sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

Save this PDF as:

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune"



2 sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici


4 La carica di un amino acido dipende dal ph

5 Classificazione amino acidi

6 Glicina Alanina Aminoacidi idrofobici

7 Valina Leucina Isoleucina Metionina Aminoacidi idrofobici

8 Prolina

9 Fenilalanina Tirosina Triptofano Aminoacidi aromatici

10 Serina Treonina Aminoacidi polari con gruppo -OH

11 Cisteina Aminoacidi polari con gruppo -SH

12 Cisteina Ossido-riduzione dei gruppi -SH


14 Acido aspartico Acido glutammico Asparagina Glutammina Aminoacidi ACIDI e loro ammidi

15 Lisina Arginina Istidina Aminoacidi BASICI

16 Legame peptidico è rigido e planare ed ha caratteristiche di parziale doppio legame con H dell N in trans rispetto O del C




20 PROTEINE Sono molecole molto grandi costituite da una o più catene polipeptidiche. Ogni proteina ha una caratteristica composizione in aminoacidi. Possono contenere gruppi chimici diversi dagli aminoacidi (gruppo prostetico): lipoproteine, glicoproteine, metalloproteine.

21 CONFORMAZIONE: organizzazione nello spazio degli atomi di una proteina CAMBIO DI CONFORMAZIONE: variazione strutturale senza rottura di legami covalenti CONFORMAZIONE NATIVA: di solito quella a più bassa energia di Gibbs e funzionale

22 Struttura delle proteine


24 la struttura primaria è definita geneticamente

25 Struttura secondaria delle proteine


27 Struttura ad α-elica Struttura avvolta ad elica stabilizzata da legami idrogeno che si formano tra l H legato all N del legame peptidico e l O carbonilico del quarto residuo aminoacidico. Le catene laterali sono esposte all esterno dell elica


29 Legami idrogeno che stabilizzano l α-elica

30 Rappresentazioni schematiche di α-eliche

31 Rappresentazioni schematica di una proteina costituita principalmente da α-elica

32 Una α-elica avvolta, si ritrovano in proteine come la cheratina dei capelli, delle unghia e delle corna


34 Struttura a foglietto β parallelo Struttura estesa stabilizzata da legami idrogeno che si formano fra gruppi NH e CO di catene diverse. Le catene laterali sono esposte sopra e sotto il piano

35 Struttura a foglietto β anti-parallelo

36 Struttura a foglietto β misto

37 foglietto β avvolto

38 Proteina ricca di foglietti β

39 Struttura a β turn E presente dove le catene polipeptidiche cambiano bruscamente direzione. La struttura è un ripiegamento di 180 che comprende 4 residui aminoacidici. Il β turn collega due segmenti adiacenti di un foglietto β ripiegato antiparallelo

40 La struttura della maggior parte delle proteine risulta dalla combinazione di elementi ad α- elica ed elementi a foglietto β. Questi elementi sono collegati da regioni LOOP (a forma di ansa) di lunghezza variabile e forma irregolare. In queste anse i gruppi CO e NH non fanno legami idrogeno. LOOP FILAMENTO 1 FILAMENTO 2

41 I loop sono esposti al solvente e presentano residui polari. I loop rappresentano spesso siti di legame, ad esempio ENZIMI-SITO ATTIVO ANTICORPI (6 regioni a loop)

42 Struttura terziaria Definisce la disposizione spaziale di tutti gli atomi della proteina. Aminoacidi localizzati in regioni anche lontane e parte di strutture secondarie diverse possono interagire e causare avvolgimenti della proteina su se stessa. la struttura terziaria non è rigida; gode di una certa flessibilità che permette modificazioni conformazionali. Queste modificazioni sono spesso associate alla loro funzione biologica. Esempio: un ligande può causare un cambio conformazionale (adattamento indotto).


44 STRUTTURA QUATERNARIA Riguarda proteine costituite da due subunità o più catene polipeptidiche (subunità). Le subunità possono essere uguali o distinte e si associano tra loro con legami non-covalenti L associazione di catene polipeptidiche può servire a diversi scopi: -subunità regolatrici -subunità con funzioni diverse ma correlate

45 ATTIVITA DI UNA PROTEINA E determinata da: Sequenza aminoacidica (struttura primaria) Conformazionale Gruppo prostetico


47 La funzione di una proteina viene svolta in seguito al legame con il proprio ligando I siti di legame per le macromolecole possono essere concavi, convessi o piatti I siti di legame per piccoli ligandi sono fenditure, tasche o cavità


AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi



BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)


Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:


Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi


Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi


Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina



STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica


Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine


Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia


Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche



PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine


Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il


Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine


La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso


Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi


La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena


amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a


LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche


scaricato da Proteine semplici costituite dai soli amminoacidi

scaricato da Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico


MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine


Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono



SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali


Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH


Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare


La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi


Aldosi Chetosi. Glucidi (carboidrati o zuccheri) Monosaccaridi. Gliceraldeide un aldotrioso. Diossiacetone un chetotrioso

Aldosi Chetosi. Glucidi (carboidrati o zuccheri) Monosaccaridi. Gliceraldeide un aldotrioso. Diossiacetone un chetotrioso Glucidi (carboidrati o zuccheri) polialcoli con una funzione carbonilica Ud'A - CdL in Scienze Motorie - AA 2004-05 [Le biomolecole] dia n. 1 Monosaccaridi Aldosi Chetosi Ud'A - CdL in Scienze Motorie


Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica


Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro


Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse


Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.


Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e


Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione


gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-





α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica



30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio


Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni


Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,


Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e


LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole


4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,


LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici


LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (


Compartime nto aminoacidi. 0,08 g (0,06 g) 0,36 g (0,32 g)

Compartime nto aminoacidi. 0,08 g (0,06 g) 0,36 g (0,32 g) G10% SENZA POTASSIO soluzione per infusione Principi attivi Compartime nto Compartime nto pronta all uso 125 ml 125 ml 250 ml 1000 ml Alanina 0,36 g 0,36 g 1,44 g Arginina 0,24 g 0,24 g 0,96 g Acido aspartico


Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche


CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 3 GLI AMMINOACIDI PROTEICI Le


Lezione 2. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi

Lezione 2. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi Lezione 2 Bioinformatica Mauro Ceccanti e Alberto Paoluzzi Dip. Informatica e Automazione Università Roma Tre Dip. Medicina Clinica Università La Sapienza Lezione 2: AMMINOACIDI E POLIPEPTIDI Aminoacidi



LIVELLI DI STRUTTURA DELLE PROTEINE FUNZIONI E STRUTTURA DELLE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 LIVELLI



PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente


Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)


Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi


lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni Biochimica Matricole dispari 1 1^ lezione Prof. Spina LA BIOCHIMICA 15 20 miliardi di anni fa l universo comparve sotto forma di eruzioni d l f d inimmaginabili di particele subatomiche ricche di energia



CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente





La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza



CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p


Nome e cognome: [Totale: 80 punti]

Nome e cognome: [Totale: 80 punti] Nome e cognome: ruppo / candidato No. SIENZE SPERIMENTLI: BIOLOI [Totale: 80 punti] Raccomandazioni: Rispondere direttamente sui fogli Non separare i fogli Rispondere in modo sintetico e chiaro, usando


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale


Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 4

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 4 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 4 Scoperta degli amminoacidi: gli amminoacidi essenziali Gli amminoacidi essenziali sono quegli amminoacidi che un


α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della


NH 2 CHCOOH AMINOACIDI PRESENTI NELLE PROTEINE. Abbreviazione internazionale. Nome. acido aspartico acido glutammico. CXasparagina.

NH 2 CHCOOH AMINOACIDI PRESENTI NELLE PROTEINE. Abbreviazione internazionale. Nome. acido aspartico acido glutammico. CXasparagina. Le proteine sono composti organici quaternari; esse sono costituite infatti da C,H,N e O. Pertanto rappresentano l'unica fonte di azoto del nostro organismo. Le proteine si formano per polimerizzazione


Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente


9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione


Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza


La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi


Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari


Alcune domande di carattere evolutivo

Alcune domande di carattere evolutivo Alcune domande di carattere evolutivo 1. Perché tutti gli organismi viventi (a parte le solite, rare, eccezioni usano lo stesso insieme di 20 aminoacidi? Interrelazioni tra organismi 2. Perché gli amino





10/03/ Proteine di membrana

10/03/ Proteine di membrana Proteine di membrana; Proteine di membrana 1 I domini transmembrana delle proteine integrali


Le proteine. Le proteine sono macromolecole che presentano differenze funzionali e strutturali

Le proteine. Le proteine sono macromolecole che presentano differenze funzionali e strutturali Le proteine Le proteine sono macromolecole che presentano differenze funzionali e strutturali LE PROTEINE HANNO FUNZIONI BIOLOGICHE DIVERSE enzimi proteine di trasporto proteine strutturali proteine di



LE BIOMOLECOLE LIPIDI, PROTEINE E ACIDI NUCLEICI GSCATULLO LE BIOMOLECOLE LIPIDI, PROTEINE E ACIDI NUCLEICI GSCATULLO ( Le Biomolecole I Lipidi Definizione e classificazione I lipidi rappresentano una vasta classe di composti chimicamente eterogenea per struttura


le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con


Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel.

