Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Lezione 2: Allineamento di sequenze. BLAST e CLUSTALW"

Transcript

1 Lezione 2: Allineamento di sequenze BLAST e CLUSTALW

2 Allineamento di sequenze

3 Allineamenti L avvento della genomica moderna permette di analizzare le similitudini e le differenze tra organismi a livello del loro DNA e del loro corredo proteico completo ( informazioni evolutive, sequenze funzionali conservate, omologia tra geni ). Parallelamente, una attività comune in biologia è, data una sequenza di acidi nucleici o proteine di interesse sperimentale, di trovare sequenze simili all interno di gruppi di altre sequenze note. Molte di queste attività si possono ricondurre al problema di trovare o meno similarità tra sequenze di DNA o di amminoacidi. Ovvero, in generale, data una sequenza A (di DNA o amminoacidi) detta query e una sequenza B detta target, di allineare le due sequenze ovvero appaiare le loro singole componenti in modo da evidenziarne le zone somiglianti e quelle differenti.

4 Allineamenti Data una sequenza (DNA/proteina), ci sono oggetti simili in un certo database oppure ci sono somiglianze con altre sequenze che mi interessano? Ho trovato un nuovo gene o proteina? Un certo gene ha somiglianze con qualche altro gene nella stessa specie o in altre specie? Come posso trovare le regione di sovrapposizione tra sequenze? Come posso studiare l evoluzione di genomi di popolazioni o specie? Come posso trovare informazioni sul tipo di fold, sulla famiglia, sulla funzione di una certa proteina? allineamento di sequenze

5 Allineamenti Un tipico risultato di una procedura di allineamento è il seguente: Conservation in GABPA promoter region reveals functional Err-α motif. Asterisks denote conserved bases. The yellow box marks the experimentally validated Err- α binding site. Xie et al., Nature 2005

6 Allineamenti L operazione di allineamento però non è banale da realizzare. Allineare trovare le corrispondenze, posizione per posizione, tra due o più sequenze. A priori, ci sono molti modi di allineare due sequenze. Supponiamo di voler allineare le due sequenze di DNA ACGTCTAG ed ACTCTAG: DOMANDA: Quale è l allineamento (statisticamente) migliore?

7 Allineamenti Oppure supponiamo di voler allineare la sequenza TCTAG con una sequenza di DNA molto lunga: se partiamo da una sequenza abbastanza piccola e la vogliamo allineare con una sequenza abbastanza lunga, potremmo sempre ottenere un accordo perfetto tra elementi appaiati delle due stringhe se permettiamo un numero arbitrario di gaps. DOMANDA: Ma quale di questi allineamenti è quello (statisticamente) più significativo?

8 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di proteomica del corso). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

9 Allineamenti Concentrandosi all inizio sul problema di allineare coppie di sequenze, possiamo distinguere tra: - allineamento globale si cercano similarità sull intera - allineamento locale sequenza si cercano corte regioni ad alta similarità comprese dentro le sequenze di partenza Gli algoritmi e i metodi di allineamento sono simili, ma non uguali tra sequenze di DNA e proteine (escluse ulteriori considerazioni strutturali: cfr parte di Zamma). Ad ogni procedura di allineamento corrisponde in generale un significato dal punto di vista evolutivo. Ad esempio, le inserzioni / delezioni / gaps degli esempi precedenti che significato biologico potrebbero avere?

10 Toy example Vogliamo allineare la sequenza WHAT con la sequenza WHY. Vogliamo in oltre determinare l allineamento più significativo. Per fare questo, costruiamo delle regole per costruire ogni possibile allineamento e per assegnare un punteggio (score) ad ognuno di essi. regola (algoritmo) per costruire tutti i possibili allineamenti regola (algoritmo) per assegnare uno score S ad ogni allineamento prendere l allineamento con score massimo Regole ad es: Allineamento ad es:

11 Toy example Più in generale: costruzione della matrice di allineamento della sequenza WHAT con la sequenza WHY: La matrice descrive tutti i possibili allineamenti della sequenza target con la sequenza query. Un particolare allineamento è un percorso nella matrice.

12 Toy example Ogni passo da un elemento della matrice ad una altro corrisponde ad uno spostamento su un nuovo elemento di una od entrambe le sequenze. Ad ogni passo, possiamo scrivere nell elemento di matrice lo score fino a quel punto. Il migliore allineamento è il percorso che genera lo score più alto, arrivando in basso a destra nella matrice, ovvero avendo usato tutte le lettere a disposizione di query e di target (allineamento globale).

13 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

14 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

15 Toy example 1) 2) Con queste regole la matrice di allineamento completa per il nostro esempio WHAT / WHY è:

16 Allineamento globale: formalismi In generale un allineamento globale si può scrivere come: - date due sequenze A e B di simboli, non necessariamente della stessa lunghezza ma scritte nello stesso alfabeto Scrivere una successione del tipo: le sequenze sono allineate secondo la loro lunghezza. Si inseriscono gaps se hanno lunghezze diverse. Needleman e Wunsch (1970)

17 Allineamento globale: formalismi In particolare: se le lettere ai e bj allineate sono uguale si ha una identity, altrimenti si ha un mismach. Se devo allungare l allineamento ho un indel. Lo score per aver allineato le prime i lettere di A con le prime j lettere di B è: Calcolato in maniera ricorsiva a partire da:

18 Allineamento locale Proteine con la stessa funzione possono presentare degli allineamenti di sequenza reciproci poco significativi, a causa di piccole zone di similarità racchiuse dentro zone di apparente forte diversità e/o lunghezze molto diverse. In questo casi è preferibile cercare degli allineamenti locali, cioe corti allineamenti contenuti all interno delle sequenze più lunghe (Smith e Waterman, 1981). La tecnica per calcolare allineamenti locali è sempre basata sulla costruzione di una matrice di allineamento, e cercando poi il percorso con lo score più alto. Solo che nel caso dell allineamento locale: il percorso migliore attraverserà solo parte della matrice non c è richiesta di allineare le stringhe agli estremi.

19 Allineamento locale: esempio Trovare il migliore allineamento locale e il massimo score di allineamento date le due sequenze A =ACCTAAGG e B = GGCTCAATCA.

20 Numero dei possibili allineamenti globali Date due sequenze di lunghezza m ed n per calcolarne il migliore allineamento globale, abbiamo calcolato 3 score per andare in (n-1)(m-1) celle e poi prenderne il massimo quindi circa 4mn operazioni un singolo allineamento globale è una operazione di classe O(mn). Ma quanti sono i possibili allineamenti globali? Se supponiamo per semplicità che m ~ n è possibile dimostrare che: Questo numero è gigantesco!!!!

21 Numero dei possibili allineamenti globali Supponiamo ad esempio di avere: Supponiamo ad esempio di avere: Il Sole pesa circa 1.99 x 1033 grammi. Ogni grammo contiene circa 12 x tra protoni, elettroni e neutroni, per cui il Sole contiene circa 24 x particelle elementari. ci vorrebbero 400 stelle come il Sole per contenere tante particelle elementari quanti sono gli allineamenti di due sequenze di 100 caratteri.

22 Regole di scoring (DNA) Lo scoring delle singole mosse in un allineamento deve essere fissato all inizio una volta per tutte in una scoring matrix una scelta precisa di un modello evolutivo per il nostro allineamento. Nei casi precedenti, le regole di scoring usate si possono riassumere in:

23 Regole di scoring (DNA) Sono però possibili scelte diverse. Studi di mutazioni su geni omologhi hanno indicato che le transizioni (A G, G A, C T, or T C) capitano in media con una frequenza doppia delle transversioni (A T, T A, A C, G T, etc). Quindi un modello di allineamento più sensato potrebbe utilizzare degli scores diversi per transizioni o per transversioni (e.s. sequenze simili hanno la tendenza ad avere transizioni, per cui il loro peso statistico dovrebbe essere inferiore). Una scoring matrix più realistica allora potrebbe essere:

24 Regole di scoring (DNA) Analogamente sorge il problema di come esattamente valutare lo scoring dei gaps (successioni di indels). Fino ad adesso abbiamo usato la regola semplice: come score per un gap di lunghezza k. Tuttavia è noto, per esempio che i gaps appaiono più facilmente in successione che isolati (cfr. biochimica). Inoltre, come altro esempio, delezioni di uno o due nucleotidi in regioni protein-coding in genere sono estremamente dannosi, mentre delezioni o inserzioni di gruppi di 3 nucleotidi lo sono di meno (frameshift). Un approccio potrebbe essere allora usare una regola del tipo: che ha l effetto di avere una alta penalità per aprire un primo gap α e una penalità inferiore per allargare un gap (-β per ogni base in più nel gap, con α < β).

25 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

26 Regole di scoring (proteine) Per gli amminoacidi le regole di accoppiamento sono più complesse: Nucleotidi: identità AGGCTGACCTGGGAAGGGAAACTCTCAAAACCAT AGGATGAGCT-GGAAGGATA-CTCTCAAAAACAT *** *** ** ******* ** ******** *** Amminoacidi: identità + somiglianza VLSSADKTNVKAAWGKVGAHAGEYGAEALERMFL VLSAADKANIKAAW-KVGGQAGDHGAEALERMPL ***:*** *:**** ***: **: ******** *

27 Regole di scoring (proteine) Le scoring matrix degli amminoacidi sono più complesse di quelle per i nucleotidi. Sono delle tabelle che danno per ciascuna coppia di aa, un valore che indica il loro grado di similarità (informazione sulla probabilità che un aa si sostitutisca ad un altro durante l evoluzione). Si ottengono con metodi statistici assegnando a ciascuna coppia un valore che riflette la frequenza con cui l uno si sostituisce all altro in famiglie di proteine omologhe. Di solito si utilizzano due tipi di matrici: 1) Matrici PAM 2) Matrici BLOSUM

28 Regole di scoring (proteine) Matrici PAM (Point Accepted Mutation) (M. Dayhoff 1978) Due sequenze sono definite ad 1PAM di distanza se per convertire l una nell altra, c è stata in media 1 mutazione accettata ogni 100 aa. Accettata = non ha cambiato la funzione della proteina o comunque non è stata letale per l organismo Per ottenere i valori da inserire nella matrice si utilizzano inizialmente sequenze molto simili: Poi da questi valori si estrapolano le frequenze attese per seq. più divergenti. Utilizzando tante coppie di sequenze ad 1 PAM di distanza, ci aspettiamo solo l 1% di differenze: a questo punto ricaviamo le frequenze di sostituzione attese di ciascuna coppia di aa. Abbiamo così costruito la matrice PAM1.

29 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

30 Regole di scoring (proteine) Se due sequenze sono filogeneticamente distanti è opportuno usare matrici PAM con indici più alti, e viceversa. Le matrici PAM si possono costruire in maniera iterativa e classificare: PAM % identità % 99% 75% 60% 50% 25% 20%

31 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

32 Regole di scoring (proteine) Matrici BLOSUM (BLOcks SUbstitution Matrices) (Henikoff and Henikoff 1992) Derivano dalla banca dati BLOCKS contenente gli allineamenti delle regioni più conservate di famiglie di proteine. Blosum6 Per ogni tipo di matrice BLOSUM si eliminano tutte le sequenze2 che hanno una percentuale di identità superiore ad una soglia. BLOSUM62 = derivata da un allineamento in cui le sequenze che abbiano più del 62% di amminoacidi identici vengono considerate come identiche

33 Regole di scoring (proteine) L utilizzo della matrice di similarita appropriata per ciascuna analisi e importante per avere buoni risultati negli allineamenti. poco divergenti molto divergenti BLOSUM80 BLOSUM62 BLOSUM45 PAM1 PAM120 PAM250

34 Allineamenti multipli Una estensione immediata dell allineamento a coppie è quello di estendere la procedura a N > 2 sequenze. GTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC GTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC RIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl RIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl RIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTNN

35 Allineamenti multipli Un allineamento multiplo si costruisce usando in maniera ricorsiva algoritmi simili a quelli usati per gli allineamenti a coppie ancora più calcoli dell allineamento pairwise!!! Si ottengono prima tutti i possibili allineamenti di coppia e si registra il punteggio di ciascuno. Si selezionano le sequenze più simili tra loro formando quindi clusters di sequenze allineate (costituiti da 2 o più sequenze il cui allineamento sia stato precedentemente fissato) Poi si continua aggiungendo le altre sequenze al cluster precedentemente ottenuto e così via fino ad includere tutte le sequenze considerate.

36 BLAST e CLUSTALW

37 Software per allineamenti In pratica, nel momento in cui ho bisogno di eseguire un allineamento di sequenze, ricerco un opportuno software che risolva il mio problema. seq1 seq2 seq DB tool allineamento similarità di sequenza tool lista di proteine simili alla query

38 Software per allineamenti Nella maggioranza dei casi però non avrò a che fare con software che eseguono gli algoritmi di allineamento esatto visti in precedenza, ma con versione euristiche degli stessi maggiore velocità. Es: una tipica ricerca di similarità sul database delle sequenze dell NCBI, richiede l analisi di un numero di sequenze > e che cresce in continuazione in maniera esponenziale.

39 Software per allineamenti Sono state sviluppate moltissime tecniche per incrementare la velocità degli algoritmi di allineamento. Es. di un possibile trucco : scomposizione di query e target in k-mers Supponiamo di aver una stringa di query I Questa può essere separata in una serie di (overlapping) 8-mers: Idea: se ho una sequenza target l assenza di uno qualunque degli 8-mers implica che I # J prima di allineare due sequenze posso esplorare il loro contenuto di k-mers (seeds) e decidere velocemente se le sequenze possono (potenzialmente) essere molto simili. Se sì le allineo, altrimenti continuo.

40 Software per allineamenti Noi faremo esperienza con 2 software per allineamento: BLAST e CLUSTALW

41 BLAST BLAST (Basic Local Alignment and Search Tool) è una suite di programmi sviluppata presso NCBI (Altschul et al., 1990) per l allineamento veloce di una sequenza query con database anche di grandi dimensioni e di identificare target con una precisa significanza statistica. BLAST usa un approccio euristico che approssima l algoritmo di SmithWaterman, dando dei risultati meno accurati ma in media almeno 50 volte più veloci non c'è la sicurezzza di ottenere il migliore allineamento.

42 BLAST The BLAST algorithm is a heuristic search method that seeks words of length W (default = 3 in blastp) that score at least T when aligned with the query and scored with a substitution matrix. Words in the database that score T or greater are extended in both directions in an attempt to fina a locally optimal ungapped alignment or HSP (high scoring pair) with a score of at least S or an E value lower than the specified threshold. HSPs that meet these criteria will be reported by BLAST, provided they do not exceed the cutoff value specified for number of descriptions and/or alignments to report.

43 NCBI BLAST

44 NCBI BLAST

45 NCBI BLAST

46 CLUSTALW

47 CLUSTALW

48 CLUSTALW

49 CLUSTALW

Informatica e biotecnologie II parte

Informatica e biotecnologie II parte Informatica e biotecnologie II parte Analisi di sequenze: allineamenti CGCTTCGGACGAAATCGCATCAGCATACGATCGCATGCCGGGCGGGATAAC CGAAATCGCATCAGCATACGATCGCATGC Bioinformatica La Bioinformatica è una disciplina

Dettagli

Bioinformatica e Biologia Computazionale per la Medicina Molecolare

Bioinformatica e Biologia Computazionale per la Medicina Molecolare Facoltà di Ingegneria dell Informazione Laurea Specialistica e Magistrale in Ingegneria Informatica Facoltà di Ingegneria dei Sistemi Laurea Magistrale in Ingegneria Biomedica Dipartimento di Elettronica

Dettagli

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST

ESERCITAZIONE 3. OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST ESERCITAZIONE 3 OBIETTIVO: Ricerca di omologhe mediante i programmi FASTA e BLAST L'esercitazione prevede l'utilizzo di risorse web per effettuare ricerche di similarità con la proteina GRB2 (growth factor

Dettagli

Riconoscimento e recupero dell informazione per bioinformatica

Riconoscimento e recupero dell informazione per bioinformatica Riconoscimento e recupero dell informazione per bioinformatica Clustering: similarità Manuele Bicego Corso di Laurea in Bioinformatica Dipartimento di Informatica - Università di Verona Definizioni preliminari

Dettagli

Determinare la sequenza del DNA

Determinare la sequenza del DNA Corso di Laurea in Chimica e Tecnologie Farmaceu9che a.a. 2014-2015 Università di Catania Determinare la sequenza del DNA Sequenziamento Sanger, NGS e Bioinforma9ca Stefano Forte Sequenziare significa

Dettagli

Tesi di Laurea di Mauro Baluda matr. 038208

Tesi di Laurea di Mauro Baluda matr. 038208 Università degli Studi di Milano Bicocca Facoltà di Scienze Matematiche Fisiche e Naturali Corso di Laurea in Informatica Algoritmi per l'allineamento di Sequenze Tesi di Laurea di matr. 038208 Relatore:

Dettagli

Una proteina nella rete: Introduzione alla bioinformatica

Una proteina nella rete: Introduzione alla bioinformatica Una proteina nella rete: Introduzione alla bioinformatica L era genomica ha assistito ad una crescita esponenziale delle informazioni biologiche rese disponibili dai progressi nel campo della biologia

Dettagli

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione

Allineamento di sequenze di DNA e proteine: possibilità, limiti ed interpretazione ATTENZIONE: lo sfondo giallo NON riguarda parti più importanti ma evidenzia solo parti di testo (frasi, paragrafi) aggiornate (correzioni, miglioramento dello stile, o aggiunta di note o esempi per chiarire

Dettagli

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà

Bioinformatica (1) Introduzione. Dott. Alessandro Laganà Bioinformatica (1) Introduzione Dott. Alessandro Laganà Dott. Alessandro Laganà Martedi 15.30 16.30 Studio Assegnisti - 1 Piano (Davanti biblioteca) Dipartimento di Matematica e Informatica (Città Universitaria)

Dettagli

Applicazioni biotecnologiche in systems biology

Applicazioni biotecnologiche in systems biology Applicazioni biotecnologiche in systems biology Lezione #6 Dr. Marco Galardini AA 2012/2013 Gene regulation analysis Lezione #6 Dr. Marco Galardini AA 2012/2013 Regolazione genica Elementi molecolari e

Dettagli

4. Ricerca di sequenze in banche dati e allineamento multiplo

4. Ricerca di sequenze in banche dati e allineamento multiplo 4. Ricerca di sequenze in banche dati e allineamento multiplo Collegatevi al sito www.ncbi.nlm.nih.gov/blast. Apparirà una pagina nella quale le versioni di BLAST disponibili sono organizzate in base al

Dettagli

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata

Metodi per la Ricostruzione Filogenetica. Giuliana Allegrucci riproduzione vietata Metodi per la Ricostruzione Filogenetica Ricostruire una filogenesi significa trovare la migliore stima delle relazioni evolutive storiche fra entità tassonomiche usando i dati disponibili. I dati di base

Dettagli

e dei genotipi tossici

e dei genotipi tossici Metodi molecolari l per il riconoscimento dei cianobatteri e dei genotipi tossici Susanna Vichi Dip. Ambiente e Connessa Prevenzione Primaria Istituto Superiore di Sanità, Roma Workshop Sorveglianza delle

Dettagli

3. Confronto tra due sequenze

3. Confronto tra due sequenze 3. Confronto tra due sequenze Esercizio 1: uso di DotLet Il programma DotLet è accessibile dal sito http://myhits.isb-sib.ch/cgi-bin/dotlet, dove può essere utilizzato attraverso un interfaccia utente

Dettagli

Sperimenta il BioLab Attività di Bioinformatica Caccia al gene

Sperimenta il BioLab Attività di Bioinformatica Caccia al gene Sperimenta il BioLab Attività di Bioinformatica Caccia al gene Università degli Studi di Milano Settore Didattico, via Celoria 20, Milano Laboratorio 105 INTRODUZIONE Questa attività pratica ha come scopo

Dettagli

Esercitazioni di Genomica

Esercitazioni di Genomica Esercitazioni di Genomica Bioinformatica ai tempi del NGS, PhD CRIBI Biotechnology Center, University of Padua BMR Genomics srl, Spin-Off Giovanni Birolo, PhD CRIBI Biotechnology Center, University of

Dettagli

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016 Docente: Silvia Fuselli fss@unife.it Possibili testi di riferimento Introduction to Genomics, A.M. Lesk, Oxford Capitoli 1, 3,

Dettagli

Sequence Alignment Algorithms

Sequence Alignment Algorithms Sequence Alignment Algorithms Algoritmi per l Allineamento di Sequenze Relatore: Prof. Giancarlo Mauri Correlatore: Prof. Gianluca Della Vedova Tesi di Laurea di: Mauro Baluda Matricola 038208 Part of

Dettagli

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della struttura secondaria: Minimizzazione dell energia Un

Dettagli

Bioinformatica. Marin Vargas, Sergio Paul

Bioinformatica. Marin Vargas, Sergio Paul Bioinformatica Marin Vargas, Sergio Paul 2013 Wikipedia: La bioinformatica è una disciplina scientifica dedicata alla risoluzione di problemi biologici a livello molecolare con metodi informatici. La bioinformatica

Dettagli

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale.

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale. Homology modelling L omology modeling delle proteine è il tipo di predizione di struttura terziaria più semplice ed affidabile. Viene richiesta soltanto una (o più) sequenze di riferimento su cui modellare

Dettagli

Informatica e biotecnologie I parte

Informatica e biotecnologie I parte Informatica e biotecnologie I parte Banche dati biologiche Bioinformatica La Bioinformatica è una disciplina che affronta con metodiche proprie delle Scienze dell'informazione problemi propri della Biologia.

Dettagli

Le query. Lezione 6 a cura di Maria Novella Mosciatti

Le query. Lezione 6 a cura di Maria Novella Mosciatti Lezione 6 a cura di Maria Novella Mosciatti Le query Le query sono oggetti del DB che consentono di visualizzare, modificare e analizzare i dati in modi diversi. Si possono utilizzare query come origine

Dettagli

La portata del software

La portata del software La portata del software Portata Contesto. In che modo il software in costruzione si inserirà nel sistema, prodotto o contesto aziendale esistente e quali vincoli impone il contesto? Obiettivi relativi

Dettagli

3. Gli algoritmi di ottimizzazione.

3. Gli algoritmi di ottimizzazione. Marcello Salmeri - Progettazione Automatica di Circuiti e Sistemi Elettronici Capitolo 3-3. Gli algoritmi di ottimizzazione. I grafi. La teoria dei grafi è un comodo strumento per la definizione e la formalizzazione

Dettagli

CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE

CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE CAPITOLO 1 INTRODUZIONE ALLE RETI COMPLESSE Negli ultimi anni si è compreso che sistemi anche molto diversi tra loro possono essere efficacemente descritti in termini di cosiddetti "networks" o reti complesse.

Dettagli

Predizione della struttura terziaria

Predizione della struttura terziaria Predizione della struttura terziaria Metodi di predizione La predizione della struttura tridimensionale è di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi

Dettagli

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto La Bioinformatica è una disciplina che si occupa dell applicazione dell informatica nell ambito biologico per consentire lo studio

Dettagli

Lezione 8. DNA sequencing informatics

Lezione 8. DNA sequencing informatics Lezione 8 DNA sequencing informatics Il materiale di questa lezione è contenuto nel libro Next-generation DNA sequencing informatics Edited by Stuart M Brown Disponibile in biblioteca (CHIOSTRO 572.8633

Dettagli

Bioinformatica (3) Banche dati biologiche. Dott. Alessandro Laganà

Bioinformatica (3) Banche dati biologiche. Dott. Alessandro Laganà Bioinformatica (3) Banche dati biologiche Dott. Alessandro Laganà Banche dati biologiche Organismi e sequenze biologiche Rappresentazione digitale dei dati biologici e formati Banche dati generiche: NCBI,

Dettagli

Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA

Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA Laboratorio di Metodologie e Tecnologie Genetiche ESERCITAZIONE DI BIOINFORMATICA Bioinformatica - Scienza interdisciplinare coinvolgente la biologia, l informatica, la matematica e la statistica per l

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione in virgola mobile Problemi connessi all utilizzo di un numero di bit limitato Abbiamo visto quali sono i vantaggi dell utilizzo della rappresentazione in complemento alla base: corrispondenza biunivoca fra rappresentazione

Dettagli

pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA

pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA INDICE pag. Presentazione... IX Ringraziamenti... XXIII Prefazione... XXV Introduzione... 1 Capitolo I IDENTIFICAZIONE GENETICA 1.1. Il concetto d identificazione... 9 1.2. L identificazione nella storia....

Dettagli

Parte 2. Determinante e matrice inversa

Parte 2. Determinante e matrice inversa Parte. Determinante e matrice inversa A. Savo Appunti del Corso di Geometria 013-14 Indice delle sezioni 1 Determinante di una matrice, 1 Teorema di Cramer (caso particolare), 3 3 Determinante di una matrice

Dettagli

Data Alignment and (Geo)Referencing (sometimes Registration process)

Data Alignment and (Geo)Referencing (sometimes Registration process) Data Alignment and (Geo)Referencing (sometimes Registration process) All data aquired from a scan position are refered to an intrinsic reference system (even if more than one scan has been performed) Data

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

ANALISI DEI DATI PER IL MARKETING 2014

ANALISI DEI DATI PER IL MARKETING 2014 ANALISI DEI DATI PER IL MARKETING 2014 Marco Riani mriani@unipr.it http://www.riani.it LA CLASSIFICAZIONE CAP IX, pp.367-457 Problema generale della scienza (Linneo, ) Analisi discriminante Cluster Analysis

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Fondamenti di calcolo booleano

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Fondamenti di calcolo booleano Breve introduzione storica Nel 1854, il prof. Boole pubblica un trattato ormai famosissimo: Le leggi del pensiero. Obiettivo finale del trattato è di far nascere la matematica dell intelletto umano, un

Dettagli

I Modelli della Ricerca Operativa

I Modelli della Ricerca Operativa Capitolo 1 I Modelli della Ricerca Operativa 1.1 L approccio modellistico Il termine modello è di solito usato per indicare una costruzione artificiale realizzata per evidenziare proprietà specifiche di

Dettagli

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori

Corso di Informatica Generale (C. L. Economia e Commercio) Ing. Valerio Lacagnina Rappresentazione dell informazione negli elaboratori Informazione e computer Si può rappresentare l informazione attraverso varie forme: Numeri Testi Suoni Immagini 0001010010100101010 Computer Cerchiamo di capire come tutte queste informazioni possano essere

Dettagli

Programmazione dinamica

Programmazione dinamica Capitolo 6 Programmazione dinamica 6.4 Il problema della distanza di edit tra due stringhe x e y chiede di calcolare il minimo numero di operazioni su singoli caratteri (inserimento, cancellazione e sostituzione)

Dettagli

Tecniche di DM: Link analysis e Association discovery

Tecniche di DM: Link analysis e Association discovery Tecniche di DM: Link analysis e Association discovery Vincenzo Antonio Manganaro vincenzomang@virgilio.it, www.statistica.too.it Indice 1 Architettura di un generico algoritmo di DM. 2 2 Regole di associazione:

Dettagli

Caccia al gene della Fibrosi Cistica

Caccia al gene della Fibrosi Cistica Caccia al gene della Fibrosi Cistica Scenario e simulazione di consulenza genetica Siete un genetista medico e lavorate in un consultorio genetico. Si presenta da voi una coppia che richiede consulenza

Dettagli

Machine Learning -1. Seminari di Sistemi Informatici. F.Sciarrone-Università Roma Tre

Machine Learning -1. Seminari di Sistemi Informatici. F.Sciarrone-Università Roma Tre Machine Learning -1 Seminari di Sistemi Informatici Sommario Problemi di apprendimento Well-Posed Esempi di problemi well-posed Progettazione di un sistema di apprendimento Scelta della Training Experience

Dettagli

Decode NGS data: search for genetic features

Decode NGS data: search for genetic features Decode NGS data: search for genetic features Valeria Michelacci NGS course, June 2015 Blast searches What we are used to: online querying NCBI database for the presence of a sequence of interest ONE SEQUENCE

Dettagli

Sommario della lezione

Sommario della lezione Università degli Studi di Salerno Corso di Algoritmi Prof. Ugo Vaccaro Anno Acc. 2014/15 p. 1/33 Sommario della lezione Ancora sui cammini minimi: Cammini minimi in grafi con archi di costo negativo Algoritmi

Dettagli

Roberta Sinatra. Diploma di Licenza

Roberta Sinatra. Diploma di Licenza UNIVERSITÁ DEGLI STUDI DI CATANIA Scuola Superiore di Catania Roberta Sinatra DISTANZA FILOGENETICA BASATA SULLA COESPRESSIONE DI MOTIVI AMINOACIDICI STATISTICAMENTE SIGNIFICATIVI Diploma di Licenza Relatori:

Dettagli

Sorgenti autorevoli in ambienti hyperlinkati.

Sorgenti autorevoli in ambienti hyperlinkati. Sorgenti autorevoli in ambienti hyperlinkati. La qualità di un metodo di ricerca richiede la valutazione umana dovuta alla soggettività inerente alla nozione di rilevanza. I motori di ricerca correnti,

Dettagli

IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014

IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014 IC MONTE SAN PIETRO Scuola Media Cassani Lusvardi INGLESE- Prof.ssa Vanessa Cortello PROGRAMMAZIONE a.s. 2013-2014 CLASSE:Prima B LIBRI DI TESTO: Bowen, Delaney High Spirits Starter Book e High Spirits

Dettagli

LABORATORIO. 2 Lezioni su Basi di Dati Contatti:

LABORATORIO. 2 Lezioni su Basi di Dati Contatti: PRINCIPI DI INFORMATICA CORSO DI LAUREA IN SCIENZE BIOLOGICHE Gennaro Cordasco e Rosario De Chiara {cordasco,dechiara}@dia.unisa.it Dipartimento di Informatica ed Applicazioni R.M. Capocelli Laboratorio

Dettagli

Idee guida. Finite State Machine (1) Un automa a stati finiti è definito da una 5- pla: FSM = , dove: Finite State Machine (2)

Idee guida. Finite State Machine (1) Un automa a stati finiti è definito da una 5- pla: FSM = <Q,,, q0, F>, dove: Finite State Machine (2) Idee guida ASM = FSM con stati generalizzati Le ASM rappresentano la forma matematica di Macchine Astratte che estendono la nozione di Finite State Machine Ground Model (descrizioni formali) Raffinamenti

Dettagli

Analisi filogenetica delle famiglie di proteine omologhe

Analisi filogenetica delle famiglie di proteine omologhe Testo originale in russo http://zbio.net/bio/001/003.html Traduzione a cura di M.T. Carreras http://geneproject.altervista.org/ Analisi filogenetica delle famiglie di proteine omologhe 1. Oggetto di analisi

Dettagli

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee

Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Algoritmo euclideo, massimo comun divisore ed equazioni diofantee Se a e b sono numeri interi, si dice che a divide b, in simboli: a b, se e solo se esiste c Z tale che b = ac. Si può subito notare che:

Dettagli

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani LE MOLECOLE INFORMAZIONALI Lezioni d'autore Treccani Introduzione (I) I pionieri della biologia molecolare, scoperta la struttura degli acidi nucleici, pensarono di associare al DNA una sequenza di simboli,

Dettagli

Carpire il segreto della vita con l informatica Giosuè Lo Bosco Dipartimento di Matematica e Informatica, Università di Palermo, ITALY.

Carpire il segreto della vita con l informatica Giosuè Lo Bosco Dipartimento di Matematica e Informatica, Università di Palermo, ITALY. Carpire il segreto della vita con l informatica Giosuè Lo Bosco Dipartimento di Matematica e Informatica, Università di Palermo, ITALY. Lezioni Lincee Palermo, 26 Febbraio 2015 Alla base della vita degli

Dettagli

L accesso alla Cochrane è consentito solo dal PC collegati alla rete della struttura tramite controllo dell indirizzo IP.

L accesso alla Cochrane è consentito solo dal PC collegati alla rete della struttura tramite controllo dell indirizzo IP. La Cochrane Library è il principale prodotto della Cochrane Collaboration. Si tratta di un Database che raccoglie tutte le revisioni sitematiche (RS) prodotte dalla Cochrane Collaboration ed i protocolli

Dettagli

LA GENETICA: DNA e RNA LA GENETICA. DNA e RNA. Prof. Daniele Verri

LA GENETICA: DNA e RNA LA GENETICA. DNA e RNA. Prof. Daniele Verri LA GENETICA DNA e RNA Prof. Daniele Verri L'acido desossiribonucleico o deossiribonucleico (DNA) è un acido nucleico che contiene le informazioni necessarie per la formazione di RNA e proteine. LA GENETICA:

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

TECNICHE DI COMPRESSIONE DATI

TECNICHE DI COMPRESSIONE DATI TECNICHE DI COMPRESSIONE DATI COMPRESSIONE DATI La compressione produce una rappresentazione più compatta delle informazioni è come se si usassero meno parole per dire la stessa cosa in modo diverso. Esistono

Dettagli

SERVIZIO DI SEQUENZIAMENTO AUTOMATICO

SERVIZIO DI SEQUENZIAMENTO AUTOMATICO REPARTO GENOMICA LABORATORIO ANALISI GENOMICHE SERVIZIO DI SEQUENZIAMENTO AUTOMATICO DOCUMENTO ILLUSTRATIVO DEL SERVIZIO DI SEQUENZIAMENTO ACIDI NUCLEICI ISTITUTO ZOOPROFILATTICO SPERIMENTALE DELLA LOMBARDIA

Dettagli

Come si traccia un alimento di origine animale? Dalle lasagne con carne di cavallo. alla realtà di ogni giorno

Come si traccia un alimento di origine animale? Dalle lasagne con carne di cavallo. alla realtà di ogni giorno Editoriale n.10 Newsletter aprile 2013 Come si traccia un alimento di origine animale? Dalle lasagne con carne di cavallo alla realtà di ogni giorno Identificare la specie, un obiettivo fondamentale quando

Dettagli

Sequenziamento ed analisi dell esoma intero (All Exon)

Sequenziamento ed analisi dell esoma intero (All Exon) Sequenziamento ed analisi dell esoma intero (All Exon) Obiettivi La procedura ha l obiettivo di sequenziare solo le regioni trascritte e codificanti del genoma che rappresentano, almeno nell uomo, circa

Dettagli

0. Piano cartesiano 1

0. Piano cartesiano 1 0. Piano cartesiano Per piano cartesiano si intende un piano dotato di due assi (che per ragioni pratiche possiamo scegliere ortogonali). Il punto in comune ai due assi è detto origine, e funziona da origine

Dettagli

1. Le banche dati biologiche

1. Le banche dati biologiche 1. Le banche dati biologiche NCBI, ENTREZ, MEDLINE, PUBMED Il National Center for Biotechnology Information (NCBI), un ente governativo americano, gestisce un sito web (www.ncbi.nlm.nih.gov) attraverso

Dettagli

QUARTO INCONTRO LABORATORIO CORSO INDAGINI CAMPIONARIE. Laboratorio Stefania Porchia

QUARTO INCONTRO LABORATORIO CORSO INDAGINI CAMPIONARIE. Laboratorio Stefania Porchia QUARTO INCONTRO LABORATORIO CORSO INDAGINI CAMPIONARIE Laboratorio Stefania Porchia Incontri e argomenti trattati nel laboratorio 29 marzo 14.00 15.30 l indagine qualitativa come strategia di formulazione

Dettagli

Introduzione alla programmazione in C

Introduzione alla programmazione in C Introduzione alla programmazione in C Testi Consigliati: A. Kelley & I. Pohl C didattica e programmazione B.W. Kernighan & D. M. Ritchie Linguaggio C P. Tosoratti Introduzione all informatica Materiale

Dettagli

Rappresentazione e Memorizzazione dei Dati

Rappresentazione e Memorizzazione dei Dati Rappresentazione e Memorizzazione dei Dati Giuseppe Nicosia CdL in Matematica (Laurea Triennale) Facoltà di Scienze MM.FF.NN. Università di Catania Bit e loro Memorizzazione Definizioni Algoritmo: una

Dettagli

4. Proiezioni del piano e dello spazio

4. Proiezioni del piano e dello spazio 4. Proiezioni del piano e dello spazio La visualizzazione di oggetti tridimensionali richiede di ottenere una vista piana dell'oggetto. Questo avviene mediante una sequenza di operazioni. Innanzitutto,

Dettagli

Funzioni non documentate Openoffice.org. 3 Base mini-howto

Funzioni non documentate Openoffice.org. 3 Base mini-howto Funzioni non documentate Openoffice.org. 3 Base mini-howto Augusto Scatolini (webmaster@comunecampagnano.it) Ver. 1.0 gennaio 2009 Come risolvere il problema del contatore che inizia da 0 (zero) Come importare

Dettagli

SEQUENZIAMENTO DEL DNA

SEQUENZIAMENTO DEL DNA SEQUENZIAMENTO DEL DNA Il metodo di Sanger per determinare la sequenza del DNA Il metodo manuale La reazione enzimatica Elettroforesi in gel denaturante di poliacrilammide Autoradiografia Il metodo automatico

Dettagli

Studio delle energie di stabilizzazione delle proteine a partire da dati di coevoluzione

Studio delle energie di stabilizzazione delle proteine a partire da dati di coevoluzione FACOLTÀ DI SCIENZE E TECNOLOGIE Corso di Laurea Magistrale in Fisica Studio delle energie di stabilizzazione delle proteine a partire da dati di coevoluzione Relatore Dott. Guido Tiana Sara Lui Matricola

Dettagli

Informatica B. Sezione D. Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica

Informatica B. Sezione D. Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica Scuola di Ingegneria Industriale Laurea in Ingegneria Energetica Laurea in Ingegneria Meccanica Dipartimento di Elettronica, Informazione e Bioingegneria Informatica B Sezione D Franchi Alessio Mauro,

Dettagli

BIOINFORMATICA PER LA BIOLOGIA STRUTTURALE

BIOINFORMATICA PER LA BIOLOGIA STRUTTURALE BIOINFORMATICA PER LA BIOLOGIA STRUTTURALE Predizione di struttura secondaria La predizione di struttura secondaria è trattata nel corso base "Informatica e Bioinformatica" per la laurea triennale di primo

Dettagli

Analizza/Confronta medie. ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107. Test t. Test t. t-test test e confronto tra medie chi quadrato

Analizza/Confronta medie. ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107. Test t. Test t. t-test test e confronto tra medie chi quadrato Analizza/Confronta medie ELEMENTI DI PSICOMETRIA Esercitazione n. 7-8-9-107 t-test test e confronto tra medie chi quadrato C.d.L. Comunicazione e Psicologia a.a. 2008/09 Medie Calcola medie e altre statistiche

Dettagli

UNIVERSITÀ DEGLI STUDI DELL INSUBRIA BANDO PER L AMMISSIONE AL MASTER DI I LIVELLO IN BIOINFORMATICA

UNIVERSITÀ DEGLI STUDI DELL INSUBRIA BANDO PER L AMMISSIONE AL MASTER DI I LIVELLO IN BIOINFORMATICA UNIVERSITÀ DEGLI STUDI DELL INSUBRIA BANDO PER L AMMISSIONE AL MASTER DI I LIVELLO IN BIOINFORMATICA L Università degli Studi dell Insubria, in collaborazione con la Fondazione per le Biotecnologie di

Dettagli

SISTEMA DI RAPPRESENTAZIONE BINARIA DEI NUMERI E. Giordani

SISTEMA DI RAPPRESENTAZIONE BINARIA DEI NUMERI E. Giordani SISTEMA DI RAPPRESENTAZIONE BINARIA DEI NUMERI E. Giordani LEMS- Laboratorio Elettronico per la Musica Sperimentale Conservatorio di Musica G. Rossini- Pesaro,QWURGX]LRQH Tutti i FDOFRODWRUL HOHWWURQLFL

Dettagli

Una proteina nella rete: Caccia al tesoro bioinformatica

Una proteina nella rete: Caccia al tesoro bioinformatica Una proteina nella rete: Caccia al tesoro bioinformatica Nel corso di questa attivita utilizzeremo alcune delle piu importanti banche dati disponibili in rete per cercare informazioni su una proteina.

Dettagli

Statistica e biometria. D. Bertacchi. Variabili aleatorie. V.a. discrete e continue. La densità di una v.a. discreta. Esempi.

Statistica e biometria. D. Bertacchi. Variabili aleatorie. V.a. discrete e continue. La densità di una v.a. discreta. Esempi. Iniziamo con definizione (capiremo fra poco la sua utilità): DEFINIZIONE DI VARIABILE ALEATORIA Una variabile aleatoria (in breve v.a.) X è funzione che ha come dominio Ω e come codominio R. In formule:

Dettagli

Indice. 1 Rappresentazione dei dati... 3

Indice. 1 Rappresentazione dei dati... 3 INSEGNAMENTO DI INFORMATICA DI BASE LEZIONE II CODIFICA DELL'INFORMAZIONE PROF. GIOVANNI ACAMPORA Indice 1 Rappresentazione dei dati... 3 1.1. Rappresentazione dei numeri... 3 1.1.1 Rappresentazione del

Dettagli

Giuseppe Pigola Dipartimento di Matematica e Informatica Università di Catania Italy

Giuseppe Pigola Dipartimento di Matematica e Informatica Università di Catania Italy Giovanni Giuffrida, Giuseppe Giura, Carlo Pennisi, Calogero Zarba Dipartimento di Sociologia e Metodi delle Scienze Sociali Università di Catania - Italy Giuseppe Pigola Dipartimento di Matematica e Informatica

Dettagli

Strutturazione logica dei dati: i file

Strutturazione logica dei dati: i file Strutturazione logica dei dati: i file Informazioni più complesse possono essere composte a partire da informazioni elementari Esempio di una banca: supponiamo di voler mantenere all'interno di un computer

Dettagli

90.1 Sistemi di numerazione. 90.1.1 Sistema decimale. 605 Capitolo 90 Dai sistemi di numerazione all organizzazione della memoria

90.1 Sistemi di numerazione. 90.1.1 Sistema decimale. 605 Capitolo 90 Dai sistemi di numerazione all organizzazione della memoria 605 Capitolo 90 Dai sistemi di numerazione all organizzazione della memoria 90.1 Sistemi di numerazione.................................................... 605 90.1.1 Sistema decimale..................................................

Dettagli

Corso di Laurea Ingegneria Informatica Fondamenti di Informatica

Corso di Laurea Ingegneria Informatica Fondamenti di Informatica Corso di Laurea Ingegneria Informatica Fondamenti di Informatica Dispensa 05 La rappresentazione dell informazione Carla Limongelli Ottobre 2011 http://www.dia.uniroma3.it/~java/fondinf/ La rappresentazione

Dettagli

Statistica. Lezione 6

Statistica. Lezione 6 Università degli Studi del Piemonte Orientale Corso di Laurea in Infermieristica Corso integrato in Scienze della Prevenzione e dei Servizi sanitari Statistica Lezione 6 a.a 011-01 Dott.ssa Daniela Ferrante

Dettagli

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per

Dettagli

risulta (x) = 1 se x < 0.

risulta (x) = 1 se x < 0. Questo file si pone come obiettivo quello di mostrarvi come lo studio di una funzione reale di una variabile reale, nella cui espressione compare un qualche valore assoluto, possa essere svolto senza necessariamente

Dettagli

Guida Rapida all utilizzo di Microsoft Excel

Guida Rapida all utilizzo di Microsoft Excel Guida Rapida all utilizzo di Microsoft Excel Giorgio Delzanno L ambiente Excel Excel è un foglio elettronico costituito da tre diverse componenti: un gestore di cartelle di lavoro, un gestore di database

Dettagli

L analisi spaziale. Indici statistici geospaziali

L analisi spaziale. Indici statistici geospaziali L analisi spaziale Uno degli scopi principali dei GIS e quello di offrire strumenti concettuali e metodologici per studiare analiticamente le relazioni nello spazio L analisi spaziale ha come obbiettivo

Dettagli

MICROSOFT ACCESS. Fabrizio Barani 1

MICROSOFT ACCESS. Fabrizio Barani 1 MICROSOFT ACCESS Premessa ACCESS è un programma di gestione di banche dati, consente la creazione e modifica dei contenitori di informazioni di un database (tabelle), l inserimento di dati anche mediante

Dettagli

ANALISI STATISTICA DEL PROTEOMA E FILOGENESI

ANALISI STATISTICA DEL PROTEOMA E FILOGENESI UNIVERSITÀ DEGLI STUDI DI CATANIA FACOLTÀ DI SCIENZE MATEMATICHE, FISICHE E NATURALI CORSO DI LAUREA IN FISICA Roberta Sinatra ANALISI STATISTICA DEL PROTEOMA E FILOGENESI TESI DI LAUREA RELATORE: CHIAR.MO

Dettagli

Sistemi Informativi Multimediali Indicizzazione multidimensionale

Sistemi Informativi Multimediali Indicizzazione multidimensionale Indicizzazione nei sistemi di IR (1) Sistemi Informativi Multimediali Indicizzazione multidimensionale ugusto elentano Università a Foscari Venezia La struttura fondamentale di un sistema di information

Dettagli

UNIVERSITÀ DEGLI STUDI DI BARI

UNIVERSITÀ DEGLI STUDI DI BARI UNIVERSITÀ DEGLI STUDI DI BARI Nota: per le modalità concorsuali si prega cortesemente di fare sempre riferimento al Bando di Concorso A. A. 2005-2006 Parte A Informazioni generali Proposta d istituzione

Dettagli

Algoritmi Genetici. e programmazione genetica

Algoritmi Genetici. e programmazione genetica Algoritmi Genetici e programmazione genetica Algoritmi Genetici Algoritmi motivati dall analogia con l evoluzione biologica Lamarck: le specie trasmutano nel tempo Darwin e Wallace: variazioni consistenti

Dettagli

Corso di Calcolo Numerico

Corso di Calcolo Numerico Corso di Calcolo Numerico Dott.ssa M.C. De Bonis Università degli Studi della Basilicata, Potenza Facoltà di Ingegneria Corso di Laurea in Ingegneria Meccanica Sistemi di Numerazione Sistema decimale La

Dettagli

STUDIO E SPERIMENTAZIONE DI METODOLOGIE

STUDIO E SPERIMENTAZIONE DI METODOLOGIE UNIVERSITÀ DEGLI STUDI DI CAGLIARI DOTTORATO DI RICERCA IN INGEGNERIA ELETTRONICA ED INFORMATICA XVII CICLO STUDIO E SPERIMENTAZIONE DI METODOLOGIE INNOVATIVE PER L ANALISI DI SEQUENZE BIOLOGICHE Relatore:

Dettagli

strutture di Proteine

strutture di Proteine Laboratorio di Bioinformatica I Database di strutture di Proteine Dott. Sergio Marin Vargas (2014 / 2015) Dal gene alla proteina La funzione della proteina è nella sua struttura 3D. Struttura delle proteine

Dettagli

RNA non codificanti ed RNA regolatori

RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori Piccoli RNA non codificanti RNA regolatore microrna RNAi e sirna Piccoli RNA non codificanti Gli RNA non codificanti (ncrna)

Dettagli

Lezione 10. La classificazione dell Intelligenza Artificiale

Lezione 10. La classificazione dell Intelligenza Artificiale Lezione 10 Intelligenza Artificiale Cosa è l Intelligenza Artificiale Elaborazione del linguaggio naturale La visione artificiale L apprendimento nelle macchine La classificazione dell Intelligenza Artificiale

Dettagli

Ricerca Operativa A.A. 2007/2008

Ricerca Operativa A.A. 2007/2008 Ricerca Operativa A.A. 2007/2008 9. Cenni su euristiche e metaeuristiche per ottimizzazione combinatoria Motivazioni L applicazione di metodi esatti non è sempre possibile a causa della complessità del

Dettagli

Manuale a supporto dell utilizzo di Business Objects

Manuale a supporto dell utilizzo di Business Objects Business Objects Manuale a supporto dell utilizzo di Business Objects Il presente documento costituisce il manuale a supporto dell utilizzo di Business Objects per l interrogazione e l analisi dei dati

Dettagli