCINOMA DEL SENO E DELL


SEBASTIANO FILETTI. Dipartimento di Medicina Interna e Specialità Mediche. Università di Roma Sapienza, Roma

SEBASTIANO FILETTI. Dipartimento di Medicina Interna e Specialità Mediche. Università di Roma Sapienza, Roma SEBASTIANO FILETTI Dipartimento di Medicina Interna e Specialità Mediche Università di Roma Sapienza, Roma La malattia tiroidea è in aumento negli ultimi anni. Quali le ragioni? Dati epidemiologici provenienti



XIII RIUNIONE ANNUALE ASSOCIAZIONE ITALIANA REGISTRI TUMORI - AIRTUM Siracusa, 6/8 Maggio 2009. R. Sunseri 2,N. Romano 2. XIII RIUNIONE ANNUALE ASSOCIAZIONE ITALIANA REGISTRI TUMORI - AIRTUM Siracusa, 6/8 Maggio 2009 Sottotipi di carcinoma della mammella identificati con markers immunoistochimici: dati del Registro Tumori


Unità Operativa Complessa ANATOMIA PATOLOGICA

Unità Operativa Complessa ANATOMIA PATOLOGICA Unità Operativa Complessa ANATOMIA PATOLOGICA sanitaria Descrizione L obiettivo fondamentale è fornire diagnosi corrette, complete, tempestive e clinicamente rilevanti. Gli esami istologici e citologici


Unità Operativa Complessa ANATOMIA PATOLOGICA

Unità Operativa Complessa ANATOMIA PATOLOGICA Unità Operativa Complessa ANATOMIA PATOLOGICA sanitaria Descrizione L obiettivo fondamentale è fornire diagnosi corrette, complete, tempestive e clinicamente rilevanti. Gli esami istologici e citologici





PRODA Istituto di Diagnostica Clinica

PRODA Istituto di Diagnostica Clinica Test genetici per evidenziare il rischio di trombolfilia Il Fattore V della coagulazione è un cofattore essenziale per l attivazione della protrombina a trombina. La variante G1691A, definita variante



EREDITARIETÀ E TUMORE MAMMARIO. U.O. Genetica Medica EREDITARIETÀ E TUMORE MAMMARIO Dott.ssa M.Neri U.O. Genetica Medica Responsabile Consulenza Oncogenetica Prof.ssa A. Ferlini Direttore U.O. Genetica Medica I TUMORI AL SENO EREDITARI : L IMPORTANZA DELLA





La mutazione c.34g>t del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH

La mutazione c.34g>t del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH Tumori Ereditari : dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 La mutazione c.34 del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH Tiziana Venesio, Antonella


Carcinoma mammario in gravidanza: Aspetti anatomopatologici. Varese 23 maggio 2013

Carcinoma mammario in gravidanza: Aspetti anatomopatologici. Varese 23 maggio 2013 Carcinoma mammario in gravidanza: Aspetti anatomopatologici Varese 23 maggio 2013 diagnosi Tecniche diagnostiche Campione rappresentativo di anomalia Mammo- Ecografica Agoaspirato (FNA) Agobiopsia core


Progetto sulle esostosi multiple

Progetto sulle esostosi multiple Progetto sulle esostosi multiple PROGETTO SULLE ESOSTOSI MULTIPLE EREDITARIE Dott. Leonardo D Agruma Servizio di Genetica Medica - Dipartimento dell Età Evolutiva IRCCS Ospedale Casa Sollievo della Sofferenza



APPROFONDIMENTO PROGETTO DI RICERCA IRST IRCCS cod. L3P923 APPROFONDIMENTO PROGETTO DI RICERCA IRST IRCCS cod. L3P923 Titolo del progetto Studio dell'interazione tra le cellule del midollo osseo e le cellule tumorali del cancro alla mammella in piattaforme tridimensionali


Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi

Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi IV Congresso Regionale I Congresso del Middle Management di Area Tecnica Federazione Italiana Tecnici di Laboratorio Biomedico Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi Dott.ssa


La terapia del carcinoma mammario metastatico: ruolo delle antracicline

La terapia del carcinoma mammario metastatico: ruolo delle antracicline La terapia del carcinoma mammario metastatico: ruolo delle antracicline Hotel AC, 8 ottobre 2014 Razionale Il carcinoma della mammella rappresenta uno dei settori dell oncologia nel quale maggiori sono


Il ruolo dei marcatori molecolari nello screening colo rettale

Il ruolo dei marcatori molecolari nello screening colo rettale Il ruolo dei marcatori molecolari nello screening colo rettale Cristina Sani (1), Leonardo Ventura (2), Marco Zappa (2), Carlo Senore (3), Luigi Bisanti (4), Grazia Grazzini (5), Germana Martinasso (3),


Lo sviluppo del cancro è un processo complesso che coinvolge parecchi cambiamenti nella stessa cellula staminale. Poiché tutte le cellule staminali

Lo sviluppo del cancro è un processo complesso che coinvolge parecchi cambiamenti nella stessa cellula staminale. Poiché tutte le cellule staminali Tumore Cos è il tumore? Il tumore o neoplasia (dal greco neo,, nuovo, e plasìa,, formazione), o cancro se è maligno, è una classe di malattie caratterizzate da una incontrollata riproduzione di alcune


20 febbraio 2012. Muore Renato Dulbecco

20 febbraio 2012. Muore Renato Dulbecco 20 febbraio 2012 Muore Renato Dulbecco la possibilità di avere una visione completa e globale del nostro DNA ci aiuterà a comprendere le influenze genetiche e non genetiche sul nostro sviluppo, la nostra


Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica

Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica Daniela Turchetti Cattedra e Unità Operativa di Genetica Medica Università di Bologna/Policlinico S.Orsola-Malpighi


Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze

Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Dott. Elena Niccolai, PhD Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Premio Gianfranco Del Prete per le malattie orfane, Firenze 8 novembre 2014 ADENOCARCINOMA PANCREATICO


Oggetto: presentazione progetto di ricerca anno 2010

Oggetto: presentazione progetto di ricerca anno 2010 Associazione Un Vero Sorriso Onlus via Morghen, 5 10143 Torino Torino, 01/10/2010 Oggetto: presentazione progetto di ricerca anno 2010 Titolo: Nuovi approcci per l identificazione di mutazioni rare in



IL RUOLO DELLE SOCIETA SCIENTIFICHE SIAPeC IAP Roma 25-26 ottobre 2011 Camera dei Deputati Palazzo Marini Sala della Mercede IL RUOLO DELLE SOCIETA SCIENTIFICHE SIAPeC IAP (Società di Anatomia Patologica e Citopatologia diagnostica Divisione Italiana


Screening dei soggetti a rischio e diagnostica molecolare

Screening dei soggetti a rischio e diagnostica molecolare Screening dei soggetti a rischio e diagnostica molecolare Daniela Furlan U.O. Anatomia Patologica Varese, 3 luglio 2012 Il carcinoma pancreatico Patogenesi Suscettibilità genetica Implicazioni diagnostiche


A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo

A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo 2 Convegno Nazionale Sindrome di Rubinstein Taybi Lodi, 17 19 maggio 2013 A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo Donatella Milani Cristina



GENETICA DEL TUMORE DEL COLON-RETTO GENETICA DEL TUMORE DEL COLON-RETTO EPIDEMIOLOGIA In tutto l'occidente, il cancro del colon-retto occupa, per incidenza, il secondo posto tra i tumori maligni, preceduto dal tumore al polmone nell'uomo


XIII Meeting AIRTum, Siracusa 6-8 maggio 2009




Quotidiano. Quotidiano 097156 Quotidiano 097156 Lettori: 2.835.000 Diffusione: 431.913 12-NOV-2013 Dir. Resp.: Ezio Mauro da pag. 1 Lettori: 2.835.000 Diffusione: 431.913 12-NOV-2013


L informazione ottenuta dal test genetico può apportare notevoli benefici, quali:

L informazione ottenuta dal test genetico può apportare notevoli benefici, quali: INFORMATIVA E CONSENSO INFORMATO ALL ESAME BREASTSCREEN Il test BreastScreen BreastScreen è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi genetica multipla per valutare


Biomarkers per la diagnosi precoce di tumori

Biomarkers per la diagnosi precoce di tumori Università degli Studi di Bari Aldo Moro Dipartimento di Bioscienze, Biotecnologie e Biofarmaceutica Biomarkers per la diagnosi precoce di tumori Dott.ssa Maria Luana Poeta Cos è un Tumore Omeostasi Tissutale


Patologia molecolare del carcinoma della mammella: cosa un patologo deve sapere. Vicenza 20 marzo 2014 Dott. Duilio Della Libera

Patologia molecolare del carcinoma della mammella: cosa un patologo deve sapere. Vicenza 20 marzo 2014 Dott. Duilio Della Libera Patologia molecolare del carcinoma della mammella: cosa un patologo deve sapere Vicenza 20 marzo 2014 Dott. Duilio Della Libera 80% carcinomi duttali nas Dimensioni Status linfonodale Outcome Grading


Ufficio Stampa mercoledì 17 dicembre 2014. Il ringraziamento della Direzione Aziendale per questa importante donazione

Ufficio Stampa mercoledì 17 dicembre 2014. Il ringraziamento della Direzione Aziendale per questa importante donazione PRATO La generosità della Fondazione Sandro Pitigliani per la lotta contro i tumori Il ringraziamento della Direzione Aziendale per questa importante donazione Strumenti ed attrezzature per migliorare


Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto. Carmelo Lupo

Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto. Carmelo Lupo Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto Carmelo Lupo RAS-RAF signaling Activation of the RAS-RAF signaling cascade occurs via the following sequential steps 1 : Activation


Caso clinico. Laura Cimetti

Caso clinico. Laura Cimetti Gazzada Schianno 16 Ottobre 2014 Caso clinico Laura Cimetti Dipartimento di Scienze Chirurgiche e Morfologiche Servizio di Anatomia e Istologia Patologica Università degli Studi dell Insubria e Ospedale


SCHEDA INFORMATIVA. Laureato in Scienze Biologiche esperto nel campo dell'oncologia mammaria (2 unità)

SCHEDA INFORMATIVA. Laureato in Scienze Biologiche esperto nel campo dell'oncologia mammaria (2 unità) Servizio del Personale Progetto Caratterizzazione molecolare del carcinoma mammario triplonegativo (Triple Negative Breast Cancer) e screening di nuovi potenziali agenti terapeutici attivi sul sistema


Tumore della mammella rischio eredo-familiare

Tumore della mammella rischio eredo-familiare Università di Torino Dipartimento di Genetica Biologia e Biochimica barbara pasini Tumore della mammella rischio eredo-familiare problematiche linee guida ipotesi di progetto regionale Tumore della mammella


PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013. Torino 7 novembre 2013. Anatomia Patologica. Isabella Castellano

PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013. Torino 7 novembre 2013. Anatomia Patologica. Isabella Castellano PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013 Torino 7 novembre 2013 Anatomia Patologica Isabella Castellano Dipartimento di Scienze Mediche Università di Torino Anatomia


Patologia e aspetti biologici nel carcinoma mammario metastatico

Patologia e aspetti biologici nel carcinoma mammario metastatico Patologia e aspetti biologici nel carcinoma mammario metastatico Cristina Riva Laura Cimetti Dipartimento di Morfologia Umana Università dell Insubria Varese Il 20-30% delle pazienti affette da carcinoma


ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO

ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO Il rapporto tra ormoni e carcinomi della mammella ormonodipendenti venne dimostrato per la prima volta nel 1896 da Beatson. L ovariectomia determinava


La Biopsia Prostatica: where are we going?

La Biopsia Prostatica: where are we going? La Biopsia Prostatica: where are we going? Sabato 28 Novembre 2015, Catania Dott. Michele Salemi Screening genetico correlato a rischio di carcinoma prostatico. BRCA1, BRCA2, TP53, CHEK2, HOXB13 e NBN:


Carta dei Servizi rev. 1 aprile 2007. Unità Operativa di Anatomia Patologica Ospedale di Bussolengo

Carta dei Servizi rev. 1 aprile 2007. Unità Operativa di Anatomia Patologica Ospedale di Bussolengo Carta dei Servizi rev. 1 aprile 2007 Unità Operativa di Ospedale di Bussolengo Azienda ULSS n. 22 Bussolengo (VR) Dipartimento di Diagnosi e Cura Unità Operativa di Ospedale di Bussolengo Monoblocco -


Carcinoma mammario nelle giovani donne

Carcinoma mammario nelle giovani donne Carcinoma mammario nelle giovani donne RELATORI E MODERATORI Eraldo O. Bucci Responsabile - UO Oncologia Medica MultiMedica Castellanza Azzurra Cangiano Psicooncologia UO Oncologia Medica MultiMedica Castellanza


Fisiologia dell emostasi

Fisiologia dell emostasi 1 STRATEGIE DIAGNOSTICHE PER L EMOFILIA A DEL CANE Marco Caldin DVM, PhD, ECVCP Diplomate 2 Fisiologia dell emostasi 1 3 Fisiologia dell emostasi 4 Attivazione emostatica 2 5 Emostasi primaria 6 Emostasi


Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE

Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE EREDITA MENDELIANA CLASSICA ~ 600 E C M 10.000 Enzimi


Verso la terapia personalizzata

Verso la terapia personalizzata Verso la terapia personalizzata M.G.Tibiletti Genetista Ospedale di Circolo-Università dell Insubria Varese Soroptimist Club Varese Varese 20 aprile 2013 Test genetici DIAGNOSTICI PRESINTOMATICI PREDITTIVI,


Analisi della Malattia Minima Residua

Analisi della Malattia Minima Residua XIX CORSO NAZIONALE PER TECNICI DI LABORATORIO BIOMEDICO Riccione, 22-25 Maggio 2012 Analisi della Malattia Minima Residua Dr.ssa Anna Gazzola Laboratorio di Patologia Molecolare, Sezione di Emolinfopatologia,



INFORMATIVA E CONSENSO INFORMATO ALL ESAME ONCOSCREENING INFORMATIVA E CONSENSO INFORMATO ALL ESAME ONCOSCREENING Il test OncoScreening OncoScreening è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi multipla per valutare


Dott.ssa Ilaria Barchetta

Dott.ssa Ilaria Barchetta Dott.ssa Ilaria Barchetta Dipartimento di Medicina Interna e Specialità Mediche Sapienza Università di Roma Diverse evidenze sperimentali hanno dimostrato una influenza diretta della vitamina D non solo


Linfonodo sentinella. metodo OSNA: esperienze e confronto con il metodo tradizionale

Linfonodo sentinella. metodo OSNA: esperienze e confronto con il metodo tradizionale Linfonodo sentinella secondo metodo OSNA: esperienze e confronto con il metodo tradizionale Dott.ssa C.M.. Antonacci U.O. Anatomia Patologica A.O. Ospedale Luigi Sacco di Milano Linfonodo sentinella Il


la storia di HER2 Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche HER2: Human Epidermal Receptor

la storia di HER2 Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche HER2: Human Epidermal Receptor Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche la storia di HER2 V. Martin 28 giugno 2011 HER2: Human Epidermal Receptor HER2 e carcinoma mammario alias c-erb, ERBB2, HER-



FONTANAROSA VITO MARIA CV EUROPEO Nome FONTANAROSA VITO MARIA Data di nascita 07/02/1960 ESPERIENZA LAVORATIVA INTERNA Nome e indirizzo del datore di lavoro Date (da - a) 01/01/2012 - in corso Tipo di azienda o settore PUBBLICO AZIENDA


Cetuximab e mutazione K-Ras nel tumore del colon-retto

Cetuximab e mutazione K-Ras nel tumore del colon-retto Università di Pisa Dipartimento di Farmacia Corso di laurea in CTF Corso: Basi biochimiche dell azione dei farmaci Cetuximab e mutazione K-Ras nel tumore del colon-retto Pisa, 27/03/2014 Samuela Fabiani



INFORMATIVA E CONSENSO INFORMATO ALL ESAME COLONSCREEN INFORMATIVA E CONSENSO INFORMATO ALL ESAME COLONSCREEN Il test ColonScreen ColonScreen è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi genetica multipla per valutare


Strumenti di valutazione del rischio familiare Daniela Turchetti

Strumenti di valutazione del rischio familiare Daniela Turchetti Strumenti di valutazione del rischio familiare Daniela Turchetti Misura ciò che è misurabile e rendi misurabile ciò che non lo è Galileo Galilei (1564-1642) Casi multipli di cancro nella famiglia Cancro


Immunoterapia - molecole differenzianti antiproliferative

Immunoterapia - molecole differenzianti antiproliferative Con il Patrocinio dell Ordine Dei Medici Chirurghi di Bologna Congresso: EVIDENZE SCIENTIFICHE NON VALORIZZATE IN ONCOTERAPIA : Immunoterapia - molecole differenzianti antiproliferative Bologna, 9 Giugno


Mutazioni cromosomiche. Le mutazioni cromosomiche sono la causa più frequente di aborto precoce e una importante causa di ritardo mentale nell uomo

Mutazioni cromosomiche. Le mutazioni cromosomiche sono la causa più frequente di aborto precoce e una importante causa di ritardo mentale nell uomo Mutazioni cromosomiche Le mutazioni cromosomiche sono la causa più frequente di aborto precoce e una importante causa di ritardo mentale nell uomo Mutazioni cromosomiche Variazioni della struttura Variazioni


Test genetico BRCA1 & BRCA2. Il test identifica la predisposizione a sviluppare il tumore alla mammella e il tumore ovarico

Test genetico BRCA1 & BRCA2. Il test identifica la predisposizione a sviluppare il tumore alla mammella e il tumore ovarico Test genetico BRCA1 & BRCA2 Il test identifica la predisposizione a sviluppare il tumore alla mammella e il tumore ovarico I geni BRCA1 e BRCA2 Il tumore della mammella è la neoplasia più frequente nella


Meccanismi di controllo della proliferazione cellulare

Meccanismi di controllo della proliferazione cellulare Meccanismi di controllo della proliferazione cellulare Il ciclo cellulare è regolato dall azione di PROTOONCOGENI e (attivatori della proliferazione cellulare) GENI ONCOSOPPRESSORI (inibitori del ciclo






ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) Il gene implicato nella SCA17 è il gene TATA box-binding protein (TBP) che fa parte del complesso della RNA polimerasi II ed è essenziale per dare inizio


Salute e Genere Ipotesi di lavoro nelle Marche

Salute e Genere Ipotesi di lavoro nelle Marche Salute e Genere Ipotesi di lavoro nelle Marche Ancona, 14 aprile 2012 L esperienza della Medicina di Genere nell Azienda Ospedali Riuniti di Ancona. Dall organizzazione alla clinica Perdita di salute nella



CENTRO REGIONALE DI GENETICA ONCOLOGICA CARTA DEI SERVIZI Regione Marche Università Politecnica delle Marche Azienda O.U. Ospedali Riuniti Ancona CENTRO REGIONALE DI GENETICA ONCOLOGICA CARTA DEI SERVIZI - Personale - Presentazione - Prestazioni - Accesso al


Dir. Resp.: Annalisa Monfreda. 07-APR-2015 da pag. 46

Dir. Resp.: Annalisa Monfreda. 07-APR-2015 da pag. 46 Tiratura 01/2015: 302.629 Diffusione 01/2015: 226.145 Lettori III 2014: 1.869.000 Dati rilevati dagli Enti certificatori o autocertificati Dir. Resp.: Annalisa Monfreda 07-APR-2015 da pag. 46 Tiratura


Tecniche di patologia molecolare finalizzate all'analisi di mutazioni

Tecniche di patologia molecolare finalizzate all'analisi di mutazioni Tecniche di patologia molecolare finalizzate all'analisi di mutazioni dei geni predittivi di risposta alla terapia oncologica Carmelo Lupo Casa di Cura La Maddalena Palermo Test molecolari PREDITTIVI di


La mutazione è una modificazione della sequenza delle basi del DNA

La mutazione è una modificazione della sequenza delle basi del DNA La mutazione è una modificazione della sequenza delle basi del DNA Le mutazioni sono eventi rari e importanti in quanto sono alla base dell evoluzione biologica Le mutazioni possono essere spontanee (dovute



DIFFERENZA DI GENERE E MEDICINA DIFFERENZA DI GENERE E MEDICINA L ONU, l Europa e l OMS raccomandano che il determinante genere sia tenuto presente nella programmazione delle politiche sanitarie. L ONU ha inserito la medicina di genere


ARCOmenti di oncologia:

ARCOmenti di oncologia: ARCOmenti di oncologia: Il TUMORE DELLA PROSTATA Dott. Donatella Parentini - Giancarlo Mancabelli SNAMID CREMONA 26 febbraio 2011 Sala Maffei Camera di Commercio di Cremona DEVO FARE UN TEST PSA DOTTORE?


Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon

Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Carmelo Lupo Coordinatore Tecnico U.O. Anatomia Patologica e Patologia Molecolare


Exome sequencing in sporadic autism spectrum disorders identifies severe de novo mutations

Exome sequencing in sporadic autism spectrum disorders identifies severe de novo mutations Exome sequencing in sporadic autism spectrum disorders identifies severe de novo mutations Brian J O Roak1, Pelagia Deriziotis2, Choli Lee1, Laura Vives1, Jerrod J Schwartz1, Santhosh Girirajan1, Emre


Le zone grigie della citologia tiroidea.

Le zone grigie della citologia tiroidea. Carcinoma differenziato della tiroide: dalla diagnosi al follow-up Bologna 21 marzo 2009 Le zone grigie della citologia tiroidea. Cosa deve dire il patologo Gian Piero Casadei Anatomia Patologica Ospedale


La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013

La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013 La sindrome di Lynch Cancro colonrettale ereditario non poliposico o HNPCC G. A. Pablo Cirrone 1 Caratteristiche generali I HNPCC (Hereditary Non-Polyposis Colonrectal Cancer) è caratterizzato dalla comparsa,


Caratterizzazione Molecolare di Cellule Staminali di Leucemia Mieloide Acuta

Caratterizzazione Molecolare di Cellule Staminali di Leucemia Mieloide Acuta 2 Workshop Nazionale SIES Ematologia Traslazionale Verona, 21-22 Maggio 2009 Caratterizzazione Molecolare di Cellule Staminali di Leucemia Mieloide Acuta Simona Salati Universita di Modena and Reggio Emilia


Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione

Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione Milano - Nonostante la sua aggressività è definito il tumore silenzioso. Data la sua scarsa pubblicizzazione, infatti,



LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI Il Consiglio Direttivo Nazionale LILT, nella seduta del 19 marzo 2015, ha formalmente approvato la documentazione relativa ai lavori della Commissione tecnico-scientifica


REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014

REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014 REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014 Il Comitato Scientifico AIOM e SIAPEC-IAP ha organizzato per


Il Cancro è una malattia genetica

Il Cancro è una malattia genetica Il Cancro è una malattia genetica PROCESSO MULTIFASICO Il Cancro è sempre genetico Talvolta il cancro è ereditario Ciò che viene ereditato non è la malattia, bensì la PREDISPOSIZIONE In assenza di ulteriori


Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci

Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci Negli ultimi anni c è stato un notevole cambiamento nella gestione diagnosticoterapeutica dei soggetti affetti da neoplasia


Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica

Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica 17 corso nazionale per Tecnici di Laboratorio Biomedico Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica Dott.ssa Maura Pandolfi Istituto di Anatomia


Le terapie neoadiuvanti

Le terapie neoadiuvanti Le terapie neoadiuvanti Giancarlo Bisagni Dipartimento di Oncologia TERAPIA NEOADIUVANTE definizione SINONIMI: TERAPIA PRIMARIA TERAPIA PREOPERATORIA DEFINIZIONE: trattamento medico somministrato prima



ESPERIENZA REGIONE PIEMONTE ( formazione) Convegno Nazionale GISMa 2009 Workshop multidisciplinare dell equipe diagnosticoterapeutica Monitoraggio degli indicatori di qualità ESPERIENZA REGIONE PIEMONTE ( formazione) Rita Bordon CPO Piemonte Francesca





Classificazione del carcinoma mammario

Classificazione del carcinoma mammario Classificazione del carcinoma mammario Carcinoma mammario invasivo Carcinoma più frequente della donna: 1 su 9 Rischio aumentato con l étà Def.: Lesione epiteliale maligna invasiva derivata dalla unità


Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale. Simona Duranti Progetto Canoa Carcinoma Mammario

Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale. Simona Duranti Progetto Canoa Carcinoma Mammario Progetto Canoa Carcinoma Mammario Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale Simona Duranti Ospedale Sacro Cuore Don Calabria Negrar Verona 22-23 marzo


Metodi in vivo e in vitro per : il riconoscimento dei farmaci lo studio delle loro proprietà farmacologiche lo studio del loro meccanismo d azione

Metodi in vivo e in vitro per : il riconoscimento dei farmaci lo studio delle loro proprietà farmacologiche lo studio del loro meccanismo d azione Metodi in vivo e in vitro per : il riconoscimento dei farmaci lo studio delle loro proprietà farmacologiche lo studio del loro meccanismo d azione Metodi generali Metodi mirati Scoperta e sviluppo di nuovi


Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3

Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3 Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3 Grazia Cantelmi, AIF SUN Napoli Prof.ssa L.Perrone, Dipartimento della donna, del bambino, di chirurgia generale e specialistica


Genetica, malattie rare e contesto familiare

Genetica, malattie rare e contesto familiare XXV Anniversario IRCCS E. Medea La salute del bambino tra genetica e neuroscienze Bosisio Parini, 11 dicembre 2010 Genetica, malattie rare e contesto familiare La genetica negli ultimi 25 anni Sequenziamento



BOLLETTINO UFFICIALE DELLA REGIONE CAMPANIA - N. 8 DEL 29 GENNAIO 2007 REGIONE CAMPANIA - Giunta Regionale - Seduta del 29 dicembre 2006 - Deliberazione N. 2196 - Area Generale di Coordinamento N. 20 - Assistenza Sanitaria - APPROVAZIONE DEL PRO- GETTO DEL DIPARTIMENTO DI





Contributo. Tavoli tematici. 1. Dati proponente contributo VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020

Contributo. Tavoli tematici. 1. Dati proponente contributo VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020 VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020 Tavoli tematici Contributo 1 1. Dati proponente contributo Alfredo Ferro Ente/organizzazione di appartenenza Università di Catania Telefono 3666627657


Domande relative alla specializzazione in: Oncologia medica

Domande relative alla specializzazione in: Oncologia medica Domande relative alla specializzazione in: Oncologia medica Domanda #1 (codice domanda: n.541) : Cosa caratterizza il grado T2 del colangiocarcinoma? A: Interessamento del connettivo periduttale B: Coinvolgimento


Neoplasie della mammella - 2

Neoplasie della mammella - 2 Neoplasie della mammella - 2 Fattori prognostici Numero di N+ : >3 Età e stato menopausale Diametro di T Invasione linfatica e vascolare Tipo istologico Grading Recettore per Estrogeni/Progesterone Amplificazione