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel. Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276104 Fax.:+39-049-8073310 E-mail: Funzioni delle


Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale


AMMINOACIDI COO - Gli amminoacidi che costituiscono le proteine sono 20 appartenenti alla serie L = H = CH 3 = CH 2 OH R SH + H 3 N O OH.

AMMINOACIDI COO - Gli amminoacidi che costituiscono le proteine sono 20 appartenenti alla serie L = H = CH 3 = CH 2 OH R SH + H 3 N O OH. AMMINOACIDI R = H glicina R = CH 3 alanina R = CH 2 OH serina R = CH 2 SH cisteina + H 3 N COO - R = CH 2 fenilalanina O R = CH 2 tirosina O OH Gli amminoacidi che costituiscono le proteine sono 20 appartenenti


Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,



PROTEINA GREGGIA (P.G.) PROTEINA GREGGIA (P.G.) Il contenuto proteico di un alimento è valutato dal suo tenore in azoto, determinato con il metodo Kjeldahl modificato. Il metodo Kjeldahl valuta la maggior parte dell azoto presente


Università Telematica Pegaso. Indice

Università Telematica Pegaso. Indice LE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 TRASCRIZIONE--------------------------------------------------------------------------------------------------------------


Le proteine. Sintetizzate nei ribosomi come una sequenza lineare di amminoacidi assumono in seguito una struttura tridimensionale

Le proteine. Sintetizzate nei ribosomi come una sequenza lineare di amminoacidi assumono in seguito una struttura tridimensionale Le proteine Elementi funzionali e strutturali di fondamentale importanza per lo svolgimento di funzioni metaboliche, di trasporto, di trasmissione nervosa o contrattile, ormonale o immunitaria Sintetizzate


Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi


C carbonio H idrogeno O ossigeno N azoto

C carbonio H idrogeno O ossigeno N azoto Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C carbonio



CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano


Somministrazione o assunzione di alimenti allo scopo di nutrire l organismo

Somministrazione o assunzione di alimenti allo scopo di nutrire l organismo Definizioni Alimentazione Somministrazione o assunzione di alimenti allo scopo di nutrire l organismo Nutrizione complesso di processi biologici che consentono o condizionano la conservazione, l accrescimento,



BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi


Confezione G13%E emulsione per infusione 10 sacche da 300 ml a 3 camere non PVC AIC n /M (in base 10) 16WBCU (in base 32)

Confezione G13%E emulsione per infusione 10 sacche da 300 ml a 3 camere non PVC AIC n /M (in base 10) 16WBCU (in base 32) Autorizzazione all immissione in commercio del medicinale «Numeta» Estratto determinazione n. 2473/2011 MEDICINALE NUMETA TITOLARE AIC: BAXTER S.P.A. Piazzale dell Industria, 20 00144 ROMA G13%E emulsione


Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame


ARPAT Agenzia regionale per la protezione ambientale della Toscana

ARPAT Agenzia regionale per la protezione ambientale della Toscana ARPAT Agenzia regionale per la protezione ambientale della Toscana Dipartimento Provinciale di Livorno 114, Via Giovanni Marradi - 57126 LIVORNO Tel. 0586/263411 - Fax 0586/263477 E-mail:


Lezione 2. Sommario. Bioinformatica. Lezione 2: AMMINOACIDI E POLIPEPTIDI Aminoacidi e proteine. Mauro Ceccanti e Alberto Paoluzzi

Lezione 2. Sommario. Bioinformatica. Lezione 2: AMMINOACIDI E POLIPEPTIDI Aminoacidi e proteine. Mauro Ceccanti e Alberto Paoluzzi Lezione 2 Bioinformatica Mauro Ceccanti e Alberto Paoluzzi Lezione 2: AMMINOACIDI E POLIPEPTIDI Aminoacidi e proteine Dip. Informatica e Automazione Università Roma Tre Dip. Medicina Clinica Università


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo


1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:



COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA


Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina

Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina sintesi proteica La sintesi proteica è il processo che porta alla formazione delle proteine da sequenze del DN definite geni. Si tratta di un processo a più fasi Nelle sue linee fondamentali questo processo


aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi Proteine Biopolimeri degli α-amino acidi. Amino acidi sono uniti attraverso il legame peptidico. Alcune funzioni: Struttura (collagene, cheratina ecc.) Enzimi (maltasi, deidrogenasi ecc) Trasporto (albumine,


Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.
