Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra)."

Transcript

1 Strutture secondarie (b)

2 Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica, la conformazione più ricorrente adottata dalla catena polipeptidica delle proteine è il foglietto β: circa il % degli aminoacidi nelle proteine globulari conosciute ricorre in questa conformazione. Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella zona permessa dl del plot tdi Ramachandran (quadrante in alto a sinistra).

3 Filamento β L unità costituente i foglietti β èilfilamento β (βstrand), lungo in media da 5 a 10 aminoacidi, con la catena polipeptidica p p quasi completamente estesa. I foglietti β nelle proteine globulari sono costituiti da 2 a 15 filamenti β abbinati lateralmente, con un valor medio di 6. Il filamento β si può considerare un tipo speciale di elica, con n = 2 residui per giro e una traslazione d = 3.4 Å per aminoacido. I filamenti β sono allineati uno vicino all altro, in modo tale che si possano formare legami idrogeno tra i gruppi CO di un filamento eigruppi NH del filamento β adiacente e viceversa.

4 Foglietto β I foglietti β formati da un certo numero di filamenti β sono pieghettati (pleated), con gli atomi C α degli aminoacidi adiacenti alternativamente leggermente sopra e sotto il piano del foglietto β, dando al foglietto β l apparenza di un foglietto pieghettato. Le catene laterali degli aminoacidi che compongono il foglietto β seguono lo stesso andamento, per cui puntano alternativamente sopra e sotto il foglietto β. Spesso un foglietto β può presentare tutte le catene laterali polari su una faccia e tutte le catene laterali non polari sull altra (ideale per costruire la superficie delle proteine).

5 Foglietto β I foglietti β differiscono dalle α eliche: -la catena polipeptidica del foglietto β è quasi completamente estesa piuttosto che essere avvolta aspirale; -le interazioni (legami idrogeno e interazioni di van der Waals) sono fra aminoacidi appartenenti a filamenti β differenti, anche distanti in sequenza, mentre nelle α eliche le interazioni si hanno esclusivamente fra aminoacidi idi vicini iii in sequenza;

6 ..\ANIMATED_Lessons_V&V\8-1c_H-BondingInB-Sheeets-b3\HBondingBSheets.htm Foglietto β (v (v. Animated_Lesson 8_1c) I filamenti β possono interagire fra loro a formare i foglietti β in due modi diversi: - gli aminoacidi nei filamenti β adiacenti hanno direzioni alternate (N-term C-term seguito da C-term N-term seguito da N-term C-term, ) esi parla di foglietto β antiparallelo; -gli aminoacidi nei filamenti β allineati vanno tutti nella stessa direzione (sempre N-term C-term) esi parla di foglietto β parallelo.

7 Foglietto β antiparallelo Angoli diedri (φ, ψ) = ( , 135 ) ). Coppie di legami idrogeno poco spaziate si alternano a coppie largamente spaziate. Tali legami idrogeno sono paralleli fra loro e perpendicolari alla direzione dei filamenti β. Idipoli associati alle unità peptidiche costituenti un filamento β si annullano.

8 Foglietto β parallelo Angoli diedri (φ, ψ) = ( , 113 ) ). Coppie di legami idrogeno uniformemente spaziati, non sono paralleli fra loro né perpendicolari alla direzione dei filamenti β. I dipoli associati alle unità peptidiche costituenti un filamento β si annullano. I foglietti β paralleli sono meno frequenti di quelli antiparalleli.

9 Foglietto β misto I filamenti β si possono anche combinare aformare un foglietto β misto, con alcune coppie di filamenti antiparalleli ed altre paralleli. I foglietti β misti sono meno frequenti dei foglietti β antiparalleli e paralleli.

10 Kinemage beta-structure large Foglietto β Tutti i foglietti β osservati (paralleli, antiparalleli e misti) presentano una torsione (twist) destrorsa (fino a30 ) di ciascun filamento β che li compone. Tale particolare geometria osservata nei foglietti β sarebbe il risultato di un compromesso tra l ottimizzazione dell energia conformazionale delle catene polipeptidiche costituenti i filamenti β e il mantenimento della geometria dei legami idrogeno.

11 Kinemage E03/3 Foglietto β Talvolta i foglietti β presentano delle irregolarità, dette β-bulge (protuberanza). Un β-bulge è la zona compresa fra due legami idrogeno consecutivi fra due filamenti β e comprende due aminoacidi appartenenti ad un filamento β, opposti ad un solo aminoacido appartenente al filamento β adiacente. La presenza del β-bulge accentua a livello locale la torsione del foglietto β. Il ruolo del β-bulge è quello di compensare leffetto l effetto dell inserzione/delezione di un aminoacido senza provocare la distruzione della struttura β. Il β-bulge g si osserva principalmente p nei foglietti β antiparalleli, mentre solo nel 5%dei casi in quelli paralleli.

12 Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni sono dovute alla presenza di un comune elemento strutturale, chiamato reverse turn. Gli aminoacidi coinvolti nella formazione dei reverse turn si trovano generalmente sulla superficie delle proteine e hanno natura polare e/o carica. Esistono vari tipi di reverse turn, a seconda del numero di aminoacidi che li costituiscono e degli elementi di struttura secondaria che collegano: β-turn γ-turn Ω-loop

13 Reverse turn β-turn E il tipo di turn più comune per collegare due filamenti β antiparalleli adiacenti. In questo caso sono due gli aminoacidi non coinvolti nei legami idrogenotraifilamentiβ. β Ogni β-turn è caratterizzato da un legame idrogeno fra il gruppo CO dell aminoacido 1 e il gruppo NH dell aminoacido 4, anche se spesso si osservano deviazioni (fino a 30 ) da questa conformazione ideale che impediscono la formazione di questo legame idrogeno. Spesso in posizione 1 si trovano gli aminoacidi Asn, Asp, Ser e Cys, le cui catene laterali possono formare legami idrogeno con il gruppo NH dell aminoacido id in posizione ii 3. Esistono 3 tipi di β-turn: tipo I, tipo II e tipo III.

14 β-turn Tipo I Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-90, 0 ) 3 4 I β-turn di tipo I si possono considerare un breve tratto distorto di elica Nei β-turn di tipo I l aminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta. Essi sono circa 2-3 volte più frequenti di quelli di tipo II. 2 1

15 Kinemages: Bchl_prot / Porin β-turn 4 Tipo II Angoli diedri (φ, ψ) 2 = (-60, 120 ) Angoli diedri (φ, ψ) 3 = (90, 0 ) 3 I β-turnditipoiidifferisconoda quelli di tipo I per un flip di 180 dell unità peptidica che collega gli 2 aminoacidi in posizione 2 e 3. 1 Nei β-turnditipoiil aminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta, mentre l aminoacido in posizione 3 spesso è una Gly, per evitare che l atomo di carbonio della catena laterale sia troppo vicino all atomo atomo di ossigeno dell aminoacido in posizione 2.

16 Kinemage E03/4 β-turn meno frequenti Tipo III Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-60, -30 ) I β-turn di tipo III sono costituiti da un breve tratto di catena polipeptidica che assume la conformazione dell elica Tipo I, tipo II, tipo III Esistono anche le varianti I, I, II e III, che costituiscono l immagine speculare della catena polipeptidica principale (ma non delle catene laterali!) rispettivamente dei β-turn di tipo I, II e III.

17 β-turn

18 Reverse turn (raro) γ-turn Si osserva quando solo un aminoacido non è coinvolto nei legami idrogeno caratteristici del foglietto β. E caratterizzato da un legame idrogeno fra il gruppo CO dell aminoacido i e il gruppo NH dell aminoacido i+2. Questo tipo di turn, piuttosto stretto, richiede una geometria poco favorevole per il legame idrogeno e inusuali valori degli angoli diedri per l aminoacido i+1 (φ = 70, ψ = -60 ).

19 Reverse turn Ω-loop Quasi tutte le proteine globulari con un numero di aminoacidi superiore a 60 contengono uno o più loop lunghi da 6 a 16 aminoacidi, le cui estremità distano meno di 10 Å. Tali loop sono chiamati Ω-loop, perché hanno la forma della lettera greca omega maiuscola. Gli Ω-loop hanno una forma compatta e non disordinata poiché le catene laterali degli aminoacidi che li compongono tendono a riempire le loro cavità interne, rendendoli piuttosto stabili. Gli Ω-loop sono spesso localizzati sulla superficie delle proteine e possono avere un importante ruolo nel riconoscimento intermolecolare.

