ANALISI DELLE ALTERAZIONI DI EGFR, HER2 E PIK3CA NEL CARCINOMA MAMMARIO MASCHILE

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "ANALISI DELLE ALTERAZIONI DI EGFR, HER2 E PIK3CA NEL CARCINOMA MAMMARIO MASCHILE"

Transcript

1 Modena novembre 2010 ANALISI DELLE ALTERAZIONI DI EGFR, HER2 E PIK3CA NEL CARCINOMA MAMMARIO MASCHILE Piera Rizzolo

2 IL CARCINOMA MAMMARIO MASCHILE (CMM)» Il CMM è una neoplasia rara:» circa 0.6% di tutti i carcinomi mammari» meno 1% di tutti i tumori maschili (Italia 0.2%)»Biologicamente il CMM è simile al carcinoma mammario femminile» il CMM è più frequentemente di tipo duttale infiltrante» ER+/PR+ e HER2-. (Ottini et al Crit Rev Oncol Hematol. 2010)

3 EGFR, HER2 E PIK3CA ECD TD LR CR LR CR Ligand Ligand Ligand X X PTK ICD Tyrosine phosphorilation sites HER1 HER2 HER3 HER4 PIK3CA

4 EGFR, HER2 E PIK3CA NEL CARCINOMA MAMMARIO (CM) MUTAZIONI SOMATICHE 1.7% EGFR 4.3% HER2 8-40% PIK3CA 8-20% EGFR AMPLIFICAZIONE DEL GENE 25-30% HER2 6% PIK3CA OVER-ESPRESSIONE DELLA PROTEINA 30-48% EGFR 30% HER2 (Bae et al 2007, Toyama et al, 2008, Lee et al 2006, Campbell et al, 2004; Levine et al, 2005; Li et al, 2006; Dunlap et al, 2009).

5 RUOLO DI EGFR, HER2 E PIK3CA NEL CM Alto grado tumorale EGFR (Over-espressione) Mutazioni BRCA1, tipo basal cell-like Alto grado tumorale, MIB1+, aneuploidia HER2 (Over-espressione) ER-/PR- ER-/PR- Mutazioni del gene p53 ER+/PR+ PIK3CA (Mutazioni somatiche) N1, T>2 cm (Uberall et al, 2008, Bianchi et al, 2006 Hayes & Thor, 2002; Masood & Bui, 2002, Bachman et al, 2004; Saal et al, 2005; Maruyama et al, 2007)

6 OBIETTIVI Analizzare la presenza e il ruolo di alterazioni in linea somatica (mutazioni, amplificazione ed espressione) di EGFR, HER2 e PIK3CA Identificare sottogruppi di CMM con specifiche caratteristiche patologiche e biologiche, mediante valutazione di possibili associazioni tra Espressione ER, PR, HER2, MIB1 ALTERAZIONI DI PIK3CA, EGFR E HER2 vs GRADO TUMORALE (G) Mutazioni BRCA1/BRCA2

7 CASISTICA ESAMINATA 102 campioni tumorali di pazienti affetti da CMM: Per ciascun caso è stato ottenuto consenso informato allo studio; sezioni consecutive da blocchetti di preparati istologici di tumori primari inclusi in paraffina o congelati; due o più campioni di sangue fresco; informazioni dettagliate relative alla storia personale e familiare di cancro; referti patologici.

8 ANALISI DI ALTERAZIONI SOMATICHE DI PIK3CA Analisi mutazionale PIK3CA G1633A (E545K):in 3 casi (3%) 1659delT(S553X): in 1 caso (1%) G1658C(S553T):in 1 caso (1%) T C A C T A A G C G A T G G A G T C A C A G G A C C A C A G G A T * PIK3CA 1633G>A (E545K) (freccia) Mutazione PIK3CA 1659delT (freccia) e variante missenso 1658G>C (S553T) (asterisco).

9 ANALISI DELLA VARIANTE 1658G>C (S553T) Sequenziamento diretto degli alleli (A) e (B) isolati mediante clonaggio per la mutazione 1659delT e per la variante 1658G>C (A) Analisi in silico SIFT POLYPHEN Pmut A-GVGD S 553T Tolerated Benign Neutral Class 55 Tutti e quattro i programmi hanno evidenziato un ruolo neutro per questa variante delt G (B) Analisi comparativa tra omologhi di PIK3CA mediante EXPRESSO(3DCoffee) Regular Human SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Mouse SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Rat SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Chicken SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVK Bovine SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Chimpanzee SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Hamster SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVK Entrambe le alterazioni sono presenti sullo stesso allele (B) Il codone S553 è conservato in tutte le specie considerate (uomo, ratto, topo, toro, scimpanzé e criceto) come del resto tutta la sequenza amminoacidica della proteina PIK3CA.

10 RQ ANALISI DI ALTERAZIONI SOMATICHE DI PIK3CA Amplificazione genica Casi CMM Il gene PIK3CA risulta amplificato in 6/74 (8.1%) campioni tumorali di CMM

11 ANALISI DI ALTERAZIONI SOMATICHE DI EGFR Analisi mutazionale Legame EGF Legame EGF TM interazione di HER2 esone 2-4 esone 5-6 esone 7-12 esone Dominio tirosin-chinasico PIK3C2B c-cbl G2547A(Q787Q): in 15 casi C2934T(N916N): in 1 caso aa745 ATP G2547A(Q787Q) C2934T (N916N) 2547G A G Variante EGFR 2547 G A (Q787Q) riscontrata in 15 casi

12 RQ ANALISI DI ALTERAZIONI SOMATICHE DI EGFR Amplificazione genica Casi CMM Il gene EGFR risulta amplificato in 5/70 (7.1%) campioni tumorali di CMM

13 Immunoistochimica di HER2 71,7% 27,5% Analisi immunoistochimica di HER2 (Paget) Analisi IHC condotta su 91casi di CMM:» 27.5% (25/91) esprimono HER2» 71.7% (66/91) non esprimono HER2 HER2: non sono state riscontrate mutazioni patogenetiche

14 ALTERAZIONI DI PIK3CA, EGFR E HER2 vs ER, PR, HER2, MIB1, G E MUTAZIONI BRCA1/2 Associazioni statisticamante significative tra: amplificazione PIK3CA e HER2+ (p=0.04) MIB1+ (p=0.04) amplificazione di EGFR e ER- (p=0.04) HER2+ (p=0.018) MIB1+ (p=0.05) over-espressione di HER2 e PR- (p=0.03) MIB1+ (p=0.048) G3 (p=0.001) mutazioni di BRCA2 (p=0.01) Tutti i tumori mutati per PIK3CA sono risultati ER/PR+

15 CONCLUSIONI (1) I risultati ottenuti dall analisi dell associazione tra alterazioni di PIK3CA, EGFR e HER2 e caratteristiche immunofenotipiche suggeriscono che: PIK3CA potrebbe avere un ruolo nella progressione tumorale del CMM Alterazioni di EGFR e HER2 potrebbero essere associate ad un fenotipo aggressivo nel CMM

16 CONCLUSIONI (2)»I risultati ottenuti in questo studio indicano che PIK3CA, EGFR e HER2 giocano un ruolo nel CMM a livelli paragonabili a quelli osservati nel CM femminile e che la presenza di alterazioni di PIK3CA, EGFR e HER2 permette di identificare un sottogruppo di casi di CMM con specifiche caratteristiche patologiche e biologiche suscettibili di terapie mirate

17 Ringraziamenti Dipartimento di Patologia Umana e Oncologia, Azienda Ospedaliero-Universitaria Careggi, Dipartimento di Medicina Molecolare Sapienza Università di Roma Firenze. Dott.ssa Simonetta Bianchi Prof.ssa Laura Ottini Dott.ssa Valentina Silvestri Dott. Mario Falchetti Dott.ssa Veronica Graziano Dott.ssa Anna Sara Navazio Unità di Epidemiologia Molecolare e Nutrizionale, ISPO, Firenze Dott. Domenico Palli Dott.ssa Ines Zanna

I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese

I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese Daniela Furlan U.O. Anatomia Patologica, Ospedale di Circolo e Fondazione Macchi, Varese Il

Dettagli

GRUPPO DI STUDIO TUMORI CUTANEI LINEE GUIDA PER ANALISI GENETICO MOLECOLARI IN PAZIENTI AFFETTI DA MELANOMA METASTICO

GRUPPO DI STUDIO TUMORI CUTANEI LINEE GUIDA PER ANALISI GENETICO MOLECOLARI IN PAZIENTI AFFETTI DA MELANOMA METASTICO GRUPPO DI STUDIO TUMORI CUTANEI LINEE GUIDA PER ANALISI GENETICO MOLECOLARI IN PAZIENTI AFFETTI DA MELANOMA METASTICO Documento redatto da: Dott.ssa T.Venesio, Dr.ssa A. Balsamo - Laboratorio di Patologia

Dettagli

Espressione di geni specifici per un determinato tumore

Espressione di geni specifici per un determinato tumore Espressione di geni specifici per un determinato tumore Paziente A: Non ha il cancro Espressione dei geni: Nessuna Biopsia Geni associati al cancro allo stomaco Paziente B: Ha un tumore allo stomaco Bassa

Dettagli

Il test genetico BRCA1/BRCA2

Il test genetico BRCA1/BRCA2 L identificazione Il test genetico BRCA1/BRCA2 M.G.Tibiletti UO Anatomia Patologica Ospedale di Circolo-Università dell Insubria Varese IL CARCINOMA MAMMARIO FORME SPORADICHE FORME EREDITARIE FORME FAMIGLIARI

Dettagli

Ruolo della biologia molecolare nel carcinoma ovarico

Ruolo della biologia molecolare nel carcinoma ovarico Carcinoma ovarico avanzato: quali novità per il 2015? Ruolo della biologia molecolare nel carcinoma ovarico Anna Pesci Ospedale SC Don Calabria, Negrar anna.pesci@sacrocuore.it TIPO I TIPO II Basso stadio

Dettagli

Her-2 nel carcinoma mammario

Her-2 nel carcinoma mammario Her-2 nel carcinoma mammario Piera Balzarini U.O. Anatomia Patologica Università degli Studi di Brescia Spedali Civili di Brescia Il gene ERBB2 dà origine ad un recettore tirosin-chinasico appartenente

Dettagli

COMPARAZIONE DELLA METODICA AUTOMATICA SISH

COMPARAZIONE DELLA METODICA AUTOMATICA SISH COMPARAZIONE DELLA METODICA AUTOMATICA SISH (Silver Enhanced In Situ Hybridization) CON LA METODICA MANUALE FISH (Fluorescence In Situ Hybridization) PER LA VALUTAZIONE DELLO STATO DEL GENE HER2 (neu)

Dettagli

Gallarate 11 giugno 2011 ASSOCIAZIONE ITALIANA TECNICI di ISTOLOGIA e CITOLOGIA

Gallarate 11 giugno 2011 ASSOCIAZIONE ITALIANA TECNICI di ISTOLOGIA e CITOLOGIA SEZIONE LOMBARDA Aggiornamenti 2011 Corso di aggiornamento per Tecnici di Laboratorio Gallarate 11 giugno 2011 ASSOCIAZIONE ITALIANA TECNICI di ISTOLOGIA e CITOLOGIA Azienda Ospedaliera S. Antonio Abate

Dettagli

Cancro della mammella nelle teen-agers

Cancro della mammella nelle teen-agers Cancro della mammella nelle teen-agers Società Triveneta di Chirurgia Padova 12 dicembre 2014 Dott.ssa E. Goldin Dott. A. Marchet Dott. A. Varotto Prof. D. Nitti U.O. Clinica Chirurgica I Padova CASO CLINICO

Dettagli

Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi

Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi IV Congresso Regionale I Congresso del Middle Management di Area Tecnica Federazione Italiana Tecnici di Laboratorio Biomedico Stato mutazionale del gene K-RAS: K comparazione di metodi di analisi Dott.ssa

Dettagli

APPROFONDIMENTO PROGETTO DI RICERCA IRST IRCCS cod. L3P923

APPROFONDIMENTO PROGETTO DI RICERCA IRST IRCCS cod. L3P923 APPROFONDIMENTO PROGETTO DI RICERCA IRST IRCCS cod. L3P923 Titolo del progetto Studio dell'interazione tra le cellule del midollo osseo e le cellule tumorali del cancro alla mammella in piattaforme tridimensionali

Dettagli

EREDITARIETÀ E TUMORE MAMMARIO. U.O. Genetica Medica

EREDITARIETÀ E TUMORE MAMMARIO. U.O. Genetica Medica EREDITARIETÀ E TUMORE MAMMARIO Dott.ssa M.Neri U.O. Genetica Medica Responsabile Consulenza Oncogenetica Prof.ssa A. Ferlini Direttore U.O. Genetica Medica I TUMORI AL SENO EREDITARI : L IMPORTANZA DELLA

Dettagli

Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families

Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families Modena 18-19 novembre 2010 Two possible BRCA1 founder mutations in Sicilian breast and/or ovarian cancer families Dr. Laura La Paglia FOUNDER MUTATIONS in BRCA1/2 NELLA POPOLAZIONE EUROPEA e NON POPOLAZIONE

Dettagli

LA FISSAZIONE E LA PROCESSAZIONE DEI CAMPIONI ISTOLOGICI CON SOSTANZE A BASE ALCOLICA: POSSIBILI VANTAGGI E PROSPETTIVE FUTURE.

LA FISSAZIONE E LA PROCESSAZIONE DEI CAMPIONI ISTOLOGICI CON SOSTANZE A BASE ALCOLICA: POSSIBILI VANTAGGI E PROSPETTIVE FUTURE. LA FISSAZIONE E LA PROCESSAZIONE DEI CAMPIONI ISTOLOGICI CON SOSTANZE A BASE ALCOLICA: POSSIBILI VANTAGGI E PROSPETTIVE FUTURE. Dott.ssa Marchi Barbara Biologa sanitaria COMBINAZIONE TRA LA BIOLOGIA MOLECOLARE

Dettagli

L informazione ottenuta dal test genetico può apportare notevoli benefici, quali:

L informazione ottenuta dal test genetico può apportare notevoli benefici, quali: INFORMATIVA E CONSENSO INFORMATO ALL ESAME BREASTSCREEN Il test BreastScreen BreastScreen è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi genetica multipla per valutare

Dettagli

La mutazione c.34g>t del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH

La mutazione c.34g>t del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH Tumori Ereditari : dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 La mutazione c.34 del gene KRAS come marcatore precoce delle poliposi associate al gene MUTYH Tiziana Venesio, Antonella

Dettagli

Unità Operativa Complessa ANATOMIA PATOLOGICA

Unità Operativa Complessa ANATOMIA PATOLOGICA Unità Operativa Complessa ANATOMIA PATOLOGICA sanitaria Descrizione L obiettivo fondamentale è fornire diagnosi corrette, complete, tempestive e clinicamente rilevanti. Gli esami istologici e citologici

Dettagli

GENETICA DEL TUMORE DEL COLON-RETTO

GENETICA DEL TUMORE DEL COLON-RETTO GENETICA DEL TUMORE DEL COLON-RETTO EPIDEMIOLOGIA In tutto l'occidente, il cancro del colon-retto occupa, per incidenza, il secondo posto tra i tumori maligni, preceduto dal tumore al polmone nell'uomo

Dettagli

Caso clinico. Laura Cimetti

Caso clinico. Laura Cimetti Gazzada Schianno 16 Ottobre 2014 Caso clinico Laura Cimetti Dipartimento di Scienze Chirurgiche e Morfologiche Servizio di Anatomia e Istologia Patologica Università degli Studi dell Insubria e Ospedale

Dettagli

Unità Operativa Complessa ANATOMIA PATOLOGICA

Unità Operativa Complessa ANATOMIA PATOLOGICA Unità Operativa Complessa ANATOMIA PATOLOGICA sanitaria Descrizione L obiettivo fondamentale è fornire diagnosi corrette, complete, tempestive e clinicamente rilevanti. Gli esami istologici e citologici

Dettagli

CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010

CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 CONGRESSO NAZIONALE TUMORI EREDITARI: dalla biologia molecolare al trattamento Modena, 18-19 Novembre 2010 TEST FUNZIONALE EX VIVO DI SPLICING PER LA DIAGNOSTICA MOLECOLARE DEL CARCINOMA DEL SENO E DELL

Dettagli

INFORMATIVA E CONSENSO INFORMATO ALL ESAME ONCOSCREENING

INFORMATIVA E CONSENSO INFORMATO ALL ESAME ONCOSCREENING INFORMATIVA E CONSENSO INFORMATO ALL ESAME ONCOSCREENING Il test OncoScreening OncoScreening è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi multipla per valutare

Dettagli

Tecniche di patologia molecolare finalizzate all'analisi di mutazioni

Tecniche di patologia molecolare finalizzate all'analisi di mutazioni Tecniche di patologia molecolare finalizzate all'analisi di mutazioni dei geni predittivi di risposta alla terapia oncologica Carmelo Lupo Casa di Cura La Maddalena Palermo Test molecolari PREDITTIVI di

Dettagli

Cetuximab e mutazione K-Ras nel tumore del colon-retto

Cetuximab e mutazione K-Ras nel tumore del colon-retto Università di Pisa Dipartimento di Farmacia Corso di laurea in CTF Corso: Basi biochimiche dell azione dei farmaci Cetuximab e mutazione K-Ras nel tumore del colon-retto Pisa, 27/03/2014 Samuela Fabiani

Dettagli

PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013. Torino 7 novembre 2013. Anatomia Patologica. Isabella Castellano

PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013. Torino 7 novembre 2013. Anatomia Patologica. Isabella Castellano PROGRAMMA REGIONALE DI SCREENING MAMMOGRAFICO PREVENZIONE SERENA Workshop 2013 Torino 7 novembre 2013 Anatomia Patologica Isabella Castellano Dipartimento di Scienze Mediche Università di Torino Anatomia

Dettagli

Lo sviluppo del cancro è un processo complesso che coinvolge parecchi cambiamenti nella stessa cellula staminale. Poiché tutte le cellule staminali

Lo sviluppo del cancro è un processo complesso che coinvolge parecchi cambiamenti nella stessa cellula staminale. Poiché tutte le cellule staminali Tumore Cos è il tumore? Il tumore o neoplasia (dal greco neo,, nuovo, e plasìa,, formazione), o cancro se è maligno, è una classe di malattie caratterizzate da una incontrollata riproduzione di alcune

Dettagli

Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica

Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica 17 corso nazionale per Tecnici di Laboratorio Biomedico Fattori predittivi nel carcinoma della mammella: le tecniche di Anatomia Patologica incontrano la clinica Dott.ssa Maura Pandolfi Istituto di Anatomia

Dettagli

LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI

LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI Il Consiglio Direttivo Nazionale LILT, nella seduta del 19 marzo 2015, ha formalmente approvato la documentazione relativa ai lavori della Commissione tecnico-scientifica

Dettagli

Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze

Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Dott. Elena Niccolai, PhD Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Premio Gianfranco Del Prete per le malattie orfane, Firenze 8 novembre 2014 ADENOCARCINOMA PANCREATICO

Dettagli

A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo

A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo 2 Convegno Nazionale Sindrome di Rubinstein Taybi Lodi, 17 19 maggio 2013 A cosa serve al clinico e alla famiglia conoscere il difetto di base? Correlazione genotipo fenotipo Donatella Milani Cristina

Dettagli

SEBASTIANO FILETTI. Dipartimento di Medicina Interna e Specialità Mediche. Università di Roma Sapienza, Roma

SEBASTIANO FILETTI. Dipartimento di Medicina Interna e Specialità Mediche. Università di Roma Sapienza, Roma SEBASTIANO FILETTI Dipartimento di Medicina Interna e Specialità Mediche Università di Roma Sapienza, Roma La malattia tiroidea è in aumento negli ultimi anni. Quali le ragioni? Dati epidemiologici provenienti

Dettagli

SCHEDA INFORMATIVA. Laureato in Scienze Biologiche esperto nel campo dell'oncologia mammaria (2 unità)

SCHEDA INFORMATIVA. Laureato in Scienze Biologiche esperto nel campo dell'oncologia mammaria (2 unità) Servizio del Personale Progetto Caratterizzazione molecolare del carcinoma mammario triplonegativo (Triple Negative Breast Cancer) e screening di nuovi potenziali agenti terapeutici attivi sul sistema

Dettagli

XIII RIUNIONE ANNUALE ASSOCIAZIONE ITALIANA REGISTRI TUMORI - AIRTUM Siracusa, 6/8 Maggio 2009. R. Sunseri 2,N. Romano 2.

XIII RIUNIONE ANNUALE ASSOCIAZIONE ITALIANA REGISTRI TUMORI - AIRTUM Siracusa, 6/8 Maggio 2009. R. Sunseri 2,N. Romano 2. XIII RIUNIONE ANNUALE ASSOCIAZIONE ITALIANA REGISTRI TUMORI - AIRTUM Siracusa, 6/8 Maggio 2009 Sottotipi di carcinoma della mammella identificati con markers immunoistochimici: dati del Registro Tumori

Dettagli

Requisiti minimi e standard di refertazione per carcinoma della mammella

Requisiti minimi e standard di refertazione per carcinoma della mammella SIAPEC PIEMONTE Concordanza e uniformità di refertazione diagnostica nelle anatomie patologiche della Regione Piemonte Requisiti minimi e standard di refertazione per carcinoma della mammella Statement

Dettagli

INFORMATIVA E CONSENSO INFORMATO ALL ESAME COLONSCREEN

INFORMATIVA E CONSENSO INFORMATO ALL ESAME COLONSCREEN INFORMATIVA E CONSENSO INFORMATO ALL ESAME COLONSCREEN Il test ColonScreen ColonScreen è un test diagnostico, sviluppato da GENOMA Group, che permette di eseguire un analisi genetica multipla per valutare

Dettagli

Verso la terapia personalizzata

Verso la terapia personalizzata Verso la terapia personalizzata M.G.Tibiletti Genetista Ospedale di Circolo-Università dell Insubria Varese Soroptimist Club Varese Varese 20 aprile 2013 Test genetici DIAGNOSTICI PRESINTOMATICI PREDITTIVI,

Dettagli

Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione

Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione Il tumore al colon è temuto ma è necessario continuare nell'attività di Prevenzione Milano - Nonostante la sua aggressività è definito il tumore silenzioso. Data la sua scarsa pubblicizzazione, infatti,

Dettagli

Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica

Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica Come approcciare le predisposizioni ereditarie in oncologia: la consulenza oncogenetica Daniela Turchetti Cattedra e Unità Operativa di Genetica Medica Università di Bologna/Policlinico S.Orsola-Malpighi

Dettagli

Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto. Carmelo Lupo

Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto. Carmelo Lupo Aggiornamenti su RAS: mutazioni di KRAS ed NRAS nel carcinoma del colon retto Carmelo Lupo RAS-RAF signaling Activation of the RAS-RAF signaling cascade occurs via the following sequential steps 1 : Activation

Dettagli

Oggetto: presentazione progetto di ricerca anno 2010

Oggetto: presentazione progetto di ricerca anno 2010 Associazione Un Vero Sorriso Onlus via Morghen, 5 10143 Torino Torino, 01/10/2010 Oggetto: presentazione progetto di ricerca anno 2010 Titolo: Nuovi approcci per l identificazione di mutazioni rare in

Dettagli

la storia di HER2 Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche HER2: Human Epidermal Receptor

la storia di HER2 Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche HER2: Human Epidermal Receptor Citogenetica e biologia molecolare dei tumori mammari: implicazioni cliniche la storia di HER2 V. Martin 28 giugno 2011 HER2: Human Epidermal Receptor HER2 e carcinoma mammario alias c-erb, ERBB2, HER-

Dettagli

CENTRO REGIONALE DI GENETICA ONCOLOGICA CARTA DEI SERVIZI

CENTRO REGIONALE DI GENETICA ONCOLOGICA CARTA DEI SERVIZI Regione Marche Università Politecnica delle Marche Azienda O.U. Ospedali Riuniti Ancona CENTRO REGIONALE DI GENETICA ONCOLOGICA CARTA DEI SERVIZI - Personale - Presentazione - Prestazioni - Accesso al

Dettagli

Fattori predittivi di risposta al trattamento con chemioterapici e/o farmaci biologici nei tumori polmonari

Fattori predittivi di risposta al trattamento con chemioterapici e/o farmaci biologici nei tumori polmonari UNIVERSITA DEGLI STUDI DI PARMA Dottorato di ricerca in Fisiopatologia Sistemica Ciclo XXIII Fattori predittivi di risposta al trattamento con chemioterapici e/o farmaci biologici nei tumori polmonari

Dettagli

ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO

ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO ONCOLOGIA MEDICA 1 A.O.U. San Giovanni Battista,TORINO Il rapporto tra ormoni e carcinomi della mammella ormonodipendenti venne dimostrato per la prima volta nel 1896 da Beatson. L ovariectomia determinava

Dettagli

XIII Meeting AIRTum, Siracusa 6-8 maggio 2009

XIII Meeting AIRTum, Siracusa 6-8 maggio 2009 CARATTERIZZAZIONE CLINICA, MORFOLOGICA E BIOLOGICA DI DUE GRUPPI ESTREMI DI PAZIENTI CON CARCINOMA COLORETTALE SELEZIONATI ATTRAVERSO UN REGISTRO TUMORI SPECIALIZZATO Annalisa Pezzi, Piero Benatti, Luca

Dettagli

Carta dei Servizi rev. 1 aprile 2007. Unità Operativa di Anatomia Patologica Ospedale di Bussolengo

Carta dei Servizi rev. 1 aprile 2007. Unità Operativa di Anatomia Patologica Ospedale di Bussolengo Carta dei Servizi rev. 1 aprile 2007 Unità Operativa di Ospedale di Bussolengo Azienda ULSS n. 22 Bussolengo (VR) Dipartimento di Diagnosi e Cura Unità Operativa di Ospedale di Bussolengo Monoblocco -

Dettagli

Carcinoma mammario nelle giovani donne

Carcinoma mammario nelle giovani donne Carcinoma mammario nelle giovani donne RELATORI E MODERATORI Eraldo O. Bucci Responsabile - UO Oncologia Medica MultiMedica Castellanza Azzurra Cangiano Psicooncologia UO Oncologia Medica MultiMedica Castellanza

Dettagli

PRODA Istituto di Diagnostica Clinica

PRODA Istituto di Diagnostica Clinica Test genetici per evidenziare il rischio di trombolfilia Il Fattore V della coagulazione è un cofattore essenziale per l attivazione della protrombina a trombina. La variante G1691A, definita variante

Dettagli

Patologia e aspetti biologici nel carcinoma mammario metastatico

Patologia e aspetti biologici nel carcinoma mammario metastatico Patologia e aspetti biologici nel carcinoma mammario metastatico Cristina Riva Laura Cimetti Dipartimento di Morfologia Umana Università dell Insubria Varese Il 20-30% delle pazienti affette da carcinoma

Dettagli

Meccanismi di controllo della proliferazione cellulare

Meccanismi di controllo della proliferazione cellulare Meccanismi di controllo della proliferazione cellulare Il ciclo cellulare è regolato dall azione di PROTOONCOGENI e (attivatori della proliferazione cellulare) GENI ONCOSOPPRESSORI (inibitori del ciclo

Dettagli

Strumenti di valutazione del rischio familiare Daniela Turchetti

Strumenti di valutazione del rischio familiare Daniela Turchetti Strumenti di valutazione del rischio familiare Daniela Turchetti Misura ciò che è misurabile e rendi misurabile ciò che non lo è Galileo Galilei (1564-1642) Casi multipli di cancro nella famiglia Cancro

Dettagli

8. Valutazione degli screening di prevenzione delle patologie tumorali nell ASL di Mantova

8. Valutazione degli screening di prevenzione delle patologie tumorali nell ASL di Mantova 8. Valutazione degli screening di prevenzione delle patologie tumorali nell ASL di Mantova I programmi di screening per la prevenzione dei tumori della mammella, del colon retto e della cervice uterina

Dettagli

ARCOmenti di oncologia:

ARCOmenti di oncologia: ARCOmenti di oncologia: Il TUMORE DELLA PROSTATA Dott. Donatella Parentini - Giancarlo Mancabelli SNAMID CREMONA 26 febbraio 2011 Sala Maffei Camera di Commercio di Cremona DEVO FARE UN TEST PSA DOTTORE?

Dettagli

Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci

Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci Dott. Alessandro Fabbri U.O. Pneumologia ASL 3 PT Direttore ff Dott. Franco Vannucci Negli ultimi anni c è stato un notevole cambiamento nella gestione diagnosticoterapeutica dei soggetti affetti da neoplasia

Dettagli

CARCINOMA DELLA MAMMELLA

CARCINOMA DELLA MAMMELLA CARCINOMA DELLA MAMMELLA TRATTAMENTO LOCO REGIONALE e ADIUVANTE NEOPLASIE INTRAEPITELIALI DELLA MAMMELLA Neoplasia Lobulare Intraepiteliale (LIN 2-3) Nessun trattamento (dopo la diagnosi) Resezione mammaria

Dettagli

Le terapie neoadiuvanti

Le terapie neoadiuvanti Le terapie neoadiuvanti Giancarlo Bisagni Dipartimento di Oncologia TERAPIA NEOADIUVANTE definizione SINONIMI: TERAPIA PRIMARIA TERAPIA PREOPERATORIA DEFINIZIONE: trattamento medico somministrato prima

Dettagli

La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013

La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013 La sindrome di Lynch Cancro colonrettale ereditario non poliposico o HNPCC G. A. Pablo Cirrone 1 Caratteristiche generali I HNPCC (Hereditary Non-Polyposis Colonrectal Cancer) è caratterizzato dalla comparsa,

Dettagli

Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale. Simona Duranti durantisimona@virgilio.it. Progetto Canoa Carcinoma Mammario

Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale. Simona Duranti durantisimona@virgilio.it. Progetto Canoa Carcinoma Mammario Progetto Canoa Carcinoma Mammario Gruppo C METASTASI CEREBRALI Rischio in base al sottotipo tumorale Simona Duranti durantisimona@virgilio.it Ospedale Sacro Cuore Don Calabria Negrar Verona 22-23 marzo

Dettagli

La terapia del carcinoma mammario metastatico: ruolo delle antracicline

La terapia del carcinoma mammario metastatico: ruolo delle antracicline La terapia del carcinoma mammario metastatico: ruolo delle antracicline Hotel AC, 8 ottobre 2014 Razionale Il carcinoma della mammella rappresenta uno dei settori dell oncologia nel quale maggiori sono

Dettagli

DIFFERENZA DI GENERE E MEDICINA

DIFFERENZA DI GENERE E MEDICINA DIFFERENZA DI GENERE E MEDICINA L ONU, l Europa e l OMS raccomandano che il determinante genere sia tenuto presente nella programmazione delle politiche sanitarie. L ONU ha inserito la medicina di genere

Dettagli

20 febbraio 2012. Muore Renato Dulbecco

20 febbraio 2012. Muore Renato Dulbecco 20 febbraio 2012 Muore Renato Dulbecco la possibilità di avere una visione completa e globale del nostro DNA ci aiuterà a comprendere le influenze genetiche e non genetiche sul nostro sviluppo, la nostra

Dettagli

Domande relative alla specializzazione in: Oncologia medica

Domande relative alla specializzazione in: Oncologia medica Domande relative alla specializzazione in: Oncologia medica Domanda #1 (codice domanda: n.541) : Cosa caratterizza il grado T2 del colangiocarcinoma? A: Interessamento del connettivo periduttale B: Coinvolgimento

Dettagli

IL RUOLO DELLE SOCIETA SCIENTIFICHE SIAPeC IAP

IL RUOLO DELLE SOCIETA SCIENTIFICHE SIAPeC IAP Roma 25-26 ottobre 2011 Camera dei Deputati Palazzo Marini Sala della Mercede IL RUOLO DELLE SOCIETA SCIENTIFICHE SIAPeC IAP (Società di Anatomia Patologica e Citopatologia diagnostica Divisione Italiana

Dettagli

La mutazione è una modificazione della sequenza delle basi del DNA

La mutazione è una modificazione della sequenza delle basi del DNA La mutazione è una modificazione della sequenza delle basi del DNA Le mutazioni sono eventi rari e importanti in quanto sono alla base dell evoluzione biologica Le mutazioni possono essere spontanee (dovute

Dettagli

CONTROLLO DI QUALITA IN FISH: PROGETTO INTERREGIONALE DELLA REGIONE PIEMONTE

CONTROLLO DI QUALITA IN FISH: PROGETTO INTERREGIONALE DELLA REGIONE PIEMONTE Trento 19 novembre 2010 CONTROLLO DI QUALITA IN FISH: PROGETTO INTERREGIONALE DELLA REGIONE PIEMONTE Dott.ssa Ludovica Verdun di Cantogno, Stefano Vigna, Prof.ssa Anna Sapino Azienda Ospedaliero-Universitaria

Dettagli

Contributo. Tavoli tematici. 1. Dati proponente contributo VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020

Contributo. Tavoli tematici. 1. Dati proponente contributo VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020 VERSO LA STRATEGIA REGIONALE DELL INNOVAZIONE 2014-2020 Tavoli tematici Contributo 1 1. Dati proponente contributo Alfredo Ferro Ente/organizzazione di appartenenza Università di Catania Telefono 3666627657

Dettagli

Screening dei soggetti a rischio e diagnostica molecolare

Screening dei soggetti a rischio e diagnostica molecolare Screening dei soggetti a rischio e diagnostica molecolare Daniela Furlan U.O. Anatomia Patologica Varese, 3 luglio 2012 Il carcinoma pancreatico Patogenesi Suscettibilità genetica Implicazioni diagnostiche

Dettagli

Tumore della mammella rischio eredo-familiare

Tumore della mammella rischio eredo-familiare Università di Torino Dipartimento di Genetica Biologia e Biochimica barbara pasini Tumore della mammella rischio eredo-familiare problematiche linee guida ipotesi di progetto regionale Tumore della mammella

Dettagli

Salute e Genere Ipotesi di lavoro nelle Marche

Salute e Genere Ipotesi di lavoro nelle Marche Salute e Genere Ipotesi di lavoro nelle Marche Ancona, 14 aprile 2012 L esperienza della Medicina di Genere nell Azienda Ospedali Riuniti di Ancona. Dall organizzazione alla clinica Perdita di salute nella

Dettagli

ONCOLOGIA Dott.ssa Samantha Messina Genetica delle neoplasie

ONCOLOGIA Dott.ssa Samantha Messina Genetica delle neoplasie ONCOLOGIA Dott.ssa Samantha Messina Genetica delle neoplasie Anno accademico 2012/2013 I anno, II trimestre Laurea Magistrale LM-67 Scienze Motorie Università degli Studi di Cassino e del Lazio Meridionale

Dettagli

Immunoterapia - molecole differenzianti antiproliferative

Immunoterapia - molecole differenzianti antiproliferative Con il Patrocinio dell Ordine Dei Medici Chirurghi di Bologna Congresso: EVIDENZE SCIENTIFICHE NON VALORIZZATE IN ONCOTERAPIA : Immunoterapia - molecole differenzianti antiproliferative Bologna, 9 Giugno

Dettagli

Analisi della Malattia Minima Residua

Analisi della Malattia Minima Residua XIX CORSO NAZIONALE PER TECNICI DI LABORATORIO BIOMEDICO Riccione, 22-25 Maggio 2012 Analisi della Malattia Minima Residua Dr.ssa Anna Gazzola Laboratorio di Patologia Molecolare, Sezione di Emolinfopatologia,

Dettagli

ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico. Linea di ricerca. Via Gattamelata, 64 35128 Padova

ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico. Linea di ricerca. Via Gattamelata, 64 35128 Padova ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico Linea di ricerca Via Gattamelata, 64 35128 Padova Linea di ricerca 3 Valutazione del rischio genetico E' noto che la malattia

Dettagli

Aggiornamenti in ambito genetico

Aggiornamenti in ambito genetico 10 Congresso Nazionale sulla Sindrome di Cornelia de Lange 1-4 novembre 2012 - Gabicce Aggiornamenti in ambito genetico Cristina Gervasini Genetica Medica Dip. Scienze della Salute Università degli Studi

Dettagli

Progetto Tesi di Master Dr. Zamir KADIJA

Progetto Tesi di Master Dr. Zamir KADIJA Progetto Tesi di Master Dr. Zamir KADIJA Profilo mutazionale di oncogeni candidati nel carcinoma broncogeno non-a-piccole cellule condotto su campioni ottenuti mediante biopsia endobronchiale ed agoaspirato

Dettagli

Il Cancro è una malattia genetica

Il Cancro è una malattia genetica Il Cancro è una malattia genetica PROCESSO MULTIFASICO Il Cancro è sempre genetico Talvolta il cancro è ereditario Ciò che viene ereditato non è la malattia, bensì la PREDISPOSIZIONE In assenza di ulteriori

Dettagli

Biobanca Genetica per Malattie Rare Scheletriche

Biobanca Genetica per Malattie Rare Scheletriche Biobanca Genetica per Malattie Rare Scheletriche Luca Sangiorgi S.S.D. di Genetica Medica e Malattie Rare Ortopediche, Istituto Ortopedico Rizzoli Bologna SSD di Genetica Medica IOR Roma, 25 settembre

Dettagli

CAPITOLO 2 I TRATTI COMPLESSI

CAPITOLO 2 I TRATTI COMPLESSI CAPITOLO 2 I TRATTI COMPLESSI Tratti semplici e tratti complessi Come detto nel capitolo precedente, la genetica classica studia fondamentalmente i cosiddetti tratti mendeliani semplici, quelli in cui,

Dettagli

Dal paziente al gene malattia : il clonaggio posizionale del gene Met

Dal paziente al gene malattia : il clonaggio posizionale del gene Met Dal paziente al gene malattia : il clonaggio posizionale del gene Met Una storia di interazione fra Medicina e Ricerca a cura di Debora Angeloni, Ph.D., Settore di Medicina Scuola Estiva di Orientamento

Dettagli

IL DIRETTORE GENERALE

IL DIRETTORE GENERALE Prot. n. 1991 del 17 gennaio 2013 Pubblicato il: 18 gennaio 2013 Scadenza: 25 gennaio 2013 AVVISO DI PROCEDURA PER IL CONFERIMENTO DI UN INCARICO PER COLLABORAZIONE COORDINATA E CONTINUATIVA PRESSO IL

Dettagli

TERAPIE TARGET IN ONCOLOGIA Bioetica e sostenibilità delle cure

TERAPIE TARGET IN ONCOLOGIA Bioetica e sostenibilità delle cure TERAPIE TARGET IN ONCOLOGIA Bioetica e sostenibilità delle cure Dr. Roberto Benelli TERAPIE TARGET IN ONCOLOGIA Bioetica e sostenibilità delle cure Dr.ssa Maria Nincheri Kunz Terapie a bersaglio molecolare

Dettagli

Neoplasie della mammella - 2

Neoplasie della mammella - 2 Neoplasie della mammella - 2 Fattori prognostici Numero di N+ : >3 Età e stato menopausale Diametro di T Invasione linfatica e vascolare Tipo istologico Grading Recettore per Estrogeni/Progesterone Amplificazione

Dettagli

Ufficio Stampa mercoledì 17 dicembre 2014. Il ringraziamento della Direzione Aziendale per questa importante donazione

Ufficio Stampa mercoledì 17 dicembre 2014. Il ringraziamento della Direzione Aziendale per questa importante donazione PRATO La generosità della Fondazione Sandro Pitigliani per la lotta contro i tumori Il ringraziamento della Direzione Aziendale per questa importante donazione Strumenti ed attrezzature per migliorare

Dettagli

Fisiologia dell emostasi

Fisiologia dell emostasi 1 STRATEGIE DIAGNOSTICHE PER L EMOFILIA A DEL CANE Marco Caldin DVM, PhD, ECVCP Diplomate 2 Fisiologia dell emostasi 1 3 Fisiologia dell emostasi 4 Attivazione emostatica 2 5 Emostasi primaria 6 Emostasi

Dettagli

REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014

REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014 REPORT FINALE DEL PROGETTO III Controllo di qualità nazionale per la valutazione delle mutazioni di RAS nel carcinoma del colon-retto -2014 Il Comitato Scientifico AIOM e SIAPEC-IAP ha organizzato per

Dettagli

Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE

Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE Bari, 27 Febbraio 2010 Nicoletta Resta Dipartimento di Biomedicina dell Età Evolutiva UOC Lab. Genetica Medica INDAGINI GENETICHE: QUANDO E PERCHE EREDITA MENDELIANA CLASSICA ~ 600 E C M 10.000 Enzimi

Dettagli

Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon

Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Carmelo Lupo Coordinatore Tecnico U.O. Anatomia Patologica e Patologia Molecolare

Dettagli

Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3

Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3 Un caso di pubertà precoce familiare causato da una nuova mutazione nel gene MKRN3 Grazia Cantelmi, AIF SUN Napoli Prof.ssa L.Perrone, Dipartimento della donna, del bambino, di chirurgia generale e specialistica

Dettagli

PRODA Istituto di Diagnostica Clinica

PRODA Istituto di Diagnostica Clinica Caratterizzazione molecolare delle Distrofie Muscolari di Duchenne (DMD) e di Becker (BMD): diagnosi di malattia e studi familari L Proda esegue le indagini molecolari per le Distrofie muscolari di Duchenne

Dettagli

Il Counselling. Padova, 21 marzo 2016. Dr.ssa Stefania ZOVATO Istituto Oncologico Veneto (IOV) IRCCS Padova SSD Unità per i Tumori Ereditari

Il Counselling. Padova, 21 marzo 2016. Dr.ssa Stefania ZOVATO Istituto Oncologico Veneto (IOV) IRCCS Padova SSD Unità per i Tumori Ereditari Il Counselling Padova, 21 marzo 2016 Dr.ssa Stefania ZOVATO Istituto Oncologico Veneto (IOV) IRCCS Padova SSD Unità per i Tumori Ereditari Punti chiave del counselling Significato Scopo e limiti A chi

Dettagli

La Biopsia Prostatica: where are we going?

La Biopsia Prostatica: where are we going? La Biopsia Prostatica: where are we going? Sabato 28 Novembre 2015, Catania Dott. Michele Salemi Screening genetico correlato a rischio di carcinoma prostatico. BRCA1, BRCA2, TP53, CHEK2, HOXB13 e NBN:

Dettagli

Biologia molecolare nella diagnosi citologica

Biologia molecolare nella diagnosi citologica Carcinoma differenziato della tiroide: dalla diagnosi al follow up 21 Marzo 2009 Biologia molecolare nella diagnosi citologica Giovanni Tallini Universita di Bologna Anatomia Patologica Osp. Bellaria Patogenesi

Dettagli

CURRICULUM VITAE ET STUDIORUM

CURRICULUM VITAE ET STUDIORUM Angela Pitisci Via II Trav C.so Piemonte 25 86078 Sesto Campano (IS) DATI ANAGRAFICI CURRICULUM VITAE ET STUDIORUM NOME : Angela COGNOME :Pitisci NATA IL :12/08/1982 A Sesto Campano RESIDENZA: Sesto Campano

Dettagli

ESPERIENZA REGIONE PIEMONTE ( formazione)

ESPERIENZA REGIONE PIEMONTE ( formazione) Convegno Nazionale GISMa 2009 Workshop multidisciplinare dell equipe diagnosticoterapeutica Monitoraggio degli indicatori di qualità ESPERIENZA REGIONE PIEMONTE ( formazione) Rita Bordon CPO Piemonte Francesca

Dettagli

Le zone grigie della citologia tiroidea.

Le zone grigie della citologia tiroidea. Carcinoma differenziato della tiroide: dalla diagnosi al follow-up Bologna 21 marzo 2009 Le zone grigie della citologia tiroidea. Cosa deve dire il patologo Gian Piero Casadei Anatomia Patologica Ospedale

Dettagli

Quotidiano. www.ecostampa.it

Quotidiano. www.ecostampa.it Quotidiano 097156 www.ecostampa.it Quotidiano 097156 www.ecostampa.it Lettori: 2.835.000 Diffusione: 431.913 12-NOV-2013 Dir. Resp.: Ezio Mauro da pag. 1 Lettori: 2.835.000 Diffusione: 431.913 12-NOV-2013

Dettagli

I tumori ereditari e familiari di mammella e ovaio

I tumori ereditari e familiari di mammella e ovaio I. I tumori ereditari e familiari di mammella e ovaio La maggior parte dei tumori che colpiscono mammella e ovaio sono sporadici, cioè le alterazioni del patrimonio genetico insorgono durante l arco della

Dettagli

FONTANAROSA VITO MARIA CV EUROPEO

FONTANAROSA VITO MARIA CV EUROPEO Nome FONTANAROSA VITO MARIA Data di nascita 07/02/1960 ESPERIENZA LAVORATIVA INTERNA Nome e indirizzo del datore di lavoro Date (da - a) 01/01/2012 - in corso Tipo di azienda o settore PUBBLICO AZIENDA

Dettagli

MALATTIE UMANE LEGATE ALL UPP: IL MORBO DI PARKINSON

MALATTIE UMANE LEGATE ALL UPP: IL MORBO DI PARKINSON MALATTIE UMANE LEGATE ALL UPP: IL MORBO DI PARKINSON La degradazione proteica è uno dei meccanismi essenziali che regolano i livelli di proteine cellulari, coinvolto in processi cellulari cruciali dal

Dettagli

Carcinoma mammario HER2-positivo in stadio iniziale e avanzato. HER2: la crescita del tumore

Carcinoma mammario HER2-positivo in stadio iniziale e avanzato. HER2: la crescita del tumore IL TUMORE AL SENO Il tumore della mammella è caratterizzato dalla crescita non controllata di cellule che subiscono modificazioni rispetto alle cellule che originano nelle ghiandole dove avviene la produzione

Dettagli