FUNZIONI DELLE PROTEINE

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "FUNZIONI DELLE PROTEINE"

Transcript

1 FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA CRESCITA E DELLA DIFFERENZIAZIONE

2

3 STEREOISOMERIA DEGLI α -AMMINOACIDI (3 modi di rappresentare la struttura degli enantiomeri dell alanina) Proiezioni di Fischer

4 Relazione tra gli stereoisomeri dell alanina e la configurazione assoluta della D- e della L-gliceraldeide Gli amminoacidi L costituiscono la serie naturale

5 I 20 AMMINOACIDI STANDARD DELLE PROTEINE Gly (G) Leu (L) Ala (A) Val (V) Met (M) Ser (S) Cys (C) Ile (I) Pro (P) Amminoacidi essenziali Thr (T) Asn (N) Gln (Q)

6 I 20 AMMINOACIDI STANDARD DELLE PROTEINE Asp (D) Glu (E) Lys (K) Amminoacidi essenziali Arg (H) His (R)

7 I 20 AMMINOACIDI STANDARD DELLE PROTEINE Phe (F) Amminoacidi essenziali Tyr (Y) Trp (W)

8

9 IL LEGAME PEPTIDICO

10 IL LEGAME PEPTIDICO È PLANARE, POLARE E STABILIZZATO DALLA RISONANZA mesomeria dimensioni

11 CONFIGURAZIONE DEL LEGAME PEPTIDICO Trans Cis Nelle proteine, quasi tutti i residui amminoacidici sono in configurazione trans (minima repulsione sterica). Una eccezione è rappresentata dai legami peptidici a cui partecipa la prolina, prolina un amminoacido ciclico.

12 PEPTIDI E PROTEINE In base al numero di amminoacidi che costituiscono una catena è possibile distinguere: oligopeptidi (da 2 a 20), polipeptidi (da 20 a 100), proteine (più di 100). Una proteina, tuttavia, non è un semplice polipetide ad alto peso molecolare: una proteina è un polipeptide con una sequenza amminoacidica definita. Il pentapeptide serilgliciltirosilalanilleucina ( Ser-Gly-Tyr-Ala-Leu o SGYAL) Il nome di un peptide inizia sempre dal residuo N-terminale, che per convenzione è sempre posto a sinistra. (In grigio, i legami peptidici; in rosso, i gruppi R.)

13 CLASSIFICAZIONE DELLE PROTEINE a) In base alla composizione: SEMPLICI. SEMPLICI Costituite solo di amminoacidi CONIUGATE. CONIUGATE Costituite, oltre che di amminoacidi, anche di ioni o altre molecole organiche b) In base alla struttura: FIBROSE. FIBROSE Proteine aventi struttura estesa di tipo filamentoso con proprietà meccaniche. Sono generalmente insolubili in acqua e nella maggior parte dei casi svolgono ruoli strutturali in cellule e tessuti. GLOBULARI. GLOBULARI Proteine ripiegate in strutture compatte con una simmetria di tipo sferoidale. Sono generalmente solubili in acqua e svolgono un azione dinamica compiendo la maggior parte del lavoro chimico di una cellula. Costitiuiscono la frazione più grande delle proteine di un organismo.

14 L ARCHITETTURA DELLE PROTEINE È SECONDO QUATTRO LIVELLI DI STRUTTURA ORGANIZZATA Struttura primaria. È la descrizione completa dei legami covalenti di primaria una proteina. Descrive la sequenza degli amminoacidi e la posizione dei ponti disolfuro eventualmente presenti. Struttura secondaria. Conformazione dello scheletro polipeptidico che secondaria dà luogo a strutture periodiche. È la disposizione regolare e ricorrente della catena polipeptidica in una direzione dello spazio. È dovuta alle relazioni steriche di amminoacidi vicini nella sequenza lineare. Struttura terziaria. Conformazione della catena polipeptidica nelle tre terziaria direzioni dello spazio,. È determinata dalle relazioni steriche di amminoacidi lontani nella sequenza lineare. Per le proteine globulari costituisce la conformazione biologicamente attiva. Struttura quaternaria. Tipica delle proteine costituite dall associazione di quaternaria due o più catene polipeptidiche (proteine multimeriche), multimeriche descrive le interazioni tra le catene (subunità). essere di subunità Le interazioni possono tipo non covalente o costituite da legami trasversali covalenti.

15 LA STRUTTURA PRIMARIA DELL INSULINA BOVINA La molecola è costituita di due catene polipeptidiche unite da ponti disolfuro trasversali realizzati tra due residui di cisteina. La catena A contiene un ponte disolfuro intracatena. La catena A è identica a quella presente nell insulina dell uomo.

16 GLI AA IN UNA CATENA HANNO UN LIMITATO NUMERO DI GRADI DI LIBERTÀ In una catena polipeptidica, sono possibili rotazioni solo attorno ai legami N-Cα e Cα-C definite, rispettivamente, dagli angoli φ e ψ. Le dimensioni o le cariche dei gruppi R costituiscono un limite alla rotazione e definiscono pertanto i valori degli angoli φ e ψ. Per convenzione, il valore degli angoli φ e ψ è = 0 quando i due legami peptidici che fiancheggiano un atomo di Cα sono sullo stesso piano.

17 ROTAZIONE DEI PIANI AMMIDICI VISTA DA UN OSSERVATORE SUL CARBONIO α Per convenzione, la rotazione positiva è in senso orario, guardando dal Cα in entrambe le direzioni. L angolo φ definisce la posizione del legame peptidico precedente; Ψ ψ stabilisce la posizione di quello successivo. Φ Ψ = 0 Φ = 180 Ψ = 180 Φ = 0 massimo impedimento sterico

18 GRAFICO DI RAMACHANDRAN La maggior parte delle combinazioni di ψ e φ sono stericamente vietate (regioni in rosso). Sono favorite solo le combinazioni nelle regioni verdi. Quelle delle regioni in giallo sono energeticamente meno favorevoli, ma ugualmente possibili.

19 α - ELICA DESTRORSA (α R) È la struttura secondaria più frequente. Gli angoli φ e ψ assumono rispettivamente i valori di - 57 e - 47 I piani rigidi dei legami peptidici sono paralleli all asse dell elica Modello a palle e bastoncini di un α-elica destrorsa in cui sono visibili i legami idrogeno intracatena. L unità ripetitiva è un giro dell elica comprendente 3,6 residui

20 SEZIONE TRASVERSALE E MODELLO SPAZIALE DI UNA α -ELICA DESTRORSA 5Å Il modello a palle e bastoncini, usato per mettere in risalto l organizzazione strutturale dell α-elica, non evidenzia la reale compattezza della struttura. Questa è visibile solo nel modello spaziale che utilizza i raggi di van der Waals degli atomi.

21

22 STRUTTURA β O A FOGLIETTO RIPIEGATO La struttura a foglietto ripiegato è la seconda struttura ripetitiva, più frequente, nelle proteine. Estremità amminica Estremità carbossilica

23 LE CATENE POLIPEPTIDICHE CON STRUTTURA β POSSONO AFFIANCARSI IN DUE MODI DIVERSI Foglietto β antiparallelo φ = ψ = Foglietto β parallelo φ = ψ = + 113

24 I FOGLIETTI β, ANTIPARALLELI E PARALLELI, CON IL MODELLO A PALLE E BASTONCINI

25 I RIPIEGAMENTI β PERMETTONO L INVERSIONE DELLA DIREZIONE DELLA CATENA POLIPEPTIDICA Esistono più modi in cui la catena polipeptidica può cambiare direzione, in modo da passare da un segmento β o da uno α al segmento successivo. I più frequenti sono i ripiegamenti β. Sono formati da quattro residui amminoacidici disposti in modo da invertire la direzione della catena di circa 180. I più comuni ripiegamenti β sono due. Tipo I Entrambi i ripiegamenti sono stabilizzati da legami idrogeno tra i residui 1 e 4. Il tipo I ha una frequenza doppia rispetto al tipo II. Nel tipo II vi è sempre, in posizione 3, un residuo di glicina. In molti ripiegamenti β è presente la prolina che forma legami peptidici in configurazione cis. Tipo II

26 I RIPIEGAMENTI β SECONDO IL MODELLO A PALLE E BASTONCINI Molto meno frequente è il ripiegamento γ, una struttura più serrata a tre residui con un legame idrogeno tra il primo ed il terzo residuo.

27 PROBABILITÀ RELATIVE DELLA PRESENZA DI UN DATO AMMINOACIDO NEI TRE TIPI PIÙ COMUNI DI STRUTTURA SECONDARIA

28 PREDIZIONE DELLA STRUTTURA SECONDARIA Dalle tabelle di frequenza relativa degli amminoacidi nelle proteine è possibile ricavare che: Ala (A) Cys (C) Met (M) Glu (E) Gln (Q) His (H) Lys (K) Favoriscono la formazione di α eliche Gly(G) Ser (S) Asp (D) Val (V) Ile (I) Phe (F) Tyr (Y) Trp (W) Thr (T) Asn (N) Favoriscono la formazione di foglietti β Pro (P) Favoriscono la formazione di ripiegamenti β

29 Struttura secondaria e proprietà delle proteine fibrose Struttura Caratteristiche Esempi α elica, con ponti disolfuro Resistentza, strutture protettive insolubili di varia durezza e flessibilità α cheratina dei capelli, piume e unghie Conformazione β Sofficità, filamenti flessibili Fibroina della setra Tripla elica del collagene Elevata resistenza alla trazione, mancanza di elasticità Collagene dei tendini, matrice delle ossa.

30 Struttura del capello L α cheratina dei capelli è una lunga α elica con ispessimenti in corrispondenza delle terminazioni amminiche e carbossiliche. Coppie di queste eliche si avvolgono con andamento sinistrorso. Queste, a loro volta, formano strutture ordinate dette protofilamenti e protofibrille. Quattro protofibrille (32 filamenti di α cheratina) si combinano a formare un filamento intermedio.

31 La permanente è un operazione di ingegneria biochimica

32 Fibroina della seta La principale proteina della seta è costituita da foglietti β antiparalleli, disposti in vari strati. E composta, per oltre l 80%, di glicina, alanina e serina con una sequenza ripetitiva del tipo (Ser-Gly-Ala-Gly)n. Le piccole dimensioni dei gruppi R permettono una perfetta sovrapposizione di uno strato sull altro. Fra le lamine sovrapposte si stabiliscono interazioni di van der Waals che spiegano la flessibilità del materiale.

33 La catena del collageno ha una struttura secondaria ripetitiva unica. La sequenza ripetitiva del tripeptide Gly-X-Pro oppure Gly-X-HyPro assume una struttura elicoidale sinistrorsa con tre residui per giro (elica del collageno) collageno

34 Tre catene polipeptidiche sono superavvolte, le une attorno alle altre, in una superelica destrorsa Tre eliche, mostrate in grigio, azzurro e viola nel modello spaziale, si arrotolano insieme con un andamento destrorso.

35 Modello a palle e bastoncini della superelica a tre catene del collageno vista da una estremità I residui di Gly sono in rosso. La glicina, proprio per le sue piccole dimensioni, è necessaria per conferire compattezza alla tripla elica. I residui di prolina sono all esterno.

36 Struttura della fibra di collageno Il collageno (Mr ) è una molecola a forma di bastoncino, lunga circa 3000 Å e con uno spessore di 15 Å. I tre polipeptidi avvolti in modo elicoidale possono avere diverse sequenze, ma ognuna contiene circa 1000 residui. Le fibre sono costituite da molecole di collageno allineate in modo sfalsato e unite da legami crociati che ne aumentano la forza. Questo tipo di allineamento ed il contenuto di legami crociati variano da tessuto a tessuto e producono le tipiche striature che si osservano al microscopio elettronico. Nell esempio mostrato, l allineamento delle teste ogni quarta molecola produce striature distanti 640 Å.

