Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW"

Transcript

1 Lezione 2: Allineamento di sequenze BLAST e CLUSTALW

2 Allineamento di sequenze

3 Allineamenti L avvento della genomica moderna permette di analizzare le similitudini e le differenze tra organismi a livello del loro DNA e del loro corredo proteico completo ( informazioni evolutive, sequenze funzionali conservate, omologia tra geni ). Parallelamente, una attività comune in biologia è, data una sequenza di acidi nucleici o proteine di interesse sperimentale, di trovare sequenze simili all interno di gruppi di altre sequenze note. Molte di queste attività si possono ricondurre al problema di trovare o meno similarità tra sequenze di DNA o di amminoacidi. Ovvero, in generale, data una sequenza A (di DNA o amminoacidi) detta query e una sequenza B detta target, di allineare le due sequenze ovvero appaiare le loro singole componenti in modo da evidenziarne le zone somiglianti e quelle differenti.

4 Allineamenti Data una sequenza (DNA/proteina), ci sono oggetti simili in un certo database oppure ci sono somiglianze con altre sequenze che mi interessano? Ho trovato un nuovo gene o proteina? Un certo gene ha somiglianze con qualche altro gene nella stessa specie o in altre specie? Come posso trovare le regione di sovrapposizione tra sequenze? Come posso studiare l evoluzione di genomi di popolazioni o specie? Come posso trovare informazioni sul tipo di fold, sulla famiglia, sulla funzione di una certa proteina? allineamento di sequenze

5 Allineamenti Un tipico risultato di una procedura di allineamento è il seguente: Conservation in GABPA promoter region reveals functional Err-α motif. Asterisks denote conserved bases. The yellow box marks the experimentally validated Err- α binding site. Xie et al., Nature 2005

6 Allineamenti L operazione di allineamento però non è banale da realizzare. Allineare trovare le corrispondenze, posizione per posizione, tra due o più sequenze. A priori, ci sono molti modi di allineare due sequenze. Supponiamo di voler allineare le due sequenze di DNA ACGTCTAG ed ACTCTAG: DOMANDA: Quale è l allineamento (statisticamente) migliore?

7 Allineamenti Oppure supponiamo di voler allineare la sequenza TCTAG con una sequenza di DNA molto lunga: se partiamo da una sequenza abbastanza piccola e la vogliamo allineare con una sequenza abbastanza lunga, potremmo sempre ottenere un accordo perfetto tra elementi appaiati delle due stringhe se permettiamo un numero arbitrario di gaps. DOMANDA: Ma quale di questi allineamenti è quello (statisticamente) più significativo?

8 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di proteomica del corso). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

9 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di Zamma). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

10 Toy example Vogliamo allineare la sequenza WHAT con la sequenza WHY. Vogliamo in oltre determinare l allineamento più significativo. Per fare questo, costruiamo delle regole per costruire ogni possibile allineamento e per assegnare un punteggio (score) ad ognuno di essi. regola (algoritmo) per costruire tutti i possibili allineamenti regola (algoritmo) per assegnare uno score S ad ogni allineamento prendere l allineamento con score massimo Regole ad es: Allineamento ad es:

11 Toy example Più in generale: costruzione della matrice di allineamento della sequenza WHAT con la sequenza WHY: La matrice descrive tutti i possibili allineamenti della sequenza target con la sequenza query. Un particolare allineamento è un percorso nella matrice.

12 Toy example Ogni passo da un elemento della matrice ad una altro corrisponde ad uno spostamento su un nuovo elemento di una od entrambe le sequenze. Ad ogni passo, possiamo scrivere nell elemento di matrice lo score fino a quel punto. Il migliore allineamento è il percorso che genera lo score più alto, arrivando in basso a destra nella matrice, ovvero avendo usato tutte le lettere a disposizione di query e di target (allineamento globale).

13 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

14 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

15 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

16 Allineamento globale: formalismi In generale un allineamento globale si può scrivere come: - date due sequenze A e B di simboli, non necessariamente della stessa lunghezza ma scritte nello stesso alfabeto Scrivere una successione del tipo: le sequenze sono allineate secondo la loro lunghezza. Si inseriscono gaps se hanno lunghezze diverse. Needleman e Wunsch (1970)

17 Allineamento globale: formalismi In particolare: se le lettere ai e bj allineate sono uguale si ha una identity, altrimenti si ha un mismach. Se devo allungare l allineamento ho un indel. Lo score per aver allineato le prime i lettere di A con le prime j lettere di B è: Calcolato in maniera ricorsiva a partire da:

18 Allineamento locale Proteine con la stessa funzione possono presentare degli allineamenti di sequenza reciproci poco significativi, a causa di piccole zone di similarità racchiuse dentro zone di apparente forte diversità e/o lunghezze molto diverse. In questo casi è preferibile cercare degli allineamenti locali, cioe corti allineamenti contenuti all interno delle sequenze più lunghe (Smith e Waterman, 1981). La tecnica per calcolare allineamenti locali è sempre basata sulla costruzione di una matrice di allineamento, e cercando poi il percorso con lo score più alto. Solo che nel caso dell allineamento locale: il percorso migliore attraverserà solo parte della matrice non c è richiesta di allineare le stringhe agli estremi.

19 Allineamento locale: esempio Trovare il migliore allineamento locale e il massimo score di allineamento date le due sequenze A =ACCTAAGG e B = GGCTCAATCA.

20 Numero dei possibili allineamenti globali Date due sequenze di lunghezza m ed n per calcolarne il migliore allineamento globale, abbiamo calcolato 3 score per andare in (n-1)(m-1) celle e poi prenderne il massimo quindi circa 4mn operazioni un singolo allineamento globale è una operazione di classe O(mn). Ma quanti sono i possibili allineamenti globali? Se supponiamo per semplicità che m ~ n è possibile dimostrare che: Questo numero è gigantesco!!!!

21 Numero dei possibili allineamenti globali Supponiamo ad esempio di avere: Supponiamo ad esempio di avere: Il Sole pesa circa 1.99 x 1033 grammi. Ogni grammo contiene circa 12 x tra protoni, elettroni e neutroni, per cui il Sole contiene circa 24 x particelle elementari. ci vorrebbero 400 stelle come il Sole per contenere tante particelle elementari quanti sono gli allineamenti di due sequenze di 100 caratteri.

22 Regole di scoring (DNA) Lo scoring delle singole mosse in un allineamento deve essere fissato all inizio una volta per tutte in una scoring matrix una scelta precisa di un modello evolutivo per il nostro allineamento. Nei casi precedenti, le regole di scoring usate si possono riassumere in:

23 Regole di scoring (DNA) Sono però possibili scelte diverse. Studi di mutazioni su geni omologhi hanno indicato che le transizioni (A G, G A, C T, or T C) capitano in media con una frequenza doppia delle transversioni (A T, T A, A C, G T, etc). Quindi un modello di allineamento più sensato potrebbe utilizzare degli scores diversi per transizioni o per transversioni (e.s. sequenze simili hanno la tendenza ad avere transizioni, per cui il loro peso statistico dovrebbe essere inferiore). Una scoring matrix più realistica allora potrebbe essere:

24 Regole di scoring (DNA) Analogamente sorge il problema di come esattamente valutare lo scoring dei gaps (successioni di indels). Fino ad adesso abbiamo usato la regola semplice: come score per un gap di lunghezza k. Tuttavia è noto, per esempio che i gaps appaiono più facilmente in successione che isolati (cfr. biochimica). Inoltre, come altro esempio, delezioni di uno o due nucleotidi in regioni protein-coding in genere sono estremamente dannosi, mentre delezioni o inserzioni di gruppi di 3 nucleotidi lo sono di meno (frameshift). Un approccio potrebbe essere allora usare una regola del tipo: che ha l effetto di avere una alta penalità per aprire un primo gap α e una penalità inferiore per allargare un gap (-β per ogni base in più nel gap, con α < β).

25 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

26 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

27 Regole di scoring (proteine) Le scoring matrix degli amminoacidi sono più complesse di quelle per i nucleotidi. Sono delle tabelle che danno per ciascuna coppia di aa, un valore che indica il loro grado di similarità (informazione sulla probabilità che un aa si sostitutisca ad un altro durante l evoluzione). Si ottengono con metodi statistici assegnando a ciascuna coppia un valore che riflette la frequenza con cui l uno si sostituisce all altro in famiglie di proteine omologhe. Di solito si utilizzano due tipi di matrici: 1) Matrici PAM 2) Matrici BLOSUM

28 Regole di scoring (proteine) Matrici PAM (Point Accepted Mutation) (M. Dayhoff 1978) Due sequenze sono definite ad 1PAM di distanza se per convertire l una nell altra, c è stata in media 1 mutazione accettata ogni 100 aa. Accettata = non ha cambiato la funzione della proteina o comunque non è stata letale per l organismo Per ottenere i valori da inserire nella matrice si utilizzano inizialmente sequenze molto simili: Poi da questi valori si estrapolano le frequenze attese per seq. più divergenti. Utilizzando tante coppie di sequenze ad 1 PAM di distanza, ci aspettiamo solo l 1% di differenze: a questo punto ricaviamo le frequenze di sostituzione attese di ciascuna coppia di aa. Abbiamo così costruito la matrice PAM1.

29 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

30 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

31 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

32 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Blosum6 Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze2 che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

33 Regole di scoring (proteine) L utilizzo della matrice di similarita appropriata per ciascuna analisi e importante per avere buoni risultati negli allineamenti. poco divergenti molto divergenti BLOSUM80 BLOSUM62 BLOSUM45 PAM1 PAM120 PAM250

34 Allineamenti multipli Una estensione immediata dell allineamento a coppie è quello di estendere la procedura a N > 2 sequenze. GTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC GTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC RIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl RIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl RIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTNN

35 Allineamenti multipli Un allineamento multiplo si costruisce usando in maniera ricorsiva algoritmi simili a quelli usati per gli allineamenti a coppie ancora più calcoli dell allineamento pairwise!!! Si ottengono prima tutti i possibili allineamenti di coppia e si registra il punteggio di ciascuno. Si selezionano le sequenze più simili tra loro formando quindi clusters di sequenze allineate (costituiti da 2 o più sequenze il cui allineamento sia stato precedentemente fissato) Poi si continua aggiungendo le altre sequenze al cluster precedentemente ottenuto e così via fino ad includere tutte le sequenze considerate.

36 BLAST e CLUSTALW

37 Software per allineamenti In pratica, nel momento in cui ho bisogno di eseguire un allineamento di sequenze, ricerco un opportuno software che risolva il mio problema. seq1 seq2 seq DB tool allineamento similarità di sequenza tool lista di proteine simili alla query

38 Software per allineamenti Nella maggioranza dei casi però non avrò a che fare con software che eseguono gli algoritmi di allineamento esatto visti in precedenza, ma con versione euristiche degli stessi maggiore velocità. Es: una tipica ricerca di similarità sul database delle sequenze dell NCBI, richiede l analisi di un numero di sequenze > e che cresce in continuazione in maniera esponenziale.

39 Software per allineamenti Sono state sviluppate moltissime tecniche per incrementare la velocità degli algoritmi di allineamento. Es. di un possibile trucco : scomposizione di query e target in k-mers Supponiamo di aver una stringa di query I Questa può essere separata in una serie di (overlapping) 8-mers: Idea: se ho una sequenza target l assenza di uno qualunque degli 8-mers implica che I # J prima di allineare due sequenze posso esplorare il loro contenuto di k-mers (seeds) e decidere velocemente se le sequenze possono (potenzialmente) essere molto simili. Se sì le allineo, altrimenti continuo.

40 Software per allineamenti Noi faremo esperienza con 2 software per allineamento: BLAST e CLUSTALW

41 BLAST BLAST (Basic Local Alignment and Search Tool) è una suite di programmi sviluppata presso NCBI (Altschul et al., 1990) per l allineamento veloce di una sequenza query con database anche di grandi dimensioni e di identificare target con una precisa significanza statistica. BLAST usa un approccio euristico che approssima l algoritmo di SmithWaterman, dando dei risultati meno accurati ma in media almeno 50 volte più veloci non c'è la sicurezzza di ottenere il migliore allineamento.

42 BLAST The BLAST algorithm is a heuristic search method that seeks words of length W (default = 3 in blastp) that score at least T when aligned with the query and scored with a substitution matrix. Words in the database that score T or greater are extended in both directions in an attempt to fina a locally optimal ungapped alignment or HSP (high scoring pair) with a score of at least S or an E value lower than the specified threshold. HSPs that meet these criteria will be reported by BLAST, provided they do not exceed the cutoff value specified for number of descriptions and/or alignments to report.

43 NCBI BLAST

44 NCBI BLAST

45 NCBI BLAST

46 CLUSTALW

47 CLUSTALW

48 CLUSTALW

49 CLUSTALW

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della struttura secondaria: Minimizzazione dell energia Un

Dettagli

Data Alignment and (Geo)Referencing (sometimes Registration process)

Data Alignment and (Geo)Referencing (sometimes Registration process) Data Alignment and (Geo)Referencing (sometimes Registration process) All data aquired from a scan position are refered to an intrinsic reference system (even if more than one scan has been performed) Data

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

Una proteina nella rete: Caccia al tesoro bioinformatica

Una proteina nella rete: Caccia al tesoro bioinformatica Una proteina nella rete: Caccia al tesoro bioinformatica Nel corso di questa attivita utilizzeremo alcune delle piu importanti banche dati disponibili in rete per cercare informazioni su una proteina.

Dettagli

Parte 2. Determinante e matrice inversa

Parte 2. Determinante e matrice inversa Parte. Determinante e matrice inversa A. Savo Appunti del Corso di Geometria 013-14 Indice delle sezioni 1 Determinante di una matrice, 1 Teorema di Cramer (caso particolare), 3 3 Determinante di una matrice

Dettagli

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Se a e b sono numeri interi, si dice che a divide b, in simboli: a b, se e solo se esiste c Z tale che b = ac. Si può subito notare che:

Dettagli

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma.

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna è caratteristico degli eucarioti: Sequenze codificanti 1.5% del genoma umano Introni in media 95-97%

Dettagli

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile Problemi connessi all utilizzo di un numero di bit limitato Abbiamo visto quali sono i vantaggi dell utilizzo della rappresentazione in complemento alla base: corrispondenza biunivoca fra rappresentazione

Dettagli

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione nei procarioti Concetti base Nucleoside base purinica o pirimidinica legata alla posizione 1 dell anello pentoso Nucleotide base azotata-pentoso-fosfato Concetti base La trascrizione comporta

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

Rappresentazione dei numeri in un calcolatore

Rappresentazione dei numeri in un calcolatore Corso di Calcolatori Elettronici I A.A. 2010-2011 Rappresentazione dei numeri in un calcolatore Lezione 2 Università degli Studi di Napoli Federico II Facoltà di Ingegneria Rappresentazione dei numeri

Dettagli

Excel basi e funzioni

Excel basi e funzioni Esercitazione di Laboratorio Excel basi e funzioni Contenuto delle celle 1. Testo 2. Numeri 3. Formule Formattazione delle celle (1) Formattazione del testo e dei singoli caratteri: Orientamento a 45 Allineamento

Dettagli

DI REGOLAZIONE A DUE COMPONENTI

DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac

Dettagli

VALORE DELLE MERCI SEQUESTRATE

VALORE DELLE MERCI SEQUESTRATE La contraffazione in cifre: NUOVA METODOLOGIA PER LA STIMA DEL VALORE DELLE MERCI SEQUESTRATE Roma, Giugno 2013 Giugno 2013-1 Il valore economico dei sequestri In questo Focus si approfondiscono alcune

Dettagli

Esercizi per il corso di Algoritmi e Strutture Dati

Esercizi per il corso di Algoritmi e Strutture Dati 1 Esercizi per il corso di Algoritmi e Strutture Dati Esercizi sulla Tecnica Divide et Impera N.B. Tutti gli algoritmi vanno scritti in pseudocodice (non in Java, né in C++, etc. ). Di tutti gli algoritmi

Dettagli

4. Operazioni elementari per righe e colonne

4. Operazioni elementari per righe e colonne 4. Operazioni elementari per righe e colonne Sia K un campo, e sia A una matrice m n a elementi in K. Una operazione elementare per righe sulla matrice A è una operazione di uno dei seguenti tre tipi:

Dettagli

METODI ITERATIVI PER SISTEMI LINEARI

METODI ITERATIVI PER SISTEMI LINEARI METODI ITERATIVI PER SISTEMI LINEARI LUCIA GASTALDI 1. Metodi iterativi classici Sia A R n n una matrice non singolare e sia b R n. Consideriamo il sistema (1) Ax = b. Un metodo iterativo per la soluzione

Dettagli

Parte 3. Rango e teorema di Rouché-Capelli

Parte 3. Rango e teorema di Rouché-Capelli Parte 3. Rango e teorema di Rouché-Capelli A. Savo Appunti del Corso di Geometria 203-4 Indice delle sezioni Rango di una matrice, 2 Teorema degli orlati, 3 3 Calcolo con l algoritmo di Gauss, 6 4 Matrici

Dettagli

Nella prima lezione... Che cos è il Digitale. Prima parte: Che cos è il Digitale. Che cos è il Digitale. Che cos è il Digitale

Nella prima lezione... Che cos è il Digitale. Prima parte: Che cos è il Digitale. Che cos è il Digitale. Che cos è il Digitale !"$#%!" #% Nella prima lezione... Definizione di Informatica Cosa è una soluzione algoritmica Esempi di algoritmi cicalese@dia.unisa.it 2 Prima parte: Società dell informazione Ma cosa vuol dire società

Dettagli

unità B3. Le teorie sull evoluzione

unità B3. Le teorie sull evoluzione documentazione fossile è provata da embriologia comparata anatomia comparata biologia molecolare L evoluzione avviene per selezione naturale microevoluzione può essere macroevoluzione speciazione allopatrica

Dettagli

Circuiti in Corrente Continua (direct current=dc) RIASSUNTO: La carica elettrica La corrente elettrica Il Potenziale Elettrico La legge di Ohm Il

Circuiti in Corrente Continua (direct current=dc) RIASSUNTO: La carica elettrica La corrente elettrica Il Potenziale Elettrico La legge di Ohm Il Circuiti in Corrente Continua direct currentdc ASSUNTO: La carica elettrica La corrente elettrica l Potenziale Elettrico La legge di Ohm l resistore codice dei colori esistenze in serie ed in parallelo

Dettagli

Esercizi su lineare indipendenza e generatori

Esercizi su lineare indipendenza e generatori Esercizi su lineare indipendenza e generatori Per tutto il seguito, se non specificato esplicitamente K indicherà un campo e V uno spazio vettoriale su K Cose da ricordare Definizione Dei vettori v,,v

Dettagli

GeoGebra 4.2 Introduzione all utilizzo della Vista CAS per il secondo biennio e il quinto anno

GeoGebra 4.2 Introduzione all utilizzo della Vista CAS per il secondo biennio e il quinto anno GeoGebra 4.2 Introduzione all utilizzo della Vista CAS per il secondo biennio e il quinto anno La Vista CAS L ambiente di lavoro Le celle Assegnazione di una variabile o di una funzione / visualizzazione

Dettagli

Teoria quantistica della conduzione nei solidi e modello a bande

Teoria quantistica della conduzione nei solidi e modello a bande Teoria quantistica della conduzione nei solidi e modello a bande Obiettivi - Descrivere il comportamento quantistico di un elettrone in un cristallo unidimensionale - Spiegare l origine delle bande di

Dettagli

QUARTA E QUINTA ISTITUTO TECNICO INDUSTRIALE

QUARTA E QUINTA ISTITUTO TECNICO INDUSTRIALE QUARTA E QUINTA ISTITUTO TECNICO INDUSTRIALE - Matematica - Griglie di valutazione Materia: Matematica Obiettivi disciplinari Gli obiettivi indicati si riferiscono all intero percorso della classe quarta

Dettagli

Dimensione di uno Spazio vettoriale

Dimensione di uno Spazio vettoriale Capitolo 4 Dimensione di uno Spazio vettoriale 4.1 Introduzione Dedichiamo questo capitolo ad un concetto fondamentale in algebra lineare: la dimensione di uno spazio vettoriale. Daremo una definizione

Dettagli

Ricerca Operativa Branch-and-Bound per problemi di Programmazione Lineare Intera

Ricerca Operativa Branch-and-Bound per problemi di Programmazione Lineare Intera Ricerca Operativa Branch-and-Bound per problemi di Programmazione Lineare Intera L. De Giovanni AVVERTENZA: le note presentate di seguito non hanno alcuna pretesa di completezza, né hanno lo scopo di sostituirsi

Dettagli

Misure di base su una carta. Calcoli di distanze

Misure di base su una carta. Calcoli di distanze Misure di base su una carta Calcoli di distanze Per calcolare la distanza tra due punti su una carta disegnata si opera nel modo seguente: 1. Occorre identificare la scala della carta o ricorrendo alle

Dettagli

Introduzione agli algoritmi e alla programmazione in VisualBasic.Net

Introduzione agli algoritmi e alla programmazione in VisualBasic.Net Lezione 1 Introduzione agli algoritmi e alla programmazione in VisualBasic.Net Definizione di utente e di programmatore L utente è qualsiasi persona che usa il computer anche se non è in grado di programmarlo

Dettagli

Statistica. Lezione 6

Statistica. Lezione 6 Università degli Studi del Piemonte Orientale Corso di Laurea in Infermieristica Corso integrato in Scienze della Prevenzione e dei Servizi sanitari Statistica Lezione 6 a.a 011-01 Dott.ssa Daniela Ferrante

Dettagli

4 Quarta lezione: Spazi di Banach e funzionali lineari. Spazio duale

4 Quarta lezione: Spazi di Banach e funzionali lineari. Spazio duale 4 Quarta lezione: Spazi di Banach e funzionali lineari. Spazio duale Spazi Metrici Ricordiamo che uno spazio metrico è una coppia (X, d) dove X è un insieme e d : X X [0, + [ è una funzione, detta metrica,

Dettagli

+ / operatori di confronto (espressioni logiche/predicati) / + 5 3 9 = > < Pseudo codice. Pseudo codice

+ / operatori di confronto (espressioni logiche/predicati) / + 5 3 9 = > < Pseudo codice. Pseudo codice Pseudo codice Pseudo codice Paolo Bison Fondamenti di Informatica A.A. 2006/07 Università di Padova linguaggio testuale mix di linguaggio naturale ed elementi linguistici con sintassi ben definita e semantica

Dettagli

INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI

INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI INTRODUZIONE AGLI ALGORITMI Prima di riuscire a scrivere un programma, abbiamo bisogno di conoscere un metodo risolutivo, cioè un metodo che a partire dai dati di ingresso fornisce i risultati attesi.

