Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra)."


1 Strutture secondarie (b)

2 Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica, la conformazione più ricorrente adottata dalla catena polipeptidica delle proteine è il foglietto β: circa il % degli aminoacidi nelle proteine globulari conosciute ricorre in questa conformazione. Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella zona permessa dl del plot tdi Ramachandran (quadrante in alto a sinistra).

3 Filamento β L unità costituente i foglietti β èilfilamento β (βstrand), lungo in media da 5 a 10 aminoacidi, con la catena polipeptidica p p quasi completamente estesa. I foglietti β nelle proteine globulari sono costituiti da 2 a 15 filamenti β abbinati lateralmente, con un valor medio di 6. Il filamento β si può considerare un tipo speciale di elica, con n = 2 residui per giro e una traslazione d = 3.4 Å per aminoacido. I filamenti β sono allineati uno vicino all altro, in modo tale che si possano formare legami idrogeno tra i gruppi CO di un filamento eigruppi NH del filamento β adiacente e viceversa.

4 Foglietto β I foglietti β formati da un certo numero di filamenti β sono pieghettati (pleated), con gli atomi C α degli aminoacidi adiacenti alternativamente leggermente sopra e sotto il piano del foglietto β, dando al foglietto β l apparenza di un foglietto pieghettato. Le catene laterali degli aminoacidi che compongono il foglietto β seguono lo stesso andamento, per cui puntano alternativamente sopra e sotto il foglietto β. Spesso un foglietto β può presentare tutte le catene laterali polari su una faccia e tutte le catene laterali non polari sull altra (ideale per costruire la superficie delle proteine).

5 Foglietto β I foglietti β differiscono dalle α eliche: -la catena polipeptidica del foglietto β è quasi completamente estesa piuttosto che essere avvolta aspirale; -le interazioni (legami idrogeno e interazioni di van der Waals) sono fra aminoacidi appartenenti a filamenti β differenti, anche distanti in sequenza, mentre nelle α eliche le interazioni si hanno esclusivamente fra aminoacidi idi vicini iii in sequenza;

6 ..\ANIMATED_Lessons_V&V\8-1c_H-BondingInB-Sheeets-b3\HBondingBSheets.htm Foglietto β (v (v. Animated_Lesson 8_1c) I filamenti β possono interagire fra loro a formare i foglietti β in due modi diversi: - gli aminoacidi nei filamenti β adiacenti hanno direzioni alternate (N-term C-term seguito da C-term N-term seguito da N-term C-term, ) esi parla di foglietto β antiparallelo; -gli aminoacidi nei filamenti β allineati vanno tutti nella stessa direzione (sempre N-term C-term) esi parla di foglietto β parallelo.

7 Foglietto β antiparallelo Angoli diedri (φ, ψ) = ( , 135 ) ). Coppie di legami idrogeno poco spaziate si alternano a coppie largamente spaziate. Tali legami idrogeno sono paralleli fra loro e perpendicolari alla direzione dei filamenti β. Idipoli associati alle unità peptidiche costituenti un filamento β si annullano.

8 Foglietto β parallelo Angoli diedri (φ, ψ) = ( , 113 ) ). Coppie di legami idrogeno uniformemente spaziati, non sono paralleli fra loro né perpendicolari alla direzione dei filamenti β. I dipoli associati alle unità peptidiche costituenti un filamento β si annullano. I foglietti β paralleli sono meno frequenti di quelli antiparalleli.

9 Foglietto β misto I filamenti β si possono anche combinare aformare un foglietto β misto, con alcune coppie di filamenti antiparalleli ed altre paralleli. I foglietti β misti sono meno frequenti dei foglietti β antiparalleli e paralleli.

10 Kinemage beta-structure large Foglietto β Tutti i foglietti β osservati (paralleli, antiparalleli e misti) presentano una torsione (twist) destrorsa (fino a30 ) di ciascun filamento β che li compone. Tale particolare geometria osservata nei foglietti β sarebbe il risultato di un compromesso tra l ottimizzazione dell energia conformazionale delle catene polipeptidiche costituenti i filamenti β e il mantenimento della geometria dei legami idrogeno.

11 Kinemage E03/3 Foglietto β Talvolta i foglietti β presentano delle irregolarità, dette β-bulge (protuberanza). Un β-bulge è la zona compresa fra due legami idrogeno consecutivi fra due filamenti β e comprende due aminoacidi appartenenti ad un filamento β, opposti ad un solo aminoacido appartenente al filamento β adiacente. La presenza del β-bulge accentua a livello locale la torsione del foglietto β. Il ruolo del β-bulge è quello di compensare leffetto l effetto dell inserzione/delezione di un aminoacido senza provocare la distruzione della struttura β. Il β-bulge g si osserva principalmente p nei foglietti β antiparalleli, mentre solo nel 5%dei casi in quelli paralleli.

12 Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni sono dovute alla presenza di un comune elemento strutturale, chiamato reverse turn. Gli aminoacidi coinvolti nella formazione dei reverse turn si trovano generalmente sulla superficie delle proteine e hanno natura polare e/o carica. Esistono vari tipi di reverse turn, a seconda del numero di aminoacidi che li costituiscono e degli elementi di struttura secondaria che collegano: β-turn γ-turn Ω-loop

13 Reverse turn β-turn E il tipo di turn più comune per collegare due filamenti β antiparalleli adiacenti. In questo caso sono due gli aminoacidi non coinvolti nei legami idrogenotraifilamentiβ. β Ogni β-turn è caratterizzato da un legame idrogeno fra il gruppo CO dell aminoacido 1 e il gruppo NH dell aminoacido 4, anche se spesso si osservano deviazioni (fino a 30 ) da questa conformazione ideale che impediscono la formazione di questo legame idrogeno. Spesso in posizione 1 si trovano gli aminoacidi Asn, Asp, Ser e Cys, le cui catene laterali possono formare legami idrogeno con il gruppo NH dell aminoacido id in posizione ii 3. Esistono 3 tipi di β-turn: tipo I, tipo II e tipo III.

14 β-turn Tipo I Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-90, 0 ) 3 4 I β-turn di tipo I si possono considerare un breve tratto distorto di elica Nei β-turn di tipo I l aminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta. Essi sono circa 2-3 volte più frequenti di quelli di tipo II. 2 1

15 Kinemages: Bchl_prot / Porin β-turn 4 Tipo II Angoli diedri (φ, ψ) 2 = (-60, 120 ) Angoli diedri (φ, ψ) 3 = (90, 0 ) 3 I β-turnditipoiidifferisconoda quelli di tipo I per un flip di 180 dell unità peptidica che collega gli 2 aminoacidi in posizione 2 e 3. 1 Nei β-turnditipoiil aminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta, mentre l aminoacido in posizione 3 spesso è una Gly, per evitare che l atomo di carbonio della catena laterale sia troppo vicino all atomo atomo di ossigeno dell aminoacido in posizione 2.

16 Kinemage E03/4 β-turn meno frequenti Tipo III Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-60, -30 ) I β-turn di tipo III sono costituiti da un breve tratto di catena polipeptidica che assume la conformazione dell elica Tipo I, tipo II, tipo III Esistono anche le varianti I, I, II e III, che costituiscono l immagine speculare della catena polipeptidica principale (ma non delle catene laterali!) rispettivamente dei β-turn di tipo I, II e III.

17 β-turn

18 Reverse turn (raro) γ-turn Si osserva quando solo un aminoacido non è coinvolto nