Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW"

Transcript

1 Lezione 2: Allineamento di sequenze BLAST e CLUSTALW

2 Allineamento di sequenze

3 Allineamenti L avvento della genomica moderna permette di analizzare le similitudini e le differenze tra organismi a livello del loro DNA e del loro corredo proteico completo ( informazioni evolutive, sequenze funzionali conservate, omologia tra geni ). Parallelamente, una attività comune in biologia è, data una sequenza di acidi nucleici o proteine di interesse sperimentale, di trovare sequenze simili all interno di gruppi di altre sequenze note. Molte di queste attività si possono ricondurre al problema di trovare o meno similarità tra sequenze di DNA o di amminoacidi. Ovvero, in generale, data una sequenza A (di DNA o amminoacidi) detta query e una sequenza B detta target, di allineare le due sequenze ovvero appaiare le loro singole componenti in modo da evidenziarne le zone somiglianti e quelle differenti.

4 Allineamenti Data una sequenza (DNA/proteina), ci sono oggetti simili in un certo database oppure ci sono somiglianze con altre sequenze che mi interessano? Ho trovato un nuovo gene o proteina? Un certo gene ha somiglianze con qualche altro gene nella stessa specie o in altre specie? Come posso trovare le regione di sovrapposizione tra sequenze? Come posso studiare l evoluzione di genomi di popolazioni o specie? Come posso trovare informazioni sul tipo di fold, sulla famiglia, sulla funzione di una certa proteina? allineamento di sequenze

5 Allineamenti Un tipico risultato di una procedura di allineamento è il seguente: Conservation in GABPA promoter region reveals functional Err-α motif. Asterisks denote conserved bases. The yellow box marks the experimentally validated Err- α binding site. Xie et al., Nature 2005

6 Allineamenti L operazione di allineamento però non è banale da realizzare. Allineare trovare le corrispondenze, posizione per posizione, tra due o più sequenze. A priori, ci sono molti modi di allineare due sequenze. Supponiamo di voler allineare le due sequenze di DNA ACGTCTAG ed ACTCTAG: DOMANDA: Quale è l allineamento (statisticamente) migliore?

7 Allineamenti Oppure supponiamo di voler allineare la sequenza TCTAG con una sequenza di DNA molto lunga: se partiamo da una sequenza abbastanza piccola e la vogliamo allineare con una sequenza abbastanza lunga, potremmo sempre ottenere un accordo perfetto tra elementi appaiati delle due stringhe se permettiamo un numero arbitrario di gaps. DOMANDA: Ma quale di questi allineamenti è quello (statisticamente) più significativo?

8 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di proteomica del corso). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

9 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di Zamma). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

10 Toy example Vogliamo allineare la sequenza WHAT con la sequenza WHY. Vogliamo in oltre determinare l allineamento più significativo. Per fare questo, costruiamo delle regole per costruire ogni possibile allineamento e per assegnare un punteggio (score) ad ognuno di essi. regola (algoritmo) per costruire tutti i possibili allineamenti regola (algoritmo) per assegnare uno score S ad ogni allineamento prendere l allineamento con score massimo Regole ad es: Allineamento ad es:

11 Toy example Più in generale: costruzione della matrice di allineamento della sequenza WHAT con la sequenza WHY: La matrice descrive tutti i possibili allineamenti della sequenza target con la sequenza query. Un particolare allineamento è un percorso nella matrice.

12 Toy example Ogni passo da un elemento della matrice ad una altro corrisponde ad uno spostamento su un nuovo elemento di una od entrambe le sequenze. Ad ogni passo, possiamo scrivere nell elemento di matrice lo score fino a quel punto. Il migliore allineamento è il percorso che genera lo score più alto, arrivando in basso a destra nella matrice, ovvero avendo usato tutte le lettere a disposizione di query e di target (allineamento globale).

13 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

14 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

15 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

16 Allineamento globale: formalismi In generale un allineamento globale si può scrivere come: - date due sequenze A e B di simboli, non necessariamente della stessa lunghezza ma scritte nello stesso alfabeto Scrivere una successione del tipo: le sequenze sono allineate secondo la loro lunghezza. Si inseriscono gaps se hanno lunghezze diverse. Needleman e Wunsch (1970)

17 Allineamento globale: formalismi In particolare: se le lettere ai e bj allineate sono uguale si ha una identity, altrimenti si ha un mismach. Se devo allungare l allineamento ho un indel. Lo score per aver allineato le prime i lettere di A con le prime j lettere di B è: Calcolato in maniera ricorsiva a partire da:

18 Allineamento locale Proteine con la stessa funzione possono presentare degli allineamenti di sequenza reciproci poco significativi, a causa di piccole zone di similarità racchiuse dentro zone di apparente forte diversità e/o lunghezze molto diverse. In questo casi è preferibile cercare degli allineamenti locali, cioe corti allineamenti contenuti all interno delle sequenze più lunghe (Smith e Waterman, 1981). La tecnica per calcolare allineamenti locali è sempre basata sulla costruzione di una matrice di allineamento, e cercando poi il percorso con lo score più alto. Solo che nel caso dell allineamento locale: il percorso migliore attraverserà solo parte della matrice non c è richiesta di allineare le stringhe agli estremi.

19 Allineamento locale: esempio Trovare il migliore allineamento locale e il massimo score di allineamento date le due sequenze A =ACCTAAGG e B = GGCTCAATCA.

20 Numero dei possibili allineamenti globali Date due sequenze di lunghezza m ed n per calcolarne il migliore allineamento globale, abbiamo calcolato 3 score per andare in (n-1)(m-1) celle e poi prenderne il massimo quindi circa 4mn operazioni un singolo allineamento globale è una operazione di classe O(mn). Ma quanti sono i possibili allineamenti globali? Se supponiamo per semplicità che m ~ n è possibile dimostrare che: Questo numero è gigantesco!!!!

21 Numero dei possibili allineamenti globali Supponiamo ad esempio di avere: Supponiamo ad esempio di avere: Il Sole pesa circa 1.99 x 1033 grammi. Ogni grammo contiene circa 12 x tra protoni, elettroni e neutroni, per cui il Sole contiene circa 24 x particelle elementari. ci vorrebbero 400 stelle come il Sole per contenere tante particelle elementari quanti sono gli allineamenti di due sequenze di 100 caratteri.

22 Regole di scoring (DNA) Lo scoring delle singole mosse in un allineamento deve essere fissato all inizio una volta per tutte in una scoring matrix una scelta precisa di un modello evolutivo per il nostro allineamento. Nei casi precedenti, le regole di scoring usate si possono riassumere in:

23 Regole di scoring (DNA) Sono però possibili scelte diverse. Studi di mutazioni su geni omologhi hanno indicato che le transizioni (A G, G A, C T, or T C) capitano in media con una frequenza doppia delle transversioni (A T, T A, A C, G T, etc). Quindi un modello di allineamento più sensato potrebbe utilizzare degli scores diversi per transizioni o per transversioni (e.s. sequenze simili hanno la tendenza ad avere transizioni, per cui il loro peso statistico dovrebbe essere inferiore). Una scoring matrix più realistica allora potrebbe essere:

24 Regole di scoring (DNA) Analogamente sorge il problema di come esattamente valutare lo scoring dei gaps (successioni di indels). Fino ad adesso abbiamo usato la regola semplice: come score per un gap di lunghezza k. Tuttavia è noto, per esempio che i gaps appaiono più facilmente in successione che isolati (cfr. biochimica). Inoltre, come altro esempio, delezioni di uno o due nucleotidi in regioni protein-coding in genere sono estremamente dannosi, mentre delezioni o inserzioni di gruppi di 3 nucleotidi lo sono di meno (frameshift). Un approccio potrebbe essere allora usare una regola del tipo: che ha l effetto di avere una alta penalità per aprire un primo gap α e una penalità inferiore per allargare un gap (-β per ogni base in più nel gap, con α < β).

25 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

26 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

27 Regole di scoring (proteine) Le scoring matrix degli amminoacidi sono più complesse di quelle per i nucleotidi. Sono delle tabelle che danno per ciascuna coppia di aa, un valore che indica il loro grado di similarità (informazione sulla probabilità che un aa si sostitutisca ad un altro durante l evoluzione). Si ottengono con metodi statistici assegnando a ciascuna coppia un valore che riflette la frequenza con cui l uno si sostituisce all altro in famiglie di proteine omologhe. Di solito si utilizzano due tipi di matrici: 1) Matrici PAM 2) Matrici BLOSUM

28 Regole di scoring (proteine) Matrici PAM (Point Accepted Mutation) (M. Dayhoff 1978) Due sequenze sono definite ad 1PAM di distanza se per convertire l una nell altra, c è stata in media 1 mutazione accettata ogni 100 aa. Accettata = non ha cambiato la funzione della proteina o comunque non è stata letale per l organismo Per ottenere i valori da inserire nella matrice si utilizzano inizialmente sequenze molto simili: Poi da questi valori si estrapolano le frequenze attese per seq. più divergenti. Utilizzando tante coppie di sequenze ad 1 PAM di distanza, ci aspettiamo solo l 1% di differenze: a questo punto ricaviamo le frequenze di sostituzione attese di ciascuna coppia di aa. Abbiamo così costruito la matrice PAM1.

29 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

30 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

31 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

32 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Blosum6 Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze2 che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

33 Regole di scoring (proteine) L utilizzo della matrice di similarita appropriata per ciascuna analisi e importante per avere buoni risultati negli allineamenti. poco divergenti molto divergenti BLOSUM80 BLOSUM62 BLOSUM45 PAM1 PAM120 PAM250

34 Allineamenti multipli Una estensione immediata dell allineamento a coppie è quello di estendere la procedura a N > 2 sequenze. GTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC GTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC RIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl RIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl RIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTNN

35 Allineamenti multipli Un allineamento multiplo si costruisce usando in maniera ricorsiva algoritmi simili a quelli usati per gli allineamenti a coppie ancora più calcoli dell allineamento pairwise!!! Si ottengono prima tutti i possibili allineamenti di coppia e si registra il punteggio di ciascuno. Si selezionano le sequenze più simili tra loro formando quindi clusters di sequenze allineate (costituiti da 2 o più sequenze il cui allineamento sia stato precedentemente fissato) Poi si continua aggiungendo le altre sequenze al cluster precedentemente ottenuto e così via fino ad includere tutte le sequenze considerate.

36 BLAST e CLUSTALW

37 Software per allineamenti In pratica, nel momento in cui ho bisogno di eseguire un allineamento di sequenze, ricerco un opportuno software che risolva il mio problema. seq1 seq2 seq DB tool allineamento similarità di sequenza tool lista di proteine simili alla query

38 Software per allineamenti Nella maggioranza dei casi però non avrò a che fare con software che eseguono gli algoritmi di allineamento esatto visti in precedenza, ma con versione euristiche degli stessi maggiore velocità. Es: una tipica ricerca di similarità sul database delle sequenze dell NCBI, richiede l analisi di un numero di sequenze > e che cresce in continuazione in maniera esponenziale.

39 Software per allineamenti Sono state sviluppate moltissime tecniche per incrementare la velocità degli algoritmi di allineamento. Es. di un possibile trucco : scomposizione di query e target in k-mers Supponiamo di aver una stringa di query I Questa può essere separata in una serie di (overlapping) 8-mers: Idea: se ho una sequenza target l assenza di uno qualunque degli 8-mers implica che I # J prima di allineare due sequenze posso esplorare il loro contenuto di k-mers (seeds) e decidere velocemente se le sequenze possono (potenzialmente) essere molto simili. Se sì le allineo, altrimenti continuo.

40 Software per allineamenti Noi faremo esperienza con 2 software per allineamento: BLAST e CLUSTALW

41 BLAST BLAST (Basic Local Alignment and Search Tool) è una suite di programmi sviluppata presso NCBI (Altschul et al., 1990) per l allineamento veloce di una sequenza query con database anche di grandi dimensioni e di identificare target con una precisa significanza statistica. BLAST usa un approccio euristico che approssima l algoritmo di SmithWaterman, dando dei risultati meno accurati ma in media almeno 50 volte più veloci non c'è la sicurezzza di ottenere il migliore allineamento.

42 BLAST The BLAST algorithm is a heuristic search method that seeks words of length W (default = 3 in blastp) that score at least T when aligned with the query and scored with a substitution matrix. Words in the database that score T or greater are extended in both directions in an attempt to fina a locally optimal ungapped alignment or HSP (high scoring pair) with a score of at least S or an E value lower than the specified threshold. HSPs that meet these criteria will be reported by BLAST, provided they do not exceed the cutoff value specified for number of descriptions and/or alignments to report.

43 NCBI BLAST

44 NCBI BLAST

45 NCBI BLAST

46 CLUSTALW

47 CLUSTALW

48 CLUSTALW

49 CLUSTALW

Informatica e biotecnologie II parte

Informatica e biotecnologie II parte Informatica e biotecnologie II parte Analisi di sequenze: allineamenti CGCTTCGGACGAAATCGCATCAGCATACGATCGCATGCCGGGCGGGATAAC CGAAATCGCATCAGCATACGATCGCATGC Bioinformatica La Bioinformatica è una disciplina

Dettagli

Bioinformatica e Biologia Computazionale per la Medicina Molecolare

Bioinformatica e Biologia Computazionale per la Medicina Molecolare Facoltà di Ingegneria dell Informazione Laurea Specialistica e Magistrale in Ingegneria Informatica Facoltà di Ingegneria dei Sistemi Laurea Magistrale in Ingegneria Biomedica Dipartimento di Elettronica

Dettagli

Riconoscimento e recupero dell informazione per bioinformatica

Riconoscimento e recupero dell informazione per bioinformatica Riconoscimento e recupero dell informazione per bioinformatica Clustering: similarità Manuele Bicego Corso di Laurea in Bioinformatica Dipartimento di Informatica - Università di Verona Definizioni preliminari

Dettagli

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST ESERCITAZIONE 3 OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST L'esercitazione prevede l'utilizzo di risorse web per effettuare ricerche di similarità con la proteina GRB2 (growth factor

Dettagli

4. Ricerca di sequenze in banche dati e allineamento multiplo

4. Ricerca di sequenze in banche dati e allineamento multiplo 4. Ricerca di sequenze in banche dati e allineamento multiplo Collegatevi al sito www.ncbi.nlm.nih.gov/blast. Apparirà una pagina nella quale le versioni di BLAST disponibili sono organizzate in base al

Dettagli

Una proteina nella rete: Introduzione alla bioinformatica

Una proteina nella rete: Introduzione alla bioinformatica Una proteina nella rete: Introduzione alla bioinformatica L era genomica ha assistito ad una crescita esponenziale delle informazioni biologiche rese disponibili dai progressi nel campo della biologia

Dettagli

Applicazioni biotecnologiche in systems biology

Applicazioni biotecnologiche in systems biology Applicazioni biotecnologiche in systems biology Lezione #6 Dr. Marco Galardini AA 2012/2013 Gene regulation analysis Lezione #6 Dr. Marco Galardini AA 2012/2013 Regolazione genica Elementi molecolari e

Dettagli

Z-score. lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random

Z-score. lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random Z-score lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random è una misura di quanto il valore di opt si discosta dalla deviazione standard media. indica di quante dev.

Dettagli

Tesi di Laurea di Mauro Baluda matr. 038208

Tesi di Laurea di Mauro Baluda matr. 038208 Università degli Studi di Milano Bicocca Facoltà di Scienze Matematiche Fisiche e Naturali Corso di Laurea in Informatica Algoritmi per l'allineamento di Sequenze Tesi di Laurea di matr. 038208 Relatore:

Dettagli

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà Bioinformatica (1) Introduzione Dott. Alessandro Laganà Dott. Alessandro Laganà Martedi 15.30 16.30 Studio Assegnisti - 1 Piano (Davanti biblioteca) Dipartimento di Matematica e Informatica (Città Universitaria)

Dettagli

DNA sequence alignment

DNA sequence alignment DNA sequence alignment - Introduzione: un possibile modello per rappresentare il DNA. Il DNA (Acido desossiribonucleico) è una sostanza presente nei nuclei cellulari, sia vegetali che animali; a questo

Dettagli

Determinare la sequenza del DNA

Determinare la sequenza del DNA Corso di Laurea in Chimica e Tecnologie Farmaceu9che a.a. 2014-2015 Università di Catania Determinare la sequenza del DNA Sequenziamento Sanger, NGS e Bioinforma9ca Stefano Forte Sequenziare significa

Dettagli

Sequence Alignment Algorithms

Sequence Alignment Algorithms Sequence Alignment Algorithms Algoritmi per l Allineamento di Sequenze Relatore: Prof. Giancarlo Mauri Correlatore: Prof. Gianluca Della Vedova Tesi di Laurea di: Mauro Baluda Matricola 038208 Part of

Dettagli

Sorgenti autorevoli in ambienti hyperlinkati.

Sorgenti autorevoli in ambienti hyperlinkati. Sorgenti autorevoli in ambienti hyperlinkati. La qualità di un metodo di ricerca richiede la valutazione umana dovuta alla soggettività inerente alla nozione di rilevanza. I motori di ricerca correnti,

Dettagli

Componenti di un sistema KNOWLEDGE-BASED

Componenti di un sistema KNOWLEDGE-BASED Componenti di un sistema KNOWLEDGE-BASED DYNAMIC DATABASE PROBLEM FORMALIZATION CONTROL STRATEGY IL DATABASE DESCRIVE LA SITUAZIONE CORRENTE NELLA DETERMINAZIONE DELLA SOLUZIONE AL PROBLEMA. LA FORMALIZZAZIONE

Dettagli

Entropia. Motivazione. ? Quant è l informazione portata dalla sequenza? Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,...

Entropia. Motivazione. ? Quant è l informazione portata dalla sequenza? Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,... Entropia Motivazione Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,... ) s,s 2,s 3,... ognuno dei quali appartiene ad un alfabeto A di M elementi.? Quant è l informazione portata

Dettagli

Lezione 7. Allineamento di sequenze biologiche

Lezione 7. Allineamento di sequenze biologiche Lezione 7 Allineamento di sequenze biologiche Allineamento di sequenze Determinare la similarità e dedurre l omologia Allineare Definire il numero di passi necessari per trasformare una sequenza nell altra

Dettagli

3. Confronto tra due sequenze

3. Confronto tra due sequenze 3. Confronto tra due sequenze Esercizio 1: uso di DotLet Il programma DotLet è accessibile dal sito http://myhits.isb-sib.ch/cgi-bin/dotlet, dove può essere utilizzato attraverso un interfaccia utente

Dettagli

Banche Dati Secondarie. geni trascritti proteine profili strutture

Banche Dati Secondarie. geni trascritti proteine profili strutture Banche Dati Secondarie geni trascritti proteine profili strutture definizione Banca dati il cui contenuto deriva da una banca dati primaria DB sec DB primario informazione PROSITE SWISS Prot patterns Profiles

Dettagli

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata Metodi per la Ricostruzione Filogenetica Ricostruire una filogenesi significa trovare la migliore stima delle relazioni evolutive storiche fra entità tassonomiche usando i dati disponibili. I dati di base

Dettagli

ANALISI DEI DATI PER IL MARKETING 2014

ANALISI DEI DATI PER IL MARKETING 2014 ANALISI DEI DATI PER IL MARKETING 2014 Marco Riani mriani@unipr.it http://www.riani.it LA CLASSIFICAZIONE CAP IX, pp.367-457 Problema generale della scienza (Linneo, ) Analisi discriminante Cluster Analysis

Dettagli

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione ATTENZIONE: lo sfondo giallo NON riguarda parti più importanti ma evidenzia solo parti di testo (frasi, paragrafi) aggiornate (correzioni, miglioramento dello stile, o aggiunta di note o esempi per chiarire

Dettagli

I Modelli della Ricerca Operativa

I Modelli della Ricerca Operativa Capitolo 1 I Modelli della Ricerca Operativa 1.1 L approccio modellistico Il termine modello è di solito usato per indicare una costruzione artificiale realizzata per evidenziare proprietà specifiche di

Dettagli

Varianti Macchine di Turing

Varianti Macchine di Turing Varianti Macchine di Turing Esistono definizioni alternative di macchina di Turing. Chiamate Varianti. Tra queste vedremo: MdT a più nastri e MdT non deterministiche. Mostriamo: tutte le varianti ragionevoli

Dettagli

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Dipartimento di Ingegneria della Informazione Via Diotisalvi, 2 56122 PISA ALGORITMI GENETICI (GA) Sono usati per risolvere problemi di ricerca

Dettagli

Linkage. Lezione 4 (riprendere il testo di Genetica ) By NA

Linkage. Lezione 4 (riprendere il testo di Genetica ) By NA Linkage Lezione (riprendere il testo di Genetica ) Tipi di mappe: mappe genetiche Mappe genetiche : si basano sulla frequenza di ricombinazione fra locus identificati attraverso marcatori di varia natura:

Dettagli

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale.

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale. Homology modelling L omology modeling delle proteine è il tipo di predizione di struttura terziaria più semplice ed affidabile. Viene richiesta soltanto una (o più) sequenze di riferimento su cui modellare

Dettagli

CURRICOLO MATEMATICA ABILITA COMPETENZE

CURRICOLO MATEMATICA ABILITA COMPETENZE CURRICOLO MATEMATICA 1) Operare con i numeri nel calcolo aritmetico e algebrico, scritto e mentale, anche con riferimento a contesti reali. Per riconoscere e risolvere problemi di vario genere, individuando

Dettagli

Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT

Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT Giuditta Franco Corso di Laurea in Bioinformatica - AA 2012/2013 Uno dei più grossi risultati nell informatica degli

Dettagli

Sommario della lezione

Sommario della lezione Università degli Studi di Salerno Corso di Algoritmi Prof. Ugo Vaccaro Anno Acc. 2014/15 p. 1/33 Sommario della lezione Ancora sui cammini minimi: Cammini minimi in grafi con archi di costo negativo Algoritmi

Dettagli

Allineamento locale: BLAST

Allineamento locale: BLAST Allineamento locale: BLAST BLAST (Basic Local Alignment Search Tool) è il più diffuso programma di allineamento locale delle sequenze. Per vari anni il metodo FASTA (da non confondere con l omonimo formato)

Dettagli

Le query. Lezione 6 a cura di Maria Novella Mosciatti

Le query. Lezione 6 a cura di Maria Novella Mosciatti Lezione 6 a cura di Maria Novella Mosciatti Le query Le query sono oggetti del DB che consentono di visualizzare, modificare e analizzare i dati in modi diversi. Si possono utilizzare query come origine

Dettagli

per immagini guida avanzata Uso delle tabelle e dei grafici Pivot Geometra Luigi Amato Guida Avanzata per immagini excel 2000 1

per immagini guida avanzata Uso delle tabelle e dei grafici Pivot Geometra Luigi Amato Guida Avanzata per immagini excel 2000 1 Uso delle tabelle e dei grafici Pivot Geometra Luigi Amato Guida Avanzata per immagini excel 2000 1 Una tabella Pivot usa dati a due dimensioni per creare una tabella a tre dimensioni, cioè una tabella

Dettagli

Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ;

Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ; Primo anno Secondo anno Terzo anno Primo anno MATEMATICA Scuola dell Infanzia Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ; legge

Dettagli

Parte 2. Determinante e matrice inversa

Parte 2. Determinante e matrice inversa Parte. Determinante e matrice inversa A. Savo Appunti del Corso di Geometria 013-14 Indice delle sezioni 1 Determinante di una matrice, 1 Teorema di Cramer (caso particolare), 3 3 Determinante di una matrice

Dettagli

Sommario. 1 Realizzazione del STG. Introduzione. 1 traduzione delle specifiche informali in specifiche formali (STG o

Sommario. 1 Realizzazione del STG. Introduzione. 1 traduzione delle specifiche informali in specifiche formali (STG o Sommario Sintesi di macchine a stati finiti 1 Realizzazione del ST M. avalli 2 utoma minimo di SM completamente specificate 6th June 2007 3 Ottimizzazione di SM non completamente specificate Sommario ()

Dettagli

Elementi di Informatica e Programmazione

Elementi di Informatica e Programmazione Elementi di Informatica e Programmazione Il concetto di Algoritmo e di Calcolatore Corsi di Laurea in: Ingegneria Civile Ingegneria per l Ambiente e il Territorio Università degli Studi di Brescia Cos

Dettagli

ISTITUTO COMPRENSIVO MONTEGROTTO TERME SCUOLA PRIMARIA DISCIPLINA: MATEMATICA - CLASSE PRIMA OBIETTIVI DI APPRENDIMENTO

ISTITUTO COMPRENSIVO MONTEGROTTO TERME SCUOLA PRIMARIA DISCIPLINA: MATEMATICA - CLASSE PRIMA OBIETTIVI DI APPRENDIMENTO PRIMA DELLA DISCIPLINA: MATEMATICA - CLASSE PRIMA L alunno si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali. Legge e comprende testi che coinvolgono aspetti logici e matematici.

Dettagli

MATEMATICA SCUOLE DELL INFANZIA

MATEMATICA SCUOLE DELL INFANZIA MATEMATICA SCUOLE DELL INFANZIA CAMPO DI ESPERIENZA: LA CONOSCENZA DEL MONDO (ordine, misura, spazio, tempo, natura) È l'ambito relativo all'esplorazione, scoperta e prima sistematizzazione delle conoscenze

Dettagli

Codici Numerici. Modifica dell'informazione. Rappresentazione dei numeri.

Codici Numerici. Modifica dell'informazione. Rappresentazione dei numeri. Codici Numerici. Modifica dell'informazione. Rappresentazione dei numeri. A partire da questa lezione, ci occuperemo di come si riescono a codificare con sequenze binarie, quindi con sequenze di 0 e 1,

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori Informazione e computer Si può rappresentare l informazione attraverso varie forme: Numeri Testi Suoni Immagini 0001010010100101010 Computer Cerchiamo di capire come tutte queste informazioni possano essere

Dettagli

Laboratorio Matematico Informatico 2

Laboratorio Matematico Informatico 2 Laboratorio Matematico Informatico 2 (Matematica specialistica) A.A. 2006/07 Pierluigi Amodio Dipartimento di Matematica Università di Bari Laboratorio Matematico Informatico 2 p. 1/1 Informazioni Orario

Dettagli

CURRICOLO MATEMATICA - CLASSE QUINTA -

CURRICOLO MATEMATICA - CLASSE QUINTA - CURRICOLO MATEMATICA - CLASSE QUINTA - COMPETENZA NUCLEO FONDANTE OBIETTIVI DI APPRENDIMENTO CONTENUTI TRAGUARDI NUMERI 1.a) Indicare il valore posizionale delle cifre nei numeri decimali b) comporre e

Dettagli

Statistica e biometria. D. Bertacchi. Variabili aleatorie. V.a. discrete e continue. La densità di una v.a. discreta. Esempi.

Statistica e biometria. D. Bertacchi. Variabili aleatorie. V.a. discrete e continue. La densità di una v.a. discreta. Esempi. Iniziamo con definizione (capiremo fra poco la sua utilità): DEFINIZIONE DI VARIABILE ALEATORIA Una variabile aleatoria (in breve v.a.) X è funzione che ha come dominio Ω e come codominio R. In formule:

Dettagli

EASYVET 1.0 MANUALE UTENTE

EASYVET 1.0 MANUALE UTENTE MANUALE UTENTE MANUALE UTENTE Sommario Introduzione 1 Primi Passi 2 Opzioni di amministrazione 3 Gestione clienti 5 Gestione fatture e spese 7 Il Giornaliero 8 Le fatture 12 Le Statistiche 14 Bilancio

Dettagli

Omologia di sequenze: allineamento e ricerca

Omologia di sequenze: allineamento e ricerca Omologia di sequenze: allineamento e ricerca Genomi (organismi) e geni hanno un evoluzione divergente Sequenze imparentate per evoluzione divergente sono omologhe Le sequenze sono confrontabili tramite

Dettagli

La ricerca di similarità: i metodi

La ricerca di similarità: i metodi La ricerca di similarità: i metodi Pairwise alignment allineamenti a coppie 1. Analisi della matrice a punti (dot matrix) 2. Programmazione dinamica (dynamic programming) allineamenti locale e globale.

Dettagli

CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE

CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE Negli ultimi anni si è compreso che sistemi anche molto diversi tra loro possono essere efficacemente descritti in termini di cosiddetti "networks" o reti complesse.

Dettagli

CURRICOLO MATEMATICA

CURRICOLO MATEMATICA 1 CURRICOLO MATEMATICA Competenza 1 al termine della scuola dell Infanzia 2 NUMERI Raggruppare, ordinare, contare, misurare oggetti, grandezze ed eventi direttamente esperibili. Utilizzare calendari settimanali

Dettagli

Competenza chiave europea: MATEMATICA. Scuola Primaria. DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte

Competenza chiave europea: MATEMATICA. Scuola Primaria. DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte Competenza chiave europea: MATEMATICA Scuola Primaria DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte TAB. A TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE al termine della Scuola Primaria

Dettagli

Lezione 7. Allineamento di sequenze biologiche

Lezione 7. Allineamento di sequenze biologiche Lezione 7 Allineamento di sequenze biologiche Allineamento di sequenze Determinare la similarità e dedurre l omologia Allineare Definire il numero di passi necessari per trasformare una sequenza nell altra

Dettagli

Programmazione dinamica

Programmazione dinamica Capitolo 6 Programmazione dinamica 6.4 Il problema della distanza di edit tra due stringhe x e y chiede di calcolare il minimo numero di operazioni su singoli caratteri (inserimento, cancellazione e sostituzione)

Dettagli

Linguaggi di programmazione

Linguaggi di programmazione Linguaggi di programmazione Programmazione L attività con cui si predispone l elaboratore ad eseguire un particolare insieme di azioni su particolari dati, allo scopo di risolvere un problema Dati Input

Dettagli

Polimorfismi LEZIONE 6. By NA 1

Polimorfismi LEZIONE 6. By NA 1 Polimorfismi LEZIONE 6 By NA 1 * Polimorfismo Variazione presente nella popolazione con una frequenza superiore a 1% Variazioni nell aspetto By NA 2 Polimorfismo proteico Variazione presente nella popolazione

Dettagli

Funzioni non documentate Openoffice.org. 3 Base mini-howto

Funzioni non documentate Openoffice.org. 3 Base mini-howto Funzioni non documentate Openoffice.org. 3 Base mini-howto Augusto Scatolini (webmaster@comunecampagnano.it) Ver. 1.0 gennaio 2009 Come risolvere il problema del contatore che inizia da 0 (zero) Come importare

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile Problemi connessi all utilizzo di un numero di bit limitato Abbiamo visto quali sono i vantaggi dell utilizzo della rappresentazione in complemento alla base: corrispondenza biunivoca fra rappresentazione

Dettagli

MATEMATICA. Classe I Classe II Classe III Classe IV Classe V Traguardo 1

MATEMATICA. Classe I Classe II Classe III Classe IV Classe V Traguardo 1 MATEMATICA COMPETENZE Dimostra conoscenze matematiche che gli consentono di analizzare dati e fatti della realtà e di verificare l'attendibilità delle analisi quantitative e statistiche proposte da altri.

Dettagli

CURRICOLO MATEMATICA CLASSE 1^

CURRICOLO MATEMATICA CLASSE 1^ CURRICOLO CLASSE 1^ COMPETENZE CHIAVE: Competenze di base in matematica Classe 1^ Contare oggetti o eventi, a voce e mentalmente Leggere e scrivere i numeri naturali in notazione decimale avendo consapevolezza

Dettagli

Introduzione. Il principio di localizzazione... 2 Organizzazioni delle memorie cache... 4 Gestione delle scritture in una cache...

Introduzione. Il principio di localizzazione... 2 Organizzazioni delle memorie cache... 4 Gestione delle scritture in una cache... Appunti di Calcolatori Elettronici Concetti generali sulla memoria cache Introduzione... 1 Il principio di localizzazione... 2 Organizzazioni delle memorie cache... 4 Gestione delle scritture in una cache...

Dettagli

Tesi di Laurea Specialistica. Elaborazione di dati bioinformatici attraverso l uso di Particle Swarm Optimization

Tesi di Laurea Specialistica. Elaborazione di dati bioinformatici attraverso l uso di Particle Swarm Optimization Università degli Studi di Genova Facoltà di Scienze Matematiche Fisiche e Naturali Corso di Laurea Specialistica in Informatica Anno Accademico 2009/2010 Tesi di Laurea Specialistica Elaborazione di dati

Dettagli

SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA

SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA ANNO SCOLASTICO 2013/2014 INSEGNANTI Gabellone, Silvagni,Damiano TRAGUARDI DELLE COMPETENZE AL TERMINE della CLASSE QUARTA Sviluppa

Dettagli

Teoria dei Giochi non Cooperativi

Teoria dei Giochi non Cooperativi Politecnico di Milano Descrizione del gioco Egoismo Razionalità 1 L insieme dei giocatori 2 La situazione iniziale 3 Le sue possibili evoluzioni 4 I suoi esiti finali I Giochi della teoria Perché studiare

Dettagli

SCUOLA PRIMARIA: MATEMATICA

SCUOLA PRIMARIA: MATEMATICA SCUOLA PRIMARIA: MATEMATICA Traguardi per lo sviluppo delle competenze al termine della scuola primaria L'alunno si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali e sa valutare

Dettagli

RAPPRESENTAZIONE DEI NUMERI BINARI. Corso di Fondamenti di Informatica AA 2010-2011

RAPPRESENTAZIONE DEI NUMERI BINARI. Corso di Fondamenti di Informatica AA 2010-2011 RAPPRESENTAZIONE DEI NUMERI BINARI Corso di Fondamenti di Informatica AA 2010-2011 Prof. Franco Zambonelli Numeri interi positivi Numeri interi senza segno Caratteristiche generali numeri naturali (1,2,3,...)

Dettagli

Analizza/Confronta medie. ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107. Test t. Test t. t-test test e confronto tra medie chi quadrato

Analizza/Confronta medie. ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107. Test t. Test t. t-test test e confronto tra medie chi quadrato Analizza/Confronta medie ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107 t-test test e confronto tra medie chi quadrato C.d.L. Comunicazione e Psicologia a.a. 2008/09 Medie Calcola medie e altre statistiche

Dettagli

Corso di Laurea Ingegneria Informatica Fondamenti di Informatica

Corso di Laurea Ingegneria Informatica Fondamenti di Informatica Corso di Laurea Ingegneria Informatica Fondamenti di Informatica Dispensa 05 La rappresentazione dell informazione Carla Limongelli Ottobre 2011 http://www.dia.uniroma3.it/~java/fondinf/ La rappresentazione

Dettagli

TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA

TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA SCUOLA PRIMARIA DI CORTE FRANCA MATEMATICA CLASSE QUINTA TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA L ALUNNO SVILUPPA UN ATTEGGIAMENTO POSITIVO RISPETTO ALLA MATEMATICA,

Dettagli

Traccia delle lezioni svolte in laboratorio Excel 2003. Excel 2003 Excel 2010

Traccia delle lezioni svolte in laboratorio Excel 2003. Excel 2003 Excel 2010 Traccia delle lezioni svolte in laboratorio Excel 2003 Excel 2003 Excel 2010 INTRODUZIONE A EXCEL EXCEL è un programma di Microsoft Office che permette di analizzare grandi quantità di dati (database)

Dettagli

SISTEMA INTERNAZIONALE DI UNITÀ

SISTEMA INTERNAZIONALE DI UNITÀ LE MISURE DEFINIZIONI: Grandezza fisica: è una proprietà che può essere misurata (l altezza di una persona, la temperatura in una stanza, la massa di un oggetto ) Misurare: effettuare un confronto tra

Dettagli

LABORATORIO. 2 Lezioni su Basi di Dati Contatti:

LABORATORIO. 2 Lezioni su Basi di Dati Contatti: PRINCIPI DI INFORMATICA CORSO DI LAUREA IN SCIENZE BIOLOGICHE Gennaro Cordasco e Rosario De Chiara {cordasco,dechiara}@dia.unisa.it Dipartimento di Informatica ed Applicazioni R.M. Capocelli Laboratorio

Dettagli

I Sistemi di numerazione e la rappresentazione dei dati

I Sistemi di numerazione e la rappresentazione dei dati I Sistemi di numerazione e la rappresentazione dei dati LA RAPPRESENTAZIONE DELLE INFORMAZIONI (1) Per utilizzare un computer è necessario rappresentare in qualche modo le informazioni da elaborare e il

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Fondamenti di calcolo booleano

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Fondamenti di calcolo booleano Breve introduzione storica Nel 1854, il prof. Boole pubblica un trattato ormai famosissimo: Le leggi del pensiero. Obiettivo finale del trattato è di far nascere la matematica dell intelletto umano, un

Dettagli

Evasione. Evasione. Vendite. Magazzini Immagini

Evasione. Evasione. Vendite. Magazzini Immagini Schema di funzionamento del Carico da Ordini Ordine Archivio di Transito Univoco Evasione Codifica Controllo Articoli Generico Evasione Movimenti Documenti Giacenze Testata Scadenze Vendite Dettaglio Ingrosso

Dettagli

Ricerca Operativa A.A. 2007/2008

Ricerca Operativa A.A. 2007/2008 Ricerca Operativa A.A. 2007/2008 9. Cenni su euristiche e metaeuristiche per ottimizzazione combinatoria Motivazioni L applicazione di metodi esatti non è sempre possibile a causa della complessità del

Dettagli

SCUOLA PRIMARIA Anno Scolastico 2014/2015 CURRICOLO DI MATEMATICA OBIETTIVI DI APPRENDIMENTO AL TERMINE DELLA CLASSE TERZA DELLA SCUOLA PRIMARIA

SCUOLA PRIMARIA Anno Scolastico 2014/2015 CURRICOLO DI MATEMATICA OBIETTIVI DI APPRENDIMENTO AL TERMINE DELLA CLASSE TERZA DELLA SCUOLA PRIMARIA Ministero dell Istruzione, dell Università e della Ricerca Istituto Comprensivo Statale di Calolziocorte Via F. Nullo,6 23801 CALOLZIOCORTE (LC) e.mail: lcic823002@istruzione.it - Tel: 0341/642405/630636

Dettagli

Prof.ssa Paola Vicard

Prof.ssa Paola Vicard Questa nota consiste perlopiù nella traduzione da Descriptive statistics di J. Shalliker e C. Ricketts, 2000, University of Plymouth Consideriamo come esempio il data set contenuto nel foglio excel esercizio2_dati.xls.

Dettagli

4.1 Modelli di calcolo analisi asintotica e ricorrenze

4.1 Modelli di calcolo analisi asintotica e ricorrenze 4 Esercizi Prima Parte 4.1 Modelli di calcolo analisi asintotica e ricorrenze Esercizio 4 1 Rispondere alle seguenti domande: 1. Come misuriamo l efficienza di un algoritmo?. Quali sono gli algoritmi più

Dettagli

INTRODUZIONE. Gli operatori della morfologia binaria sono operatori fra insiemi definiti a partire dell immagine binaria.

INTRODUZIONE. Gli operatori della morfologia binaria sono operatori fra insiemi definiti a partire dell immagine binaria. Capitolo 7 - Operatori Morfologici per Immagini Binarie INTRODUZIONE Gli operatori della morfologia binaria sono operatori fra insiemi definiti a partire dell immagine binaria. L immagine binaria, I, viene

Dettagli

0. Piano cartesiano 1

0. Piano cartesiano 1 0. Piano cartesiano Per piano cartesiano si intende un piano dotato di due assi (che per ragioni pratiche possiamo scegliere ortogonali). Il punto in comune ai due assi è detto origine, e funziona da origine

Dettagli

Foglio di calcolo. Il foglio di calcolo: Excel. Selezione delle celle

Foglio di calcolo. Il foglio di calcolo: Excel. Selezione delle celle Foglio di calcolo Il foglio di calcolo: Excel I dati inseriti in Excel sono organizzati in Cartelle di lavoro a loro volta suddivise in Fogli elettronici. I fogli sono formati da celle disposte per righe

Dettagli

Ministero dell Istruzione, dell Università e della Ricerca

Ministero dell Istruzione, dell Università e della Ricerca Ministero dell Istruzione, dell Università e della Ricerca Ufficio Scolastico Regionale per il Lazio Istiituto Comprensiivo Don Lorenzo Miillanii Scuola dell Infanzia Primaria Secondaria di I grado anche

Dettagli

Plate Locator Riconoscimento Automatico di Targhe

Plate Locator Riconoscimento Automatico di Targhe Progetto per Laboratorio di Informatica 3 - Rimotti Daniele, Santinelli Gabriele Plate Locator Riconoscimento Automatico di Targhe Il programma plate_locator.m prende come input: l immagine della targa

Dettagli

Parte 3. Rango e teorema di Rouché-Capelli

Parte 3. Rango e teorema di Rouché-Capelli Parte 3. Rango e teorema di Rouché-Capelli A. Savo Appunti del Corso di Geometria 203-4 Indice delle sezioni Rango di una matrice, 2 Teorema degli orlati, 3 3 Calcolo con l algoritmo di Gauss, 6 4 Matrici

Dettagli

CURRICOLO DI MATEMATICA

CURRICOLO DI MATEMATICA ISTITUTO COMPRENSIVO PASSIRANO-PADERNO CURRICOLO DI MATEMATICA SCUOLA PRIMARIA Revisione Curricolo di Istituto a.s. 2014-2015 Curricolo suddiviso in obiettivi didattici, nuclei tematici e anni scolastici

Dettagli

Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE. Operare con i numeri

Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE. Operare con i numeri COMPETENZA CHIAVE MATEMATICA Fonte di legittimazione Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE L alunno utilizza il calcolo scritto e mentale con i numeri

Dettagli

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Dipartimento di Ingegneria della Informazione Via Diotisalvi, 2 56122 PISA ALGORITMI GENETICI (GA) Sono usati per risolvere problemi di ricerca

Dettagli

Programmi. Algoritmi scritti in un linguaggio di programmazione

Programmi. Algoritmi scritti in un linguaggio di programmazione Programmi Algoritmi scritti in un linguaggio di programmazione Sistema operativo:programma supervisore che coordina tutte le operazioni del calcolatore Programmi applicativi esistenti Sistemi di videoscrittura

Dettagli

MATEMATICA CLASSE PRIMA

MATEMATICA CLASSE PRIMA CLASSE PRIMA L alunno/a si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali e sa valutare l opportunità di ricorrere a una calcolatrice. Contare oggetti o eventi, a voce e mentalmente,

Dettagli

Scheda n.5: variabili aleatorie e valori medi

Scheda n.5: variabili aleatorie e valori medi Scheda n.5: variabili aleatorie e valori medi October 26, 2008 1 Variabili aleatorie Per la definizione rigorosa di variabile aleatoria rimandiamo ai testi di probabilità; essa è non del tutto immediata

Dettagli

Esercitazioni di Genomica

Esercitazioni di Genomica Esercitazioni di Genomica Bioinformatica ai tempi del NGS, PhD CRIBI Biotechnology Center, University of Padua BMR Genomics srl, Spin-Off Giovanni Birolo, PhD CRIBI Biotechnology Center, University of

Dettagli

4. Operazioni elementari per righe e colonne

4. Operazioni elementari per righe e colonne 4. Operazioni elementari per righe e colonne Sia K un campo, e sia A una matrice m n a elementi in K. Una operazione elementare per righe sulla matrice A è una operazione di uno dei seguenti tre tipi:

Dettagli

Obiettivo Principale: Spiegare come la stessa cosa possa essere realizzata in molti modi diversi e come, a volte, ci siano modi migliori di altri.

Obiettivo Principale: Spiegare come la stessa cosa possa essere realizzata in molti modi diversi e come, a volte, ci siano modi migliori di altri. 6 LEZIONE: Algoritmi Tempo della lezione: 45-60 Minuti. Tempo di preparazione: 10-25 Minuti (a seconda che tu abbia dei Tangram disponibili o debba tagliarli a mano) Obiettivo Principale: Spiegare come

Dettagli

Microsoft Access 2000

Microsoft Access 2000 Microsoft Access 2000 Corso introduttivo per l ECDL 2004 Pieralberto Boasso Indice Lezione 1: le basi Lezione 2: le tabelle Lezione 3: creazione di tabelle Lezione 4: le query Lezione 5: le maschere Lezione

Dettagli

Scuola Primaria Statale Falcone e Borsellino

Scuola Primaria Statale Falcone e Borsellino ISTITUTO COMPRENSIVO STATALE DI LOVERE VIA DIONIGI CASTELLI, 2 - LOVERE Scuola Primaria Statale Falcone e Borsellino PROGRAMMAZIONE DIDATTICA ANNUALE Le programmazioni didattiche sono state stese in base

Dettagli

Cluster. Vicino alla temperatura critica gli spin formano grandi gruppi (cluster)

Cluster. Vicino alla temperatura critica gli spin formano grandi gruppi (cluster) Cluster Vicino alla temperatura critica gli spin formano grandi gruppi (cluster) all interno di ogni gruppo è molto improbabile riuscire a flippare uno spin perché ci sarebbe una grande perdita di energia,

Dettagli

Interpretazione astratta

Interpretazione astratta Interpretazione astratta By Giulia Costantini (819048) e Giuseppe Maggiore (819050) Contents Interpretazione astratta... 2 Idea generale... 2 Esempio di semantica... 2 Semantica concreta... 2 Semantica

Dettagli

L interesse nella macchina di Turing

L interesse nella macchina di Turing Aniello Murano Macchina di Turing universale e problema della fermata 6 Lezione n. Parole chiave: Universal Turing machine Corso di Laurea: Informatica Codice: Email Docente: murano@ na.infn.it A.A. 2008-2009

Dettagli

Indirizzamento Aperto

Indirizzamento Aperto Indirizzamento Aperto Sommario Metodo di indirizzamento aperto Scansione lineare Scansione quadratica Hashing doppio Metodo di indirizzamento aperto L idea è di memorizzare tutti gli elementi nella tabella

Dettagli

Sintesi di Reti Sequenziali Sincrone

Sintesi di Reti Sequenziali Sincrone LABORATORIO DI ARCHITETTURA DEI CALCOLATORI lezione n 9 Prof. Rosario Cerbone rosario.cerbone@uniparthenope.it a.a. 2007-2008 http://digilander.libero.it/rosario.cerbone Sintesi di Reti Sequenziali Sincrone

Dettagli

La portata del software

La portata del software La portata del software Portata Contesto. In che modo il software in costruzione si inserirà nel sistema, prodotto o contesto aziendale esistente e quali vincoli impone il contesto? Obiettivi relativi

Dettagli