Dettagli

AA 2006-07 LA RICORSIONE

AA 2006-07 LA RICORSIONE PROGRAMMAZIONE AA 2006-07 LA RICORSIONE AA 2006-07 Prof.ssa A. Lanza - DIB 1/18 LA RICORSIONE Il concetto di ricorsione nasce dalla matematica Una funzione matematica è definita ricorsivamente quando nella

Dettagli

iovanella@disp.uniroma2.it http://www.disp.uniroma2.it/users/iovanella Verifica di ipotesi

iovanella@disp.uniroma2.it http://www.disp.uniroma2.it/users/iovanella Verifica di ipotesi iovanella@disp.uniroma2.it http://www.disp.uniroma2.it/users/iovanella Verifica di ipotesi Idea di base Supponiamo di avere un idea del valore (incognito) di una media di un campione, magari attraverso

Dettagli

Iniziamo con un esercizio sul massimo comun divisore: Esercizio 1. Sia d = G.C.D.(a, b), allora:

Iniziamo con un esercizio sul massimo comun divisore: Esercizio 1. Sia d = G.C.D.(a, b), allora: Iniziamo con un esercizio sul massimo comun divisore: Esercizio 1. Sia d = G.C.D.(a, b), allora: G.C.D.( a d, b d ) = 1 Sono state introdotte a lezione due definizioni importanti che ricordiamo: Definizione

Dettagli

Informatica Applicata

Informatica Applicata Ing. Irina Trubitsyna Concetti Introduttivi Programma del corso Obiettivi: Il corso di illustra i principi fondamentali della programmazione con riferimento al linguaggio C. In particolare privilegia gli

Dettagli

EQUAZIONI non LINEARI

EQUAZIONI non LINEARI EQUAZIONI non LINEARI Francesca Pelosi Dipartimento di Matematica, Università di Roma Tor Vergata CALCOLO NUMERICO e PROGRAMMAZIONE http://www.mat.uniroma2.it/ pelosi/ EQUAZIONI non LINEARI p.1/44 EQUAZIONI

Dettagli

Andiamo più a fondo nella conoscenza del Sistema Solare

Andiamo più a fondo nella conoscenza del Sistema Solare Andiamo più a fondo nella conoscenza del Sistema Solare Come abbiamo visto nelle pagine precedenti il Sistema Solare è un insieme di molti corpi celesti, diversi fra loro. La sua forma complessiva è quella

Dettagli

Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN)

Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN) Estensione di un servizo di messaggistica per telefonia mobile (per una società di agenti TuCSoN) System Overview di Mattia Bargellini 1 CAPITOLO 1 1.1 Introduzione Il seguente progetto intende estendere

Dettagli

Rapida Introduzione all uso del Matlab Ottobre 2002

Rapida Introduzione all uso del Matlab Ottobre 2002 Rapida Introduzione all uso del Matlab Ottobre 2002 Tutti i tipi di dato utilizzati dal Matlab sono in forma di array. I vettori sono array monodimensionali, e così possono essere viste le serie temporali,

Dettagli

La dinamica delle collisioni

La dinamica delle collisioni La dinamica delle collisioni Un video: clic Un altro video: clic Analisi di un crash test (I) I filmati delle prove d impatto distruttive degli autoveicoli, dato l elevato numero dei fotogrammi al secondo,

Dettagli

Introduzione ad Access

Introduzione ad Access Introduzione ad Access Luca Bortolussi Dipartimento di Matematica e Informatica Università degli studi di Trieste Access E un programma di gestione di database (DBMS) Access offre: un supporto transazionale

Dettagli

Processi (di sviluppo del) software. Fase di Analisi dei Requisiti. Esempi di Feature e Requisiti. Progettazione ed implementazione

Processi (di sviluppo del) software. Fase di Analisi dei Requisiti. Esempi di Feature e Requisiti. Progettazione ed implementazione Processi (di sviluppo del) software Fase di Analisi dei Requisiti Un processo software descrive le attività (o task) necessarie allo sviluppo di un prodotto software e come queste attività sono collegate

Dettagli

RAPPRESENTAZIONE BINARIA DEI NUMERI. Andrea Bobbio Anno Accademico 1996-1997

RAPPRESENTAZIONE BINARIA DEI NUMERI. Andrea Bobbio Anno Accademico 1996-1997 1 RAPPRESENTAZIONE BINARIA DEI NUMERI Andrea Bobbio Anno Accademico 1996-1997 Numeri Binari 2 Sistemi di Numerazione Il valore di un numero può essere espresso con diverse rappresentazioni. non posizionali:

Dettagli

Ricerca non informata in uno spazio di stati

Ricerca non informata in uno spazio di stati Università di Bergamo Facoltà di Ingegneria Intelligenza Artificiale Paolo Salvaneschi A5_2 V2.4 Ricerca non informata in uno spazio di stati Il contenuto del documento è liberamente utilizzabile dagli

Dettagli

Dati importati/esportati

Dati importati/esportati Dati importati/esportati Dati importati Al workspace MATLAB script Dati esportati file 1 File di testo (.txt) Spreadsheet Database Altro Elaborazione dati Grafici File di testo Relazioni Codice Database

Dettagli

Così come le macchine meccaniche trasformano

Così come le macchine meccaniche trasformano DENTRO LA SCATOLA Rubrica a cura di Fabio A. Schreiber Il Consiglio Scientifico della rivista ha pensato di attuare un iniziativa culturalmente utile presentando in ogni numero di Mondo Digitale un argomento

Dettagli

C è solo un acca tra pi e phi ing. Rosario Turco, prof. Maria Colonnese

C è solo un acca tra pi e phi ing. Rosario Turco, prof. Maria Colonnese C è solo un acca tra pi e phi ing. Rosario Turco, prof. Maria Colonnese Introduzione Nell articolo vengono mostrate vari possibili legami tra la costante di Archimede (pi greco) e la sezione aurea (phi).

Dettagli

Cenni su algoritmi, diagrammi di flusso, strutture di controllo

Cenni su algoritmi, diagrammi di flusso, strutture di controllo Cenni su algoritmi, diagrammi di flusso, strutture di controllo Algoritmo Spesso, nel nostro vivere quotidiano, ci troviamo nella necessità di risolvere problemi. La descrizione della successione di operazioni

Dettagli

Gli algoritmi. Gli algoritmi. Analisi e programmazione

Gli algoritmi. Gli algoritmi. Analisi e programmazione Gli algoritmi Analisi e programmazione Gli algoritmi Proprietà ed esempi Costanti e variabili, assegnazione, istruzioni, proposizioni e predicati Vettori e matrici I diagrammi a blocchi Analisi strutturata

Dettagli

Manipolazione di testi: espressioni regolari

Manipolazione di testi: espressioni regolari Manipolazione di testi: espressioni regolari Un meccanismo per specificare un pattern, che, di fatto, è la rappresentazione sintetica di un insieme (eventualmente infinito) di stringhe: il pattern viene

Dettagli

Esercizi Capitolo 5 - Alberi

Esercizi Capitolo 5 - Alberi Esercizi Capitolo 5 - Alberi Alberto Montresor 19 Agosto, 2014 Alcuni degli esercizi che seguono sono associati alle rispettive soluzioni. Se il vostro lettore PDF lo consente, è possibile saltare alle

Dettagli

Capitolo 9: PROPAGAZIONE DEGLI ERRORI

Capitolo 9: PROPAGAZIONE DEGLI ERRORI Capitolo 9: PROPAGAZIOE DEGLI ERRORI 9.1 Propagazione degli errori massimi ella maggior parte dei casi le grandezze fisiche vengono misurate per via indiretta. Il valore della grandezza viene cioè dedotto

Dettagli

METODO DEI MINIMI QUADRATI. Quest articolo discende soprattutto dai lavori di Deming, Press et al. (Numerical Recipes) e Jefferys.

METODO DEI MINIMI QUADRATI. Quest articolo discende soprattutto dai lavori di Deming, Press et al. (Numerical Recipes) e Jefferys. METODO DEI MINIMI QUADRATI GIUSEPPE GIUDICE Sommario Il metodo dei minimi quadrati è trattato in tutti i testi di statistica e di elaborazione dei dati sperimentali, ma non sempre col rigore necessario

Dettagli

9. Urti e conservazione della quantità di moto.

9. Urti e conservazione della quantità di moto. 9. Urti e conservazione della quantità di moto. 1 Conservazione dell impulso m1 v1 v2 m2 Prima Consideriamo due punti materiali di massa m 1 e m 2 che si muovono in una dimensione. Supponiamo che i due

Dettagli

Principal Component Analysis (PCA)

Principal Component Analysis (PCA) Principal Component Analysis (PCA) Come evidenziare l informazione contenuta nei dati S. Marsili-Libelli: Calibrazione di Modelli Dinamici pag. Perche PCA? E un semplice metodo non-parametrico per estrarre

Dettagli

Da una a più variabili: derivate

Da una a più variabili: derivate Da una a più variabili: derivate ( ) 5 gennaio 2011 Scopo di questo articolo è di evidenziare le analogie e le differenze, relativamente al calcolo differenziale, fra le funzioni di una variabile reale

Dettagli

Semantica operazionale dei linguaggi di Programmazione

Semantica operazionale dei linguaggi di Programmazione Semantica operazionale dei linguaggi di Programmazione Oggetti sintattici e oggetti semantici Rosario Culmone, Luca Tesei Lucidi tratti dalla dispensa Elementi di Semantica Operazionale R. Barbuti, P.

Dettagli

Il ciclo di vita del software

Il ciclo di vita del software Il ciclo di vita del software Il ciclo di vita del software Definisce un modello per il software, dalla sua concezione iniziale fino al suo sviluppo completo, al suo rilascio, alla sua successiva evoluzione,

Dettagli

Appunti di Logica Matematica

Appunti di Logica Matematica Appunti di Logica Matematica Francesco Bottacin 1 Logica Proposizionale Una proposizione è un affermazione che esprime un valore di verità, cioè una affermazione che è VERA oppure FALSA. Ad esempio: 5

Dettagli

Modal 2 Modulo Analisi modale Modulo per l Analisi della dinamica strutturale.

Modal 2 Modulo Analisi modale Modulo per l Analisi della dinamica strutturale. Modal 2 Modulo Analisi modale Modulo per l Analisi della dinamica strutturale. L analisi modale è un approccio molto efficace al comportamento dinamico delle strutture, alla verifica di modelli di calcolo

Dettagli

PROBABILITA, VALORE ATTESO E VARIANZA DELLE QUANTITÁ ALEATORIE E LORO RELAZIONE CON I DATI OSSERVATI

PROBABILITA, VALORE ATTESO E VARIANZA DELLE QUANTITÁ ALEATORIE E LORO RELAZIONE CON I DATI OSSERVATI statistica, Università Cattaneo-Liuc, AA 006-007, lezione del 08.05.07 IDICE (lezione 08.05.07 PROBABILITA, VALORE ATTESO E VARIAZA DELLE QUATITÁ ALEATORIE E LORO RELAZIOE CO I DATI OSSERVATI 3.1 Valore

Dettagli

Il giardino nella macchina

Il giardino nella macchina Idee per una rilettura Il giardino nella macchina La nuova scienza della vita artificiale Claus Emmeche Bollati Boringhieri, 1996 È possibile la vita artificiale? In che modo gli strumenti offerti dalla

Dettagli

Analisi dei requisiti e casi d uso

Analisi dei requisiti e casi d uso Analisi dei requisiti e casi d uso Indice 1 Introduzione 2 1.1 Terminologia........................... 2 2 Modello della Web Application 5 3 Struttura della web Application 6 4 Casi di utilizzo della Web

Dettagli

APPUNTI DI MATEMATICA LE DISEQUAZIONI NON LINEARI

APPUNTI DI MATEMATICA LE DISEQUAZIONI NON LINEARI APPUNTI DI MATEMATICA LE DISEQUAZIONI NON LINEARI Le disequazioni fratte Le disequazioni di secondo grado I sistemi di disequazioni Alessandro Bocconi Indice 1 Le disequazioni non lineari 2 1.1 Introduzione.........................................

Dettagli

Elementi di informatica

Elementi di informatica Elementi di informatica Sistemi di numerazione posizionali Rappresentazione dei numeri Rappresentazione dei numeri nei calcolatori rappresentazioni finalizzate ad algoritmi efficienti per le operazioni

Dettagli

Numeri reali. Funzioni e loro grafici

Numeri reali. Funzioni e loro grafici Argomento Numeri reali. Funzioni e loro grafici Parte B - Funzioni e loro grafici Funzioni reali di variabile reale Definizioni. Supponiamo che A sia un sottoinsieme di R e che esista una legge che ad

Dettagli

Zeroshell come client OpenVPN

Zeroshell come client OpenVPN Zeroshell come client OpenVPN (di un server OpenVpn Linux) Le funzionalità di stabilire connessioni VPN di Zeroshell vede come scenario solito Zeroshell sia come client sia come server e per scelta architetturale,

Dettagli

Esponenziali elogaritmi

Esponenziali elogaritmi Esponenziali elogaritmi Potenze ad esponente reale Ricordiamo che per un qualsiasi numero razionale m n prendere n>0) si pone a m n = n a m (in cui si può sempre a patto che a sia un numero reale positivo.

Dettagli

Algebra Relazionale. algebra relazionale

Algebra Relazionale. algebra relazionale Algebra Relazionale algebra relazionale Linguaggi di Interrogazione linguaggi formali Algebra relazionale Calcolo relazionale Programmazione logica linguaggi programmativi SQL: Structured Query Language

Dettagli

Studente: SANTORO MC. Matricola : 528

Studente: SANTORO MC. Matricola : 528 CORSO di LAUREA in INFORMATICA Corso di CALCOLO NUMERICO a.a. 2004-05 Studente: SANTORO MC. Matricola : 528 PROGETTO PER L ESAME 1. Sviluppare una versione dell algoritmo di Gauss per sistemi con matrice

Dettagli

if t>=0 x=1; else x=0; end fornisce, nella variabile x, il valore della funzione gradino a tempi continui, calcolata in t.

if t>=0 x=1; else x=0; end fornisce, nella variabile x, il valore della funzione gradino a tempi continui, calcolata in t. Il programma MATLAB In queste pagine si introduce in maniera molto breve il programma di simulazione MAT- LAB (una abbreviazione di MATrix LABoratory). Introduzione MATLAB è un programma interattivo di

Dettagli

RELAZIONE TRA VARIABILI QUANTITATIVE. Lezione 7 a. Accade spesso nella ricerca in campo biomedico, così come in altri campi della

RELAZIONE TRA VARIABILI QUANTITATIVE. Lezione 7 a. Accade spesso nella ricerca in campo biomedico, così come in altri campi della RELAZIONE TRA VARIABILI QUANTITATIVE Lezione 7 a Accade spesso nella ricerca in campo biomedico, così come in altri campi della scienza, di voler studiare come il variare di una o più variabili (variabili

Dettagli

Esercitazioni su rappresentazione dei numeri e aritmetica dei calcolatori"

Esercitazioni su rappresentazione dei numeri e aritmetica dei calcolatori Esercitazioni su rappresentazione dei numeri e aritmetica dei calcolatori" slide a cura di Salvatore Orlando & Marta Simeoni " Architettura degli Elaboratori 1 Interi unsigned in base 2" Si utilizza un

Dettagli

Gi-Gi Art. 859 - User's Guide Istruzioni d'uso

Gi-Gi Art. 859 - User's Guide Istruzioni d'uso doc.4.12-06/03 Gi-Gi Art. 859 - User's Guide Istruzioni d'uso A belaying plate that can be used in many different conditions Una piastrina d'assicurazione che può essere utilizzata in condizioni diverse.

Dettagli

PET. Radionuclidi più utilizzati nella PET. Elemento prodotto T 1/2 in minuti primi B5 20 C6 10 N7 2 F 9 O8 110

PET. Radionuclidi più utilizzati nella PET. Elemento prodotto T 1/2 in minuti primi B5 20 C6 10 N7 2 F 9 O8 110 PET L acronimo PET sta per Positron Emission Tomography. Come per la SPECT, anche in questo caso si ha a che fare con una tecnica tomografica d indagine di tipo emissivo in quanto la sorgente di radiazione

Dettagli

I.Stat Guida utente Versione 1.7 Dicembre 2010

I.Stat Guida utente Versione 1.7 Dicembre 2010 I.Stat Guida utente Versione 1.7 Dicembre 2010 1 Sommario INTRODUZIONE 3 I concetti principali di I.Stat 4 Organizzazione dei dati 4 Ricerca 5 GUIDA UTENTE 6 Per iniziare 6 Selezione della lingua 7 Individuazione

Dettagli

Analisi dei requisiti e casi d uso

Analisi dei requisiti e casi d uso Analisi dei requisiti e casi d uso Indice 1 Introduzione 2 1.1 Terminologia........................... 2 2 Modello del sistema 4 2.1 Requisiti hardware........................ 4 2.2 Requisiti software.........................

Dettagli

Guida rapida all uso di ECM Titanium

Guida rapida all uso di ECM Titanium Guida rapida all uso di ECM Titanium Introduzione Questa guida contiene una spiegazione semplificata del funzionamento del software per Chiputilizzare al meglio il Tuning ECM Titanium ed include tutte

Dettagli

CAPITOLO PRIMO IL CONCETTO DI ALGORITMO 1

CAPITOLO PRIMO IL CONCETTO DI ALGORITMO 1 1.1 Che cos è un algoritmo CAPITOLO PRIMO IL CONCETTO DI ALGORITMO 1 Gli algoritmi sono metodi per la soluzione di problemi. Possiamo caratterizzare un problema mediante i dati di cui si dispone all inizio

Dettagli

19. Inclusioni tra spazi L p.

19. Inclusioni tra spazi L p. 19. Inclusioni tra spazi L p. Nel n. 15.1 abbiamo provato (Teorema 15.1.1) che, se la misura µ è finita, allora tra i corispondenti spazi L p (µ) si hanno le seguenti inclusioni: ( ) p, r ]0, + [ : p

Dettagli

Evoluzione Risk Management in Intesa

Evoluzione Risk Management in Intesa RISCHIO DI CREDITO IN BANCA INTESA Marco Bee, Mauro Senati NEWFIN - FITD Rating interni e controllo del rischio di credito Milano, 31 Marzo 2004 Evoluzione Risk Management in Intesa 1994: focus iniziale

Dettagli

Lezione su Informatica di Base

Lezione su Informatica di Base Lezione su Informatica di Base Esplora Risorse, Gestione Cartelle, Alcuni tasti di scelta Rapida Domenico Capano D.C. Viterbo: Lunedì 21 Novembre 2005 Indice Una nota su questa lezione...4 Introduzione:

Dettagli

LA FUNZIONE ESPONENZIALE E IL LOGARITMO

LA FUNZIONE ESPONENZIALE E IL LOGARITMO LA FUNZIONE ESPONENZIALE E IL LOGARITMO APPUNTI PER IL CORSO DI ANALISI MATEMATICA I G. MAUCERI Indice 1. Introduzione 1 2. La funzione esponenziale 2 3. Il numero e di Nepero 9 4. L irrazionalità di e

Dettagli

Presentazioni multimediali relative al senso del tatto DIMENSIONI LIVELLO INIZIALE LIVELLO INTERMEDIO LIVELLO AVANZATO

Presentazioni multimediali relative al senso del tatto DIMENSIONI LIVELLO INIZIALE LIVELLO INTERMEDIO LIVELLO AVANZATO PERCORSO DI INSEGNAMENTO/APPRENDIMENTO TIPO DI UdP: SEMPLICE (monodisciplinare) ARTICOLATO (pluridisciplinare) Progetto didattico N. 1 Titolo : Let s investigate the world with our touch! Durata: Annuale

Dettagli

Nota su Crescita e Convergenza

Nota su Crescita e Convergenza Nota su Crescita e Convergenza S. Modica 28 Ottobre 2007 Nella prima sezione si considerano crescita lineare ed esponenziale e le loro proprietà elementari. Nella seconda sezione si spiega la misura di

Dettagli

Per lo svolgimento del corso risulta particolarmente utile considerare l insieme

Per lo svolgimento del corso risulta particolarmente utile considerare l insieme 1. L insieme R. Per lo svolgimento del corso risulta particolarmente utile considerare l insieme R = R {, + }, detto anche retta reale estesa, che si ottiene aggiungendo all insieme dei numeri reali R

Dettagli

Ricapitoliamo. Ricapitoliamo

Ricapitoliamo. Ricapitoliamo Ricapitoliamo Finora ci siamo concentrati sui processi computazionali e sul ruolo che giocano le procedure nella progettazione dei programmi In particolare, abbiamo visto: Come usare dati primitivi (numeri)

Dettagli

1 Alcuni criteri di convergenza per serie a termini non negativi

1 Alcuni criteri di convergenza per serie a termini non negativi Alcuni criteri di convergenza per serie a termini non negativi (Criterio del rapporto.) Consideriamo la serie a (.) a termini positivi (ossia a > 0, =, 2,...). Supponiamo che esista il seguente ite a +

Dettagli

Architetture CISC e RISC

Architetture CISC e RISC FONDAMENTI DI INFORMATICA Prof. PIER LUCA MONTESSORO Facoltà di Ingegneria Università degli Studi di Udine Architetture CISC e RISC 2000 Pier Luca Montessoro (si veda la nota di copyright alla slide n.

Dettagli

NUMERI RAZIONALI E REALI

NUMERI RAZIONALI E REALI NUMERI RAZIONALI E REALI CARLANGELO LIVERANI. Numeri Razionali Tutti sanno che i numeri razionali sono numeri del tio q con N e q N. Purtuttavia molte frazioni ossono corrisondere allo stesso numero, er

Dettagli

1. Intorni di un punto. Punti di accumulazione.

1. Intorni di un punto. Punti di accumulazione. 1. Intorni di un punto. Punti di accumulazione. 1.1. Intorni circolari. Assumiamo come distanza di due numeri reali x e y il numero non negativo x y (che, come sappiamo, esprime la distanza tra i punti

Dettagli

Università degli Studi di Parma. Facoltà di Scienze MM. FF. NN. Corso di Laurea in Informatica

Università degli Studi di Parma. Facoltà di Scienze MM. FF. NN. Corso di Laurea in Informatica Università degli Studi di Parma Facoltà di Scienze MM. FF. NN. Corso di Laurea in Informatica A.A. 2007-08 CORSO DI INGEGNERIA DEL SOFTWARE Prof. Giulio Destri http://www.areasp.com (C) 2007 AreaSP for

Dettagli

Analisi statistica di dati biomedici Analysis of biologicalsignals

Analisi statistica di dati biomedici Analysis of biologicalsignals Analisi statistica di dati biomedici Analysis of biologicalsignals II Parte Verifica delle ipotesi (a) Agostino Accardo (accardo@units.it) Master in Ingegneria Clinica LM in Neuroscienze 2013-2014 e segg.

Dettagli

Entrate... 11 Uscite... 11 Trasferimento... 11 Movimenti ricorrenti... 11 Movimenti suddivisi... 12

Entrate... 11 Uscite... 11 Trasferimento... 11 Movimenti ricorrenti... 11 Movimenti suddivisi... 12 Data ultima revisione del presente documento: domenica 8 maggio 2011 Indice Sommario Descrizione prodotto.... 3 Licenza e assunzione di responsabilità utente finale:... 4 Prerequisiti:... 5 Sistema Operativo:...

Dettagli

Limiti e continuità di funzioni reali di una variabile

Limiti e continuità di funzioni reali di una variabile di funzioni reali di una variabile Corso di Analisi Matematica - capitolo VI Facoltà di Economia, UER Maria Caterina Bramati Université Libre de Bruxelles ECARES 22 Novembre 2006 Intuizione di ite di funzione

Dettagli

Programmazione Funzionale

Programmazione Funzionale Programmazione Funzionale LP imperativi: apparenza simile modello di progettazione = macchina fisica Famiglia dei LP imperativi = progressivo miglioramento del FORTRAN Obiezione: pesante aderenza dei LP

Dettagli

Richiami: funzione di trasferimento e risposta al gradino

Richiami: funzione di trasferimento e risposta al gradino Richiami: funzione di trasferimento e risposta al gradino 1 Funzione di trasferimento La funzione di trasferimento di un sistema lineare è il rapporto di due polinomi della variabile complessa s. Essa

Dettagli