20 Random coil (o loop) Le regioni della catena polipeptidica che non assumono alcun tipo di struttura secondaria (α-elica, struttura β, reverse turn) vengono chiamate random coil (o loop). Essi hanno una struttura tt irregolare nel senso che le coppie (φ, ψ) ) degli aminoacidi che li compongono assumono valori tra i più svariati e non costanti. I random coil sono generalmente flessibili e possono adottare diverse conformazioni: per questo motivo molto spesso sono difficili da rilevare sperimentalmente. Per esempio: estremità N- e C-terminali, zone particolarmente ricche di aminoacidi carichi (Lys in particolare).

21 Random coil (o loop) I random coil (come i reverse turn) oltre ad avere la funzione di collegare elementi di struttura secondaria, possono anche partecipare alla formazione di siti di legame e di siti attivi negli enzimi, per cui sono disordinati in assenza della molecola specifica e ordinati in presenza della molecola che legano. Kinemages: Bchl_prot / Porin

22 Le proteine fibrose

23 Macromolecole Biologiche Kinemage E04/1-2 Coiled-coil α elica L α α elica coiled-coil è un motivo strutturale costituito da 2 o 3 α eliche, che si attorcigliano a formare una superelica sinistrorsa. Il motivo base dell α elica coiled-coil è la ripetizione di un eptapeptide (a-g), in cui spesso le posizioni a e d sono occupate da aminoacidi idrofobici, attraverso i quali le α eliche interagiscono. f b c e g d a a' d' g' e' c' b' f' Un certo numero di proteine fibrose ha questa caratteristica ti e usa i coiled-coil per formare oligomeri (soprattutto dimeri e trimeri): miosina, fibrinogeno, distrofina, cheratina, proteine neurofilamentose.

24 Coiled-coil α elica: cheratina La cheratina è una proteina meccanicamente resistente e chimicamente non reattiva. E la principale componente dello strato di epidermide più esterno, dei capelli, delle corna, delle unghie e delle piume. α cheratina (mammiferi) i) β cheratina (uccelli e rettili) Il capello (circa 20 μm di diametro), costituito principalmente di α cheratina, consiste di una gerarchia di strutture: Å - microfibrille (80 Å diametro) - macrofibrille (2000 Å diametro)

25 Coiled-coil α elica: cheratina Ogni molecola di α cheratina è costituita da 310 aminoacidi che formano la superelica coiled-coil, con entrambe le estremità N- e C-terminali globulari. Le supereliche si assemblano a formare il protofilamento (30 Å di diametro), costituito da 2 file antiparallele di supereliche allineate in modalità testacoda. Due protofilamenti formano la protofibrilla e 4 di esse formano la microfibrilla. L α cheratina è ricca di cisteine, iti che formano ponti disolfuro che collegano catene polipeptidiche adiacenti, rendendola insolubile e resistente all allungamento.

26 Coiled-coil α elica: actina emiosina Kinemage Leu_Zipper La molecola di miosina è un dimero costituito da due catene pesanti (MW 230 kda) e quattro catene leggere (MW 20 kda) e forma una coda lunga 1400 Å e due teste. Frammenti di miosina, costituiti da due catene leggere e la parte N-terminale di una delle catene pesanti, si possono separare e costituiscono il sottoframmento S1.

27 Fibroina della seta L analisi della sequenza delle fibrine della seta ha mostrato la presenza di un motivo comune: domini variabili alle estremità N- e C-terminali, affiancati da ampie regioni (fino a 800 aminoacidi) caratterizzate dalla ripetizione del motivo (-Gly-Ser-Gly-Ala-Gly-Ala) n. Questi tratti ripetitivi di catena polipeptidica formano foglietti β,in cui gli aminoacidi Gly si trovano su un lato del foglietto β e Ala/Ser sull altro lato.

28 Fibroina i dll della seta I foglietti β si impilano uno sull altro, in modo tale che le superfici con gli aminoacidi Gly siano in contatto le une con le altre, alternate a superfici con Ala/Ser, anch esse in contatto. In questo modo la distanza fra i foglietti β è alternativamente pari a 3.5 Å e a 5.7 Å. Lo stretto impaccamento dif dei foglietti i β non permette la presenza di aminoacidi diversi da Gly, Ala o Ser. La presenza di altri aminoacidi (Tyr, Val, Gln, Arg e Asp) distorce e rende disordinato questo impaccamento (zone non ordinate).

29 La struttura supersecondaria

30 La struttura supersecondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria Struttura supersecondaria

31 La struttura supersecondaria Elementi di struttura secondaria si combinano a costituire aggregati locali con geometria specifica, che definiscono la struttura supersecondaria (o motivi). Alcuni di questi motivi si possono associare ad una particolare funzione, come ad esempio il legame del DNA, mentre altri non hanno una funzione biologica specifica, ma sono semplicemente parte di organizzazioni strutturali più ampie e complesse. I principali motivi individuati nelle proteine sono: - motivi α - motivi β - motivi α/β

32 Motivi α Nonostante siano le strutture secondarie più frequenti nelle proteine, le α eliche isolate non sono stabili in soluzione. Nelle strutture terziarie delle proteine le α eliche si impaccano in modo adiacente una all altra attraverso interazioni tra le catene laterali idrofobiche. Iprincipalimotivi α sono: - α-loop-α - EF hand

33 Motivi α: α-loop-α Il motivo α più semplice consiste di 2 α eliche antiparallele collegate da una regione di loop, chiamato α hairpin. i La più breve connessione fra 2 α eliche coinvolge 2aminoacidi, di cui il secondo è sempre Gly, orientati perpendicolarmente agli assi delle eliche. Le eliche risultano cosi antparallele, e sono stabilizzate dall interazione dei loro macrodipoli. N C

34 Motivi α: α-loop-α Un particolare motivo α-loop-α è caratteristico di alcune proteine che riconoscono e legano specifiche zone di DNA. (noto anche come motivo HTH) In particolare, una di queste 2 eliche si va ad inserire nel solco maggiore del DNA, e riconosce le basi nucleotidiche, mentre l altra interagisce con i gruppi fosfato dello scheletro desossiribosio-fosfato. Kinemage... Exercises/E19

35 Motivi α: EF hand Il secondo motivo α è specifico per il legame del calcio ed è presente in proteine che legano il calcio quali parvalbumina, calmodulina e troponina C, che regolano l attività cellulare. Questo particolare motivo, trovato per la prima volta nella parvalbumina, viene chiamato EF hand. Il loop fra le 2 eliche lega lo ione Ca 2+ Kinemage Cam

36 Motivi α: EF hand Gli aminoacidi che costituiscono il loop devono avere particolari caratteristiche per formare questo motivo α: - i primi 5 aminoacidi legano il calcio e le loro catene laterali devono possedere cariche negative (Asp e Glu); - il sesto aminoacido deve essere Gly; - un certo numero di aminoacidi devono essere idrofobici per formare una piccola zona idrofobica fra le 2 α eliche.

37 Motivi β: β-hairpin Il motivo β più semplice è quello costituito da 2 filamenti β antiparalleli adiacenti collegati da un tratto di loop. Questo motivo, chiamato β-hairpin o unità β β, β ricorremoltofrequentemente nelle strutture β antiparallele, come motivo isolato o come parte di un foglietto β più complesso. La lunghezza del tratto di loop tra i filamenti β èvariabile, ma di solito è costituito da 2-5 aminoacidi (v. reverse-turns, come elementi di struttura secondaria). A questo motivo β non è associata nessunana funzione specifica.

38 Motivi α/β: Cross over connection Alla base dei motivi α/β sta il modo in cui 2 filamenti β paralleli vengono collegati. Due filamentii β paralleli li adiacenti i di solito sono connessi daun α elica, che collega l estremità C-terminale del primo filamento β con l estremità N- terminale del secondo filamento β, in modo tale che l asse dell elica sia parallelo ai filamenti β. Questo motivo β-α-β β viene chiamato cross-overover connection.

39 Motivi α/β: Cross over connection La cross over connection consiste di di due filamenti β paralleli, un α elica e due loop (che possono variare notevolmente in lunghezza). L α elica si impacca con i 2 filamenti β, riparando dal solvente gli aminoacidi idrofobici dei filamenti β. La cross over connection può essere considerata come un largo giro di superelica, a partire dal primo filamento β, attraverso la connessione, fino al secondo filamento β. La cross over connection può essere di tipo destrorso (a) o sinistrorso (b). Quasi tutte le proteine presentano una cross over connection destrorsa.

40 Kinemage... Richardson/Protour1.kin (kins 2,3) Motivi α/β: Cross over connection Di solito le proteine presentano cross-over connection di tipo destrorso, in Di solito le proteine presentano cross over connection di tipo destrorso, in modo tale da meglio adattarsi al twist destrorso tipico dei foglietti β. (oppure: il twist destrorso dei foglietti β favorisce la formazione delle crossover connection destrorse)

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 11 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici.

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 1 Il carbonio deve acquistare quattro elettroni per essere stabile

Dettagli

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte

Dettagli

Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli