Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW"

Transcript

1 Lezione 2: Allineamento di sequenze BLAST e CLUSTALW

2 Allineamento di sequenze

3 Allineamenti L avvento della genomica moderna permette di analizzare le similitudini e le differenze tra organismi a livello del loro DNA e del loro corredo proteico completo ( informazioni evolutive, sequenze funzionali conservate, omologia tra geni ). Parallelamente, una attività comune in biologia è, data una sequenza di acidi nucleici o proteine di interesse sperimentale, di trovare sequenze simili all interno di gruppi di altre sequenze note. Molte di queste attività si possono ricondurre al problema di trovare o meno similarità tra sequenze di DNA o di amminoacidi. Ovvero, in generale, data una sequenza A (di DNA o amminoacidi) detta query e una sequenza B detta target, di allineare le due sequenze ovvero appaiare le loro singole componenti in modo da evidenziarne le zone somiglianti e quelle differenti.

4 Allineamenti Data una sequenza (DNA/proteina), ci sono oggetti simili in un certo database oppure ci sono somiglianze con altre sequenze che mi interessano? Ho trovato un nuovo gene o proteina? Un certo gene ha somiglianze con qualche altro gene nella stessa specie o in altre specie? Come posso trovare le regione di sovrapposizione tra sequenze? Come posso studiare l evoluzione di genomi di popolazioni o specie? Come posso trovare informazioni sul tipo di fold, sulla famiglia, sulla funzione di una certa proteina? allineamento di sequenze

5 Allineamenti Un tipico risultato di una procedura di allineamento è il seguente: Conservation in GABPA promoter region reveals functional Err-α motif. Asterisks denote conserved bases. The yellow box marks the experimentally validated Err- α binding site. Xie et al., Nature 2005

6 Allineamenti L operazione di allineamento però non è banale da realizzare. Allineare trovare le corrispondenze, posizione per posizione, tra due o più sequenze. A priori, ci sono molti modi di allineare due sequenze. Supponiamo di voler allineare le due sequenze di DNA ACGTCTAG ed ACTCTAG: DOMANDA: Quale è l allineamento (statisticamente) migliore?

7 Allineamenti Oppure supponiamo di voler allineare la sequenza TCTAG con una sequenza di DNA molto lunga: se partiamo da una sequenza abbastanza piccola e la vogliamo allineare con una sequenza abbastanza lunga, potremmo sempre ottenere un accordo perfetto tra elementi appaiati delle due stringhe se permettiamo un numero arbitrario di gaps. DOMANDA: Ma quale di questi allineamenti è quello (statisticamente) più significativo?

8 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di proteomica del corso). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

9 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di Zamma). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

10 Toy example Vogliamo allineare la sequenza WHAT con la sequenza WHY. Vogliamo in oltre determinare l allineamento più significativo. Per fare questo, costruiamo delle regole per costruire ogni possibile allineamento e per assegnare un punteggio (score) ad ognuno di essi. regola (algoritmo) per costruire tutti i possibili allineamenti regola (algoritmo) per assegnare uno score S ad ogni allineamento prendere l allineamento con score massimo Regole ad es: Allineamento ad es:

11 Toy example Più in generale: costruzione della matrice di allineamento della sequenza WHAT con la sequenza WHY: La matrice descrive tutti i possibili allineamenti della sequenza target con la sequenza query. Un particolare allineamento è un percorso nella matrice.

12 Toy example Ogni passo da un elemento della matrice ad una altro corrisponde ad uno spostamento su un nuovo elemento di una od entrambe le sequenze. Ad ogni passo, possiamo scrivere nell elemento di matrice lo score fino a quel punto. Il migliore allineamento è il percorso che genera lo score più alto, arrivando in basso a destra nella matrice, ovvero avendo usato tutte le lettere a disposizione di query e di target (allineamento globale).

13 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

14 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

15 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

16 Allineamento globale: formalismi In generale un allineamento globale si può scrivere come: - date due sequenze A e B di simboli, non necessariamente della stessa lunghezza ma scritte nello stesso alfabeto Scrivere una successione del tipo: le sequenze sono allineate secondo la loro lunghezza. Si inseriscono gaps se hanno lunghezze diverse. Needleman e Wunsch (1970)

17 Allineamento globale: formalismi In particolare: se le lettere ai e bj allineate sono uguale si ha una identity, altrimenti si ha un mismach. Se devo allungare l allineamento ho un indel. Lo score per aver allineato le prime i lettere di A con le prime j lettere di B è: Calcolato in maniera ricorsiva a partire da:

18 Allineamento locale Proteine con la stessa funzione possono presentare degli allineamenti di sequenza reciproci poco significativi, a causa di piccole zone di similarità racchiuse dentro zone di apparente forte diversità e/o lunghezze molto diverse. In questo casi è preferibile cercare degli allineamenti locali, cioe corti allineamenti contenuti all interno delle sequenze più lunghe (Smith e Waterman, 1981). La tecnica per calcolare allineamenti locali è sempre basata sulla costruzione di una matrice di allineamento, e cercando poi il percorso con lo score più alto. Solo che nel caso dell allineamento locale: il percorso migliore attraverserà solo parte della matrice non c è richiesta di allineare le stringhe agli estremi.

19 Allineamento locale: esempio Trovare il migliore allineamento locale e il massimo score di allineamento date le due sequenze A =ACCTAAGG e B = GGCTCAATCA.

20 Numero dei possibili allineamenti globali Date due sequenze di lunghezza m ed n per calcolarne il migliore allineamento globale, abbiamo calcolato 3 score per andare in (n-1)(m-1) celle e poi prenderne il massimo quindi circa 4mn operazioni un singolo allineamento globale è una operazione di classe O(mn). Ma quanti sono i possibili allineamenti globali? Se supponiamo per semplicità che m ~ n è possibile dimostrare che: Questo numero è gigantesco!!!!

21 Numero dei possibili allineamenti globali Supponiamo ad esempio di avere: Supponiamo ad esempio di avere: Il Sole pesa circa 1.99 x 1033 grammi. Ogni grammo contiene circa 12 x tra protoni, elettroni e neutroni, per cui il Sole contiene circa 24 x particelle elementari. ci vorrebbero 400 stelle come il Sole per contenere tante particelle elementari quanti sono gli allineamenti di due sequenze di 100 caratteri.

22 Regole di scoring (DNA) Lo scoring delle singole mosse in un allineamento deve essere fissato all inizio una volta per tutte in una scoring matrix una scelta precisa di un modello evolutivo per il nostro allineamento. Nei casi precedenti, le regole di scoring usate si possono riassumere in:

23 Regole di scoring (DNA) Sono però possibili scelte diverse. Studi di mutazioni su geni omologhi hanno indicato che le transizioni (A G, G A, C T, or T C) capitano in media con una frequenza doppia delle transversioni (A T, T A, A C, G T, etc). Quindi un modello di allineamento più sensato potrebbe utilizzare degli scores diversi per transizioni o per transversioni (e.s. sequenze simili hanno la tendenza ad avere transizioni, per cui il loro peso statistico dovrebbe essere inferiore). Una scoring matrix più realistica allora potrebbe essere:

24 Regole di scoring (DNA) Analogamente sorge il problema di come esattamente valutare lo scoring dei gaps (successioni di indels). Fino ad adesso abbiamo usato la regola semplice: come score per un gap di lunghezza k. Tuttavia è noto, per esempio che i gaps appaiono più facilmente in successione che isolati (cfr. biochimica). Inoltre, come altro esempio, delezioni di uno o due nucleotidi in regioni protein-coding in genere sono estremamente dannosi, mentre delezioni o inserzioni di gruppi di 3 nucleotidi lo sono di meno (frameshift). Un approccio potrebbe essere allora usare una regola del tipo: che ha l effetto di avere una alta penalità per aprire un primo gap α e una penalità inferiore per allargare un gap (-β per ogni base in più nel gap, con α < β).

25 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

26 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

27 Regole di scoring (proteine) Le scoring matrix degli amminoacidi sono più complesse di quelle per i nucleotidi. Sono delle tabelle che danno per ciascuna coppia di aa, un valore che indica il loro grado di similarità (informazione sulla probabilità che un aa si sostitutisca ad un altro durante l evoluzione). Si ottengono con metodi statistici assegnando a ciascuna coppia un valore che riflette la frequenza con cui l uno si sostituisce all altro in famiglie di proteine omologhe. Di solito si utilizzano due tipi di matrici: 1) Matrici PAM 2) Matrici BLOSUM

28 Regole di scoring (proteine) Matrici PAM (Point Accepted Mutation) (M. Dayhoff 1978) Due sequenze sono definite ad 1PAM di distanza se per convertire l una nell altra, c è stata in media 1 mutazione accettata ogni 100 aa. Accettata = non ha cambiato la funzione della proteina o comunque non è stata letale per l organismo Per ottenere i valori da inserire nella matrice si utilizzano inizialmente sequenze molto simili: Poi da questi valori si estrapolano le frequenze attese per seq. più divergenti. Utilizzando tante coppie di sequenze ad 1 PAM di distanza, ci aspettiamo solo l 1% di differenze: a questo punto ricaviamo le frequenze di sostituzione attese di ciascuna coppia di aa. Abbiamo così costruito la matrice PAM1.

29 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

30 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

31 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

32 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Blosum6 Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze2 che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

33 Regole di scoring (proteine) L utilizzo della matrice di similarita appropriata per ciascuna analisi e importante per avere buoni risultati negli allineamenti. poco divergenti molto divergenti BLOSUM80 BLOSUM62 BLOSUM45 PAM1 PAM120 PAM250

34 Allineamenti multipli Una estensione immediata dell allineamento a coppie è quello di estendere la procedura a N > 2 sequenze. GTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC GTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC RIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl RIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl RIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTNN

35 Allineamenti multipli Un allineamento multiplo si costruisce usando in maniera ricorsiva algoritmi simili a quelli usati per gli allineamenti a coppie ancora più calcoli dell allineamento pairwise!!! Si ottengono prima tutti i possibili allineamenti di coppia e si registra il punteggio di ciascuno. Si selezionano le sequenze più simili tra loro formando quindi clusters di sequenze allineate (costituiti da 2 o più sequenze il cui allineamento sia stato precedentemente fissato) Poi si continua aggiungendo le altre sequenze al cluster precedentemente ottenuto e così via fino ad includere tutte le sequenze considerate.

36 BLAST e CLUSTALW

37 Software per allineamenti In pratica, nel momento in cui ho bisogno di eseguire un allineamento di sequenze, ricerco un opportuno software che risolva il mio problema. seq1 seq2 seq DB tool allineamento similarità di sequenza tool lista di proteine simili alla query

38 Software per allineamenti Nella maggioranza dei casi però non avrò a che fare con software che eseguono gli algoritmi di allineamento esatto visti in precedenza, ma con versione euristiche degli stessi maggiore velocità. Es: una tipica ricerca di similarità sul database delle sequenze dell NCBI, richiede l analisi di un numero di sequenze > e che cresce in continuazione in maniera esponenziale.

39 Software per allineamenti Sono state sviluppate moltissime tecniche per incrementare la velocità degli algoritmi di allineamento. Es. di un possibile trucco : scomposizione di query e target in k-mers Supponiamo di aver una stringa di query I Questa può essere separata in una serie di (overlapping) 8-mers: Idea: se ho una sequenza target l assenza di uno qualunque degli 8-mers implica che I # J prima di allineare due sequenze posso esplorare il loro contenuto di k-mers (seeds) e decidere velocemente se le sequenze possono (potenzialmente) essere molto simili. Se sì le allineo, altrimenti continuo.

40 Software per allineamenti Noi faremo esperienza con 2 software per allineamento: BLAST e CLUSTALW

41 BLAST BLAST (Basic Local Alignment and Search Tool) è una suite di programmi sviluppata presso NCBI (Altschul et al., 1990) per l allineamento veloce di una sequenza query con database anche di grandi dimensioni e di identificare target con una precisa significanza statistica. BLAST usa un approccio euristico che approssima l algoritmo di SmithWaterman, dando dei risultati meno accurati ma in media almeno 50 volte più veloci non c'è la sicurezzza di ottenere il migliore allineamento.

42 BLAST The BLAST algorithm is a heuristic search method that seeks words of length W (default = 3 in blastp) that score at least T when aligned with the query and scored with a substitution matrix. Words in the database that score T or greater are extended in both directions in an attempt to fina a locally optimal ungapped alignment or HSP (high scoring pair) with a score of at least S or an E value lower than the specified threshold. HSPs that meet these criteria will be reported by BLAST, provided they do not exceed the cutoff value specified for number of descriptions and/or alignments to report.

43 NCBI BLAST

44 NCBI BLAST

45 NCBI BLAST

46 CLUSTALW

47 CLUSTALW

48 CLUSTALW

49 CLUSTALW

Informatica e biotecnologie II parte

Informatica e biotecnologie II parte Informatica e biotecnologie II parte Analisi di sequenze: allineamenti CGCTTCGGACGAAATCGCATCAGCATACGATCGCATGCCGGGCGGGATAAC CGAAATCGCATCAGCATACGATCGCATGC Bioinformatica La Bioinformatica è una disciplina

Dettagli

Bioinformatica e Biologia Computazionale per la Medicina Molecolare

Bioinformatica e Biologia Computazionale per la Medicina Molecolare Facoltà di Ingegneria dell Informazione Laurea Specialistica e Magistrale in Ingegneria Informatica Facoltà di Ingegneria dei Sistemi Laurea Magistrale in Ingegneria Biomedica Dipartimento di Elettronica

Dettagli

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST ESERCITAZIONE 3 OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST L'esercitazione prevede l'utilizzo di risorse web per effettuare ricerche di similarità con la proteina GRB2 (growth factor

Dettagli

Riconoscimento e recupero dell informazione per bioinformatica

Riconoscimento e recupero dell informazione per bioinformatica Riconoscimento e recupero dell informazione per bioinformatica Clustering: similarità Manuele Bicego Corso di Laurea in Bioinformatica Dipartimento di Informatica - Università di Verona Definizioni preliminari

Dettagli

4. Ricerca di sequenze in banche dati e allineamento multiplo

4. Ricerca di sequenze in banche dati e allineamento multiplo 4. Ricerca di sequenze in banche dati e allineamento multiplo Collegatevi al sito www.ncbi.nlm.nih.gov/blast. Apparirà una pagina nella quale le versioni di BLAST disponibili sono organizzate in base al

Dettagli

Tesi di Laurea di Mauro Baluda matr. 038208

Tesi di Laurea di Mauro Baluda matr. 038208 Università degli Studi di Milano Bicocca Facoltà di Scienze Matematiche Fisiche e Naturali Corso di Laurea in Informatica Algoritmi per l'allineamento di Sequenze Tesi di Laurea di matr. 038208 Relatore:

Dettagli

Determinare la sequenza del DNA

Determinare la sequenza del DNA Corso di Laurea in Chimica e Tecnologie Farmaceu9che a.a. 2014-2015 Università di Catania Determinare la sequenza del DNA Sequenziamento Sanger, NGS e Bioinforma9ca Stefano Forte Sequenziare significa

Dettagli

Una proteina nella rete: Introduzione alla bioinformatica

Una proteina nella rete: Introduzione alla bioinformatica Una proteina nella rete: Introduzione alla bioinformatica L era genomica ha assistito ad una crescita esponenziale delle informazioni biologiche rese disponibili dai progressi nel campo della biologia

Dettagli

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà Bioinformatica (1) Introduzione Dott. Alessandro Laganà Dott. Alessandro Laganà Martedi 15.30 16.30 Studio Assegnisti - 1 Piano (Davanti biblioteca) Dipartimento di Matematica e Informatica (Città Universitaria)

Dettagli

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione ATTENZIONE: lo sfondo giallo NON riguarda parti più importanti ma evidenzia solo parti di testo (frasi, paragrafi) aggiornate (correzioni, miglioramento dello stile, o aggiunta di note o esempi per chiarire

Dettagli

Allineamento locale: BLAST

Allineamento locale: BLAST Allineamento locale: BLAST BLAST (Basic Local Alignment Search Tool) è il più diffuso programma di allineamento locale delle sequenze. Per vari anni il metodo FASTA (da non confondere con l omonimo formato)

Dettagli

Applicazioni biotecnologiche in systems biology

Applicazioni biotecnologiche in systems biology Applicazioni biotecnologiche in systems biology Lezione #6 Dr. Marco Galardini AA 2012/2013 Gene regulation analysis Lezione #6 Dr. Marco Galardini AA 2012/2013 Regolazione genica Elementi molecolari e

Dettagli

Banche Dati Secondarie. geni trascritti proteine profili strutture

Banche Dati Secondarie. geni trascritti proteine profili strutture Banche Dati Secondarie geni trascritti proteine profili strutture definizione Banca dati il cui contenuto deriva da una banca dati primaria DB sec DB primario informazione PROSITE SWISS Prot patterns Profiles

Dettagli

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata Metodi per la Ricostruzione Filogenetica Ricostruire una filogenesi significa trovare la migliore stima delle relazioni evolutive storiche fra entità tassonomiche usando i dati disponibili. I dati di base

Dettagli

Sperimenta il BioLab Attività di Bioinformatica Caccia al gene

Sperimenta il BioLab Attività di Bioinformatica Caccia al gene Sperimenta il BioLab Attività di Bioinformatica Caccia al gene Università degli Studi di Milano Settore Didattico, via Celoria 20, Milano Laboratorio 105 INTRODUZIONE Questa attività pratica ha come scopo

Dettagli

DNA sequence alignment

DNA sequence alignment DNA sequence alignment - Introduzione: un possibile modello per rappresentare il DNA. Il DNA (Acido desossiribonucleico) è una sostanza presente nei nuclei cellulari, sia vegetali che animali; a questo

Dettagli

3. Confronto tra due sequenze

3. Confronto tra due sequenze 3. Confronto tra due sequenze Esercizio 1: uso di DotLet Il programma DotLet è accessibile dal sito http://myhits.isb-sib.ch/cgi-bin/dotlet, dove può essere utilizzato attraverso un interfaccia utente

Dettagli

Sequence Alignment Algorithms

Sequence Alignment Algorithms Sequence Alignment Algorithms Algoritmi per l Allineamento di Sequenze Relatore: Prof. Giancarlo Mauri Correlatore: Prof. Gianluca Della Vedova Tesi di Laurea di: Mauro Baluda Matricola 038208 Part of

Dettagli

CURRICOLO MATEMATICA

CURRICOLO MATEMATICA 1 CURRICOLO MATEMATICA Competenza 1 al termine della scuola dell Infanzia 2 NUMERI Raggruppare, ordinare, contare, misurare oggetti, grandezze ed eventi direttamente esperibili. Utilizzare calendari settimanali

Dettagli

Entropia. Motivazione. ? Quant è l informazione portata dalla sequenza? Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,...

Entropia. Motivazione. ? Quant è l informazione portata dalla sequenza? Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,... Entropia Motivazione Abbiamo una sequenza S di N simboli (campioni audio, pixel, caratteri,... ) s,s 2,s 3,... ognuno dei quali appartiene ad un alfabeto A di M elementi.? Quant è l informazione portata

Dettagli

Z-score. lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random

Z-score. lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random Z-score lo Z-score è definito come: Z-score = (opt query - M random)/ deviazione standard random è una misura di quanto il valore di opt si discosta dalla deviazione standard media. indica di quante dev.

Dettagli

I Modelli della Ricerca Operativa

I Modelli della Ricerca Operativa Capitolo 1 I Modelli della Ricerca Operativa 1.1 L approccio modellistico Il termine modello è di solito usato per indicare una costruzione artificiale realizzata per evidenziare proprietà specifiche di

Dettagli

Bioinformatica. Marin Vargas, Sergio Paul

Bioinformatica. Marin Vargas, Sergio Paul Bioinformatica Marin Vargas, Sergio Paul 2013 Wikipedia: La bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici a livello molecolare con metodi informatici. La bioinformatica

Dettagli

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale.

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale. Homology modelling L omology modeling delle proteine è il tipo di predizione di struttura terziaria più semplice ed affidabile. Viene richiesta soltanto una (o più) sequenze di riferimento su cui modellare

Dettagli

e dei genotipi tossici

e dei genotipi tossici Metodi molecolari l per il riconoscimento dei cianobatteri e dei genotipi tossici Susanna Vichi Dip. Ambiente e Connessa Prevenzione Primaria Istituto Superiore di Sanità, Roma Workshop Sorveglianza delle

Dettagli

Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT

Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT Note del Corso di Modelli Biologici Discreti: Un paio di algoritmi DNA per risolvere SAT Giuditta Franco Corso di Laurea in Bioinformatica - AA 2012/2013 Uno dei più grossi risultati nell informatica degli

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

Tesi di Laurea Specialistica. Elaborazione di dati bioinformatici attraverso l uso di Particle Swarm Optimization

Tesi di Laurea Specialistica. Elaborazione di dati bioinformatici attraverso l uso di Particle Swarm Optimization Università degli Studi di Genova Facoltà di Scienze Matematiche Fisiche e Naturali Corso di Laurea Specialistica in Informatica Anno Accademico 2009/2010 Tesi di Laurea Specialistica Elaborazione di dati

Dettagli

Predizione della struttura terziaria

Predizione della struttura terziaria Predizione della struttura terziaria Metodi di predizione La predizione della struttura tridimensionale è di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi

Dettagli

Prob(CCCCCCCCCC) = 1 2 10

Prob(CCCCCCCCCC) = 1 2 10 12. Contenuto di Informazione Algoritmico (AIC) - 17/05/12 Vogliamo adesso introdurre una nozione di contenuto di informazione di una stringa infinita, prodotta da una sorgente di informazione, che non

Dettagli

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016 Docente: Silvia Fuselli fss@unife.it Possibili testi di riferimento Introduction to Genomics, A.M. Lesk, Oxford Capitoli 1, 3,

Dettagli

Breve introduzione al Calcolo Evoluzionistico

Breve introduzione al Calcolo Evoluzionistico Breve introduzione al Calcolo Evoluzionistico Stefano Cagnoni Dipartimento di Ingegneria dell Informazione, Università di Parma cagnoni@ce.unipr.it 1 Introduzione Il mondo fisico ed i fenomeni naturali

Dettagli

La portata del software

La portata del software La portata del software Portata Contesto. In che modo il software in costruzione si inserirà nel sistema, prodotto o contesto aziendale esistente e quali vincoli impone il contesto? Obiettivi relativi

Dettagli

Informatica e biotecnologie I parte

Informatica e biotecnologie I parte Informatica e biotecnologie I parte Banche dati biologiche Bioinformatica La Bioinformatica è una disciplina che affronta con metodiche proprie delle Scienze dell'informazione problemi propri della Biologia.

Dettagli

Esercitazioni di Genomica

Esercitazioni di Genomica Esercitazioni di Genomica Bioinformatica ai tempi del NGS, PhD CRIBI Biotechnology Center, University of Padua BMR Genomics srl, Spin-Off Giovanni Birolo, PhD CRIBI Biotechnology Center, University of

Dettagli

Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA

Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA Bioinformatica - Scienza interdisciplinare coinvolgente la biologia, l informatica, la matematica e la statistica per l

Dettagli

CURRICOLO MATEMATICA ABILITA COMPETENZE

CURRICOLO MATEMATICA ABILITA COMPETENZE CURRICOLO MATEMATICA 1) Operare con i numeri nel calcolo aritmetico e algebrico, scritto e mentale, anche con riferimento a contesti reali. Per riconoscere e risolvere problemi di vario genere, individuando

Dettagli

Linkage. Lezione 4 (riprendere il testo di Genetica ) By NA

Linkage. Lezione 4 (riprendere il testo di Genetica ) By NA Linkage Lezione (riprendere il testo di Genetica ) Tipi di mappe: mappe genetiche Mappe genetiche : si basano sulla frequenza di ricombinazione fra locus identificati attraverso marcatori di varia natura:

Dettagli

MATEMATICA TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE ALLA FINE DELLA SCUOLA PRIMARIA

MATEMATICA TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE ALLA FINE DELLA SCUOLA PRIMARIA MATEMATICA TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE ALLA FINE DELLA SCUOLA PRIMARIA L alunno si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali e sa valutare l opportunità di

Dettagli

Parte 2. Determinante e matrice inversa

Parte 2. Determinante e matrice inversa Parte. Determinante e matrice inversa A. Savo Appunti del Corso di Geometria 013-14 Indice delle sezioni 1 Determinante di una matrice, 1 Teorema di Cramer (caso particolare), 3 3 Determinante di una matrice

Dettagli

ANALISI DEI DATI PER IL MARKETING 2014

ANALISI DEI DATI PER IL MARKETING 2014 ANALISI DEI DATI PER IL MARKETING 2014 Marco Riani mriani@unipr.it http://www.riani.it LA CLASSIFICAZIONE CAP IX, pp.367-457 Problema generale della scienza (Linneo, ) Analisi discriminante Cluster Analysis

Dettagli

La brevettazione in campo medico e biotecnologico. Università degli Studi di Ferrara, 29 marzo 2007

La brevettazione in campo medico e biotecnologico. Università degli Studi di Ferrara, 29 marzo 2007 La brevettazione in campo medico e biotecnologico Università degli Studi di Ferrara, 29 marzo 2007 La brevettazione delle sequenze di acido nucleico Elena Comoglio Jacobacci & Partners S.p.A. Brevetti

Dettagli

Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ;

Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ; Primo anno Secondo anno Terzo anno Primo anno MATEMATICA Scuola dell Infanzia Scuola Primaria Conta oggetti o eventi, a voce e a mente, in senso progressivo e regressivo e per salti di due, tre ; legge

Dettagli

LABORATORIO. 2 Lezioni su Basi di Dati Contatti:

LABORATORIO. 2 Lezioni su Basi di Dati Contatti: PRINCIPI DI INFORMATICA CORSO DI LAUREA IN SCIENZE BIOLOGICHE Gennaro Cordasco e Rosario De Chiara {cordasco,dechiara}@dia.unisa.it Dipartimento di Informatica ed Applicazioni R.M. Capocelli Laboratorio

Dettagli

INDICATORI OBIETTIVI DI APPRENDIMENTO classe prima

INDICATORI OBIETTIVI DI APPRENDIMENTO classe prima INDICATORI OBIETTIVI DI APPRENDIMENTO classe prima NUMERI Descrivere e simbolizzare la realtà utilizzando il linguaggio e gli strumenti matematici Imparare ad usare il numero naturale per contare, confrontare,

Dettagli

Università degli Studi di Napoli Federico II. Facoltà di Scienze MM.FF.NN. Corso di Laurea in Informatica

Università degli Studi di Napoli Federico II. Facoltà di Scienze MM.FF.NN. Corso di Laurea in Informatica Università degli Studi di Napoli Federico II Facoltà di Scienze MM.FF.NN. Corso di Laurea in Informatica Anno Accademico 2009/2010 Appunti di Calcolabilità e Complessità Lezione 9: Introduzione alle logiche

Dettagli

Microsoft Access - dispensa didattica ECDL Modulo 5 - a cura di Antonino Terranova PAG 1

Microsoft Access - dispensa didattica ECDL Modulo 5 - a cura di Antonino Terranova PAG 1 Microsoft Access - Determinare l input appropriato per il database...2 Determinare l output appropriato per il database...2 Creare un database usando l autocomposizione...2 Creare la struttura di una tabella...4

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori Informazione e computer Si può rappresentare l informazione attraverso varie forme: Numeri Testi Suoni Immagini 0001010010100101010 Computer Cerchiamo di capire come tutte queste informazioni possano essere

Dettagli

PARTE I: Bioinfo Sequenze. a) Allineamenti b) Multiallineamenti c) Alberi filogenetici d) Analisi di sequenze genomiche

PARTE I: Bioinfo Sequenze. a) Allineamenti b) Multiallineamenti c) Alberi filogenetici d) Analisi di sequenze genomiche PARTE I: Bioinfo Sequenze a) Allineamenti b) Multiallineamenti c) Alberi filogenetici d) Analisi di sequenze genomiche Distanza di Hamming Su stringhe binarie di uguale lunghezza. S= 010011011101011100

Dettagli

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini

Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Introduzione agli Algoritmi Genetici Prof. Beatrice Lazzerini Dipartimento di Ingegneria della Informazione Via Diotisalvi, 2 56122 PISA ALGORITMI GENETICI (GA) Sono usati per risolvere problemi di ricerca

Dettagli

Macchine di Turing. a n B B. Controllo Finito

Macchine di Turing. a n B B. Controllo Finito Macchine di Turing Il modello standard di macchina di Turing era un controllo finito, un nastro di input, diviso in celle, e una testina che prende in considerazione una cella del nastro alla volta. Il

Dettagli

CURRICOLO DI MATEMATICA SCUOLA PRIMARIA MATEMATICA SEZIONE A : Traguardi formativi

CURRICOLO DI MATEMATICA SCUOLA PRIMARIA MATEMATICA SEZIONE A : Traguardi formativi CURRICOLO DI MATEMATICA SCUOLA PRIMARIA MATEMATICA SEZIONE A : Traguardi formativi FINE CLASSE TERZA SCUOLA PRIMARIA FINE SCUOLA PRIMARIA COMPETENZE SPECIFICHE ABILITÀ CONOSCENZE ABILITÀ CONOSCENZE Utilizzare

Dettagli

Competenza chiave europea: MATEMATICA. Scuola Primaria. DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte

Competenza chiave europea: MATEMATICA. Scuola Primaria. DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte Competenza chiave europea: MATEMATICA Scuola Primaria DISCIPLINE DI RIFERIMENTO: MATEMATICA DISCIPLINE CONCORRENTI: tutte TAB. A TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE al termine della Scuola Primaria

Dettagli

Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE. Operare con i numeri

Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE. Operare con i numeri COMPETENZA CHIAVE MATEMATICA Fonte di legittimazione Raccomandazione del Parlamento europeo 18/12/2006 CLASSE PRIMA COMPETENZE ABILITÀ CONOSCENZE L alunno utilizza il calcolo scritto e mentale con i numeri

Dettagli

Laurea Specialistica in Informatica - Università di Ferrara 2008-2009 [1]

Laurea Specialistica in Informatica - Università di Ferrara 2008-2009 [1] Laurea Specialistica in Informatica - Università di Ferrara 2008-2009 [1] Macchine di Turing modello di calcolo introdotto dall ingegner Alan Turing nel 1936, per simulare il processo di calcolo umano

Dettagli

Le query. Lezione 6 a cura di Maria Novella Mosciatti

Le query. Lezione 6 a cura di Maria Novella Mosciatti Lezione 6 a cura di Maria Novella Mosciatti Le query Le query sono oggetti del DB che consentono di visualizzare, modificare e analizzare i dati in modi diversi. Si possono utilizzare query come origine

Dettagli

Elementi di Informatica e Programmazione

Elementi di Informatica e Programmazione Elementi di Informatica e Programmazione Il concetto di Algoritmo e di Calcolatore Corsi di Laurea in: Ingegneria Civile Ingegneria per l Ambiente e il Territorio Università degli Studi di Brescia Cos

Dettagli

Tecniche di riconoscimento statistico

Tecniche di riconoscimento statistico On AIR s.r.l. Tecniche di riconoscimento statistico Applicazioni alla lettura automatica di testi (OCR) Parte 1 - Introduzione generale Ennio Ottaviani On AIR srl ennio.ottaviani@onairweb.com http://www.onairweb.com/corsopr

Dettagli

Sorgenti autorevoli in ambienti hyperlinkati.

Sorgenti autorevoli in ambienti hyperlinkati. Sorgenti autorevoli in ambienti hyperlinkati. La qualità di un metodo di ricerca richiede la valutazione umana dovuta alla soggettività inerente alla nozione di rilevanza. I motori di ricerca correnti,

Dettagli

L interesse nella macchina di Turing

L interesse nella macchina di Turing Aniello Murano Macchina di Turing universale e problema della fermata 6 Lezione n. Parole chiave: Universal Turing machine Corso di Laurea: Informatica Codice: Email Docente: murano@ na.infn.it A.A. 2008-2009

Dettagli

SCUOLA PRIMARIA: MATEMATICA

SCUOLA PRIMARIA: MATEMATICA SCUOLA PRIMARIA: MATEMATICA Traguardi per lo sviluppo delle competenze al termine della scuola primaria L'alunno si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali e sa valutare

Dettagli

Lezione 8. La macchina universale

Lezione 8. La macchina universale Lezione 8 Algoritmi La macchina universale Un elaboratore o computer è una macchina digitale, elettronica, automatica capace di effettuare trasformazioni o elaborazioni su i dati digitale= l informazione

Dettagli

Introduzione alla programmazione in C

Introduzione alla programmazione in C Introduzione alla programmazione in C Testi Consigliati: A. Kelley & I. Pohl C didattica e programmazione B.W. Kernighan & D. M. Ritchie Linguaggio C P. Tosoratti Introduzione all informatica Materiale

Dettagli

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della struttura secondaria: Minimizzazione dell energia Un

Dettagli

4.1 Modelli di calcolo analisi asintotica e ricorrenze

4.1 Modelli di calcolo analisi asintotica e ricorrenze 4 Esercizi Prima Parte 4.1 Modelli di calcolo analisi asintotica e ricorrenze Esercizio 4 1 Rispondere alle seguenti domande: 1. Come misuriamo l efficienza di un algoritmo?. Quali sono gli algoritmi più

Dettagli

Dispensa 3. 1.1 YACC: generalità

Dispensa 3. 1.1 YACC: generalità Dispensa 3 1.1 YACC: generalità Il tool Yacc (acronimo per Yet Another Compiler Compiler) è uno strumento software che a partire da una specifica grammaticale context free di un linguaggio scritta in un

Dettagli

CURRICOLO DI MATEMATICA

CURRICOLO DI MATEMATICA ISTITUTO COMPRENSIVO PASSIRANO-PADERNO CURRICOLO DI MATEMATICA SCUOLA PRIMARIA Revisione Curricolo di Istituto a.s. 2014-2015 Curricolo suddiviso in obiettivi didattici, nuclei tematici e anni scolastici

Dettagli

Sommario della lezione

Sommario della lezione Università degli Studi di Salerno Corso di Algoritmi Prof. Ugo Vaccaro Anno Acc. 2014/15 p. 1/33 Sommario della lezione Ancora sui cammini minimi: Cammini minimi in grafi con archi di costo negativo Algoritmi

Dettagli

MATEMATICA SCUOLE DELL INFANZIA

MATEMATICA SCUOLE DELL INFANZIA MATEMATICA SCUOLE DELL INFANZIA CAMPO DI ESPERIENZA: LA CONOSCENZA DEL MONDO (ordine, misura, spazio, tempo, natura) È l'ambito relativo all'esplorazione, scoperta e prima sistematizzazione delle conoscenze

Dettagli

Informatica B. Sezione D. Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica

Informatica B. Sezione D. Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica Dipartimento di Elettronica, Informazione e Bioingegneria Informatica B Sezione D Franchi Alessio Mauro,

Dettagli

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto La Bioinformatica è una disciplina che si occupa dell applicazione dell informatica nell ambito biologico per consentire lo studio

Dettagli

Idee guida. Finite State Machine (1) Un automa a stati finiti è definito da una 5- pla: FSM = , dove: Finite State Machine (2)

Idee guida. Finite State Machine (1) Un automa a stati finiti è definito da una 5- pla: FSM = <Q,,, q0, F>, dove: Finite State Machine (2) Idee guida ASM = FSM con stati generalizzati Le ASM rappresentano la forma matematica di Macchine Astratte che estendono la nozione di Finite State Machine Ground Model (descrizioni formali) Raffinamenti

Dettagli

SCUOLA PRIMARIA. Indicatori Obiettivi di apprendimento Criteri di valutazione

SCUOLA PRIMARIA. Indicatori Obiettivi di apprendimento Criteri di valutazione SCUOLA PRIMARIA Relazioni, dati e Contare oggetti o eventi, a voce e mentalmente, in senso progressivo e regressivo entro il 20. Leggere e scrivere i numeri naturali entro il 20, confrontarli e ordinarli

Dettagli

TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA

TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA SCUOLA PRIMARIA DI CORTE FRANCA MATEMATICA CLASSE QUINTA TRAGUARDI PER LO SVILUPPO DELLE COMPETENZE AL TERMINE DELLA SCUOLA PRIMARIA L ALUNNO SVILUPPA UN ATTEGGIAMENTO POSITIVO RISPETTO ALLA MATEMATICA,

Dettagli

ATTIVITÀ LOGICO MATEMATICHE

ATTIVITÀ LOGICO MATEMATICHE Finalità ATTIVITÀ LOGICO MATEMATICHE La matematica si propone come strumento per modellizzare il mondo e le attività dell uomo e, nello stesso tempo, come costruzione logica, indipendente dalle sue applicazioni

Dettagli

regola(1,[e,f],b) regola(2,[m,f],e) regola(3,[m],f) regola(4,[b,f],g) regola(5,[b,g],c) regola(6,[g,q],a)

regola(1,[e,f],b) regola(2,[m,f],e) regola(3,[m],f) regola(4,[b,f],g) regola(5,[b,g],c) regola(6,[g,q],a) ESERCIZIO1 PREMESSA Per risolvere problemi spesso esistono delle regole che, dai dati del problema, permettono di calcolare o dedurre la soluzione. Questa situazione si può descrivere col termine regola(,

Dettagli

Ricerca Operativa A.A. 2007/2008

Ricerca Operativa A.A. 2007/2008 Ricerca Operativa A.A. 2007/2008 9. Cenni su euristiche e metaeuristiche per ottimizzazione combinatoria Motivazioni L applicazione di metodi esatti non è sempre possibile a causa della complessità del

Dettagli

PRIMO ISTITUTO COMPRENSIVO di PALAZZOLO S/O via Zanardelli n.34 Anno scolastico 2014/2015

PRIMO ISTITUTO COMPRENSIVO di PALAZZOLO S/O via Zanardelli n.34 Anno scolastico 2014/2015 PRIMO ISTITUTO COMPRENSIVO di PALAZZOLO S/O via Zanardelli n.34 Anno scolastico 2014/2015 CURRICOLI DISCIPLINARI SCUOLA DELL INFANZIA e PRIMO CICLO di ISTRUZIONE Percorso delle singole discipline sulla

Dettagli

ISTITUTO COMPRENSIVO ORZINUOVI ANNO SCOLASTICO 2012-2013 PROGRAMMAZIONE di MATEMATICA 1 QUADRIMESTRE CLASSE PRIMA

ISTITUTO COMPRENSIVO ORZINUOVI ANNO SCOLASTICO 2012-2013 PROGRAMMAZIONE di MATEMATICA 1 QUADRIMESTRE CLASSE PRIMA PROGRAMMAZIONE di MATEMATICA 1 QUADRIMESTRE CLASSE PRIMA COMPETENZE OBIETTIVI DI APPRENDIMENTO ATTIVITÀ NUMERI 1. Opera con i numeri 1a. Contare in senso progressivo o regressivo fino a 20 1b. Leggere

Dettagli

CURRICOLO MATEMATICA CLASSE 1^

CURRICOLO MATEMATICA CLASSE 1^ CURRICOLO CLASSE 1^ COMPETENZE CHIAVE: Competenze di base in matematica Classe 1^ Contare oggetti o eventi, a voce e mentalmente Leggere e scrivere i numeri naturali in notazione decimale avendo consapevolezza

Dettagli

Corso di Informatica II. Corso di Informatica II. Corso di Informatica. Access 22/03/2009. Ing. Dario Sguassero. Ing.

Corso di Informatica II. Corso di Informatica II. Corso di Informatica. Access 22/03/2009. Ing. Dario Sguassero. Ing. Lezione del 20 marzo 2009 Introduzione ad Access Informatica Presentazione di Microsoft Access Access Accessè un programma della suite Office per la gestione dei database (archivi) Un database è una raccolta

Dettagli

estratto da Competenze assi culturali Raccolta delle rubriche di competenza formulate secondo i livelli EFQ a cura USP Treviso Asse matematico

estratto da Competenze assi culturali Raccolta delle rubriche di competenza formulate secondo i livelli EFQ a cura USP Treviso Asse matematico Competenza matematica n. BIENNIO, BIENNIO Utilizzare le tecniche e le procedure del calcolo aritmetico ed algebrico, rappresentandole anche sotto forma grafica BIENNIO BIENNIO Operare sui dati comprendendone

Dettagli

Bioinformatica: DNA e Algoritmi

Bioinformatica: DNA e Algoritmi Bioinformatica: DNA e Algoritmi Alberto Policriti Dpt. of Mathematics and Informatics, University of Udine. Applied Genomics Institute Di cosa parleremo In generale Deniamo i termini: DNA & Algoritmi Tecnologie

Dettagli

Programmazione dinamica

Programmazione dinamica Capitolo 6 Programmazione dinamica 6.4 Il problema della distanza di edit tra due stringhe x e y chiede di calcolare il minimo numero di operazioni su singoli caratteri (inserimento, cancellazione e sostituzione)

Dettagli

Lezione 8. DNA sequencing informatics

Lezione 8. DNA sequencing informatics Lezione 8 DNA sequencing informatics Il materiale di questa lezione è contenuto nel libro Next-generation DNA sequencing informatics Edited by Stuart M Brown Disponibile in biblioteca (CHIOSTRO 572.8633

Dettagli

Processo di risoluzione di un problema ingegneristico. Processo di risoluzione di un problema ingegneristico

Processo di risoluzione di un problema ingegneristico. Processo di risoluzione di un problema ingegneristico Processo di risoluzione di un problema ingegneristico 1. Capire l essenza del problema. 2. Raccogliere le informazioni disponibili. Alcune potrebbero essere disponibili in un secondo momento. 3. Determinare

Dettagli

0. Piano cartesiano 1

0. Piano cartesiano 1 0. Piano cartesiano Per piano cartesiano si intende un piano dotato di due assi (che per ragioni pratiche possiamo scegliere ortogonali). Il punto in comune ai due assi è detto origine, e funziona da origine

Dettagli

MICROSOFT ACCESS. Fabrizio Barani 1

MICROSOFT ACCESS. Fabrizio Barani 1 MICROSOFT ACCESS Premessa ACCESS è un programma di gestione di banche dati, consente la creazione e modifica dei contenitori di informazioni di un database (tabelle), l inserimento di dati anche mediante

Dettagli

ISTITUTO COMPRENSIVO MONTEGROTTO TERME SCUOLA PRIMARIA DISCIPLINA: MATEMATICA - CLASSE PRIMA OBIETTIVI DI APPRENDIMENTO

ISTITUTO COMPRENSIVO MONTEGROTTO TERME SCUOLA PRIMARIA DISCIPLINA: MATEMATICA - CLASSE PRIMA OBIETTIVI DI APPRENDIMENTO PRIMA DELLA DISCIPLINA: MATEMATICA - CLASSE PRIMA L alunno si muove con sicurezza nel calcolo scritto e mentale con i numeri naturali. Legge e comprende testi che coinvolgono aspetti logici e matematici.

Dettagli

Scuola Primaria Statale Falcone e Borsellino

Scuola Primaria Statale Falcone e Borsellino ISTITUTO COMPRENSIVO STATALE DI LOVERE VIA DIONIGI CASTELLI, 2 - LOVERE Scuola Primaria Statale Falcone e Borsellino PROGRAMMAZIONE DIDATTICA ANNUALE Le programmazioni didattiche sono state stese in base

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile Problemi connessi all utilizzo di un numero di bit limitato Abbiamo visto quali sono i vantaggi dell utilizzo della rappresentazione in complemento alla base: corrispondenza biunivoca fra rappresentazione

Dettagli

Il Foglio Elettronico. Microsoft Excel

Il Foglio Elettronico. Microsoft Excel Il Foglio Elettronico 1 Parte I Concetti generali Celle e fogli di lavoro.xls Inserimento dati e tipi di dati Importazione di dati Modifica e formattazione di fogli di lavoro FOGLIO ELETTRONICO. I fogli

Dettagli

SCHEDA DI PROGRAMMAZIONE DISCIPLINARE DA RIPORTARE SUL P.O.F. A.S. 2014-2015. Ripasso programmazione ad oggetti. Basi di dati: premesse introduttive

SCHEDA DI PROGRAMMAZIONE DISCIPLINARE DA RIPORTARE SUL P.O.F. A.S. 2014-2015. Ripasso programmazione ad oggetti. Basi di dati: premesse introduttive SCHEDA DI PROGRAMMAZIONE DISCIPLINARE DA RIPORTARE SUL P.O.F. A.S. 2014-2015 ASSE DISCIPLINA DOCENTE MATEMATICO INFORMATICA Cattani Barbara monoennio CLASSE: quinta CORSO D SEZIONE LICEO SCIENZE APPLICATE

Dettagli

pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA

pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA INDICE pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA 1.1. Il concetto d identificazione... 9 1.2. L identificazione nella storia....

Dettagli

Ministero dell Istruzione, dell Università e della Ricerca

Ministero dell Istruzione, dell Università e della Ricerca Ministero dell Istruzione, dell Università e della Ricerca Ufficio Scolastico Regionale per il Lazio Istiituto Comprensiivo Don Lorenzo Miillanii Scuola dell Infanzia Primaria Secondaria di I grado anche

Dettagli

IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014

IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014 IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014 CLASSE:Prima B LIBRI DI TESTO: Bowen, Delaney High Spirits Starter Book e High Spirits

Dettagli

Tecniche di DM: Link analysis e Association discovery

Tecniche di DM: Link analysis e Association discovery Tecniche di DM: Link analysis e Association discovery Vincenzo Antonio Manganaro vincenzomang@virgilio.it, www.statistica.too.it Indice 1 Architettura di un generico algoritmo di DM. 2 2 Regole di associazione:

Dettagli

Interpretazione astratta

Interpretazione astratta Interpretazione astratta By Giulia Costantini (819048) e Giuseppe Maggiore (819050) Contents Interpretazione astratta... 2 Idea generale... 2 Esempio di semantica... 2 Semantica concreta... 2 Semantica

Dettagli

Esercizi per il corso di Algoritmi e Strutture Dati

Esercizi per il corso di Algoritmi e Strutture Dati 1 Esercizi per il corso di Algoritmi e Strutture Dati Esercizi sulla Tecnica Divide et Impera N.B. Tutti gli algoritmi vanno scritti in pseudocodice (non in Java, né in C++, etc. ). Di tutti gli algoritmi

Dettagli

SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA

SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA SCUOLA PRIMARIA I.C. di CRESPELLANO PROGRAMMAZIONE ANNUALE MATEMATICA ANNO SCOLASTICO 2013/2014 INSEGNANTI Gabellone, Silvagni,Damiano TRAGUARDI DELLE COMPETENZE AL TERMINE della CLASSE QUARTA Sviluppa

Dettagli