37 STABILIZZAZIONE DELLA STRUTTURA TERZIARIA N H COO- CH2 O CH2 = CH2 NH3+ COO S CH2 S CH2 CH3 S CH2 CH3 CH2 Interazioni elettrostatiche (ponti salini) Legami idrogeno OH CH2 COO- NH3+ CH2 S CH2 C CH2 OH O = NH3+ C O O O =C Ponti disolfuro Interazioni idrofobiche

38 L INFORMAZIONE CHE DETERMINA LA STRUTTURA TRIDIMENSIONALE DI UNA PROTEINA È CONTENUTA INTERAMENTE NELLA SEQUENZA DEGLI AMMINOACIDI. Christian Anfinsen (1950) Ribonucleasi A DENATURAZIONE HOCH2CH2SH SH SH RINATURAZIONE O2 a ph 8 SH SH HS SH SH 124 SH La proteina conosce la propria conformazione e non necessita di altre informazioni per ottenerla se non quella contenuta nella sua struttura primaria

39 IL RIPIEGAMENTO DI UNA PROTEINA GLOBULARE È UN PROCESSO TERMODINAMICAMENTE FAVOREVOLE Il ripiegamento, tuttavia, coinvolge il passaggio da molte conformazioni ad avvolgimento casuale ad una unica conformazione biologicamente attiva. Ciò implica una diminuzione del disordine e quindi una diminuzione di entropia. La variazione di entropia conformazionale si oppone al ripiegamento. Poiché il G per l intero processo è minore di zero: o il H è molto negativo o il contributo entropico va nel senso di un aumento di entropia

40 Contributo principale ad un H negativo nel ripiegamento di una proteina INTERAZIONI ELETTROSTATICHE. Interazioni tra gruppi carichi, ad esempio tra un gruppo ε amminico di lisina ed un gruppo carbossilico di glutammico (ponti salini) salini LEGAMI IDROGENO INTRAMOLECOLARI. La maggior parte delle catene laterali degli amminoacidi presenta gruppi tra i quali è possibile la formazione di legami idrogeno (gruppi ossidrilici di serina e treonina, gruppi amminici di lisina, azoto istidinico). FORZE DI DISPERSIONE. Interazione tra le catene laterali degli amminoacidi prive di cariche.

41 Attorno alle molecole non polari, l acqua forma gabbie (clatrati) con una struttura altamente ordinata Una unità di una struttura a clatrato che circonda una molecola idrofobica. Gli atomi di ossigeno delle molecole di acqua sono mostrati in rosso. Sono rappresentati gli atomi di idrogeno di un solo pentagono di atomi di ossigeno. La gabbia dodecaedrica di molecole di acqua, l elemento strutturale dei clatrati, può ripetersi ed estendersi in una struttura complessa ed ordinata che circonda le molecole idrofobiche.

42 Fattori che contribuiscono all energia libera di ripiegamento di proteine globulari. Il cambiamento di entropia conformazionale si oppone al ripiegamento, mentre l entalpia delle interazioni interne ed il cambiamento di entropia per l effetto idrofobico, favoriscono il ripiegamento. La sommatoria dei tre fattori da una variazione di energia libera negativa.

43 LA STRUTTURA TERZIARIA DELLA MIOGLOBINA La Mioglobina è una catena di 153 AA. È costituita da una serie di 8 segmenti di α elica indicati con le lettere da A ad H, a partire dal terminale amminico. In sostanza è una scatola che racchiude il gruppo eme. Nel modello spaziale ogni atomo è rappresentato da una sfera le cui dimensioni sono proporzionali al raggio di van der Waals. In blu sono indicate le catene laterali dei residui idrofobici Leu, Ile, Val, Phe.

44 IL GRUPPO EME, GRUPPO PROSTETICO DI DIVERSE PROTEINE, DERIVA DALLA PROTOPORFIRINA IX M P P = CH2CH2COO M = CH3 N V N M H H P V = CH=CH2 N M N Protoporfirina IX V M Il gruppo eme è la Ferro-protoporfirina IX

45 L EMOGLOBINA, UNA PROTEINA OLIGOMERICA È costituita di 4 catene polipeptidiche uguali a due a due: 2 catene (subunità) α di 141 AA, 2 catene (subunità) β di 146 AA. Le catene sono molto simili tra loro e simili a quella della mioglobina. Ciascuna subunità è fatta di segmenti ad α elica ripiegati a formare un contenitore per il gruppo eme. Le interazioni tra le 4 subunità sono per la maggior parte di tipo idrofobico, rari sono i legami idrogeno, ma vi sono ben 8 ponti salini. salini Modello a nastro Modello spaziale Le subunità α sono in grigio e in azzurro, le subunità β sono in rosa e blu. In rosso, i gruppi eme

46 OGNI LIVELLO DELLA STRUTTURA PROTEICA UTILIZZA COME BASE COSTRUTTIVA I LIVELLI INFERIORI. La struttura terziaria può essere vista come ripiegamento di elementi di struttura secondaria e la quaternaria come la combinazione di subunità ripiegate. Tutto è determinato dalla struttura primaria ed in definitiva dal gene.

47 Eritrociti di un soggetto normale

48 Eritrociti di un soggetto affetto da anemia a cellule falciformi

49 α2 α1 β1 H3 C C H CH3 β2 C CH3 CH3 H Nell HbS il Glu in posizione 6, di ciascuna catena β, è sostituto da un residuo di Val. l HbS, rispetto all Hb normale, ha, quindi, 2 cariche negative superficiali in meno, una per ogni subunità β. Sulla superficie della molecola, pertanto, nella regione della mutazione si crea un punto di contatto appiccicoso (idrofobico) che consente alle molecole di deossihb di associarsi.

50 L EMOGLOBINA NON E UN SEMPLICE CONTENITORE PER L O2, MA UN MACCHINARIO DI DIMENSIONI MOLECOLARI Segmento F CH2 NH HYS F8 (istidina prossimale) N CH2 O2 N N HYS H7 (istidina distale) N N N N N CH2 N N N O NH NH Segmento H NH N O CH2

51

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Modificazioni delle proteine

Modificazioni delle proteine Modificazioni delle proteine POST-TRADUZIONALI = avvengono dopo la sintesi proteica CO-TRADUZIONALI = avvengono durante la sintesi proteica Sono modificazioni chimiche della catena polipeptidica ad opera,

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

20/12/ tipi di amino acidi: parecchie combinazioni

20/12/ tipi di amino acidi: parecchie combinazioni 20 tipi di amino acidi: parecchie combinazioni Le proteine sono polimeri di amino acidi 1 SEMPLICI : costituite solo da amino acidi PROTEINE CONIUGATE Apoproteina = parte proteica Gruppo prostetico = parte

Dettagli

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU)

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) Roberto Giacominelli Stuffler IL CORSO MONODISCIPLINARE DI BIOCHIMICA È SUDDIVISO IN DUE UNITÀ

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

GLI AMMINOACIDI E LE PROTEINE

GLI AMMINOACIDI E LE PROTEINE UNITÀ VET. DIDATTICA DI PROPEDEUTICA BIOCHIMICA GLI AMMINOACIDI E LE PROTEINE Roberto Giacominelli Stuffler INTRODUZIONE Tutte le proteine, sia nei batteri, sia nelle forme di vita più complesse, sono

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA.

LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA. UNITÀ BIOTEC. DIDATTICA DI BIOCHIMICA GENERALE LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA. Roberto Giacominelli Stuffler IL COLLAGENO 2 IL COLLAGENO E una famiglia di proteine fibrose con ruolo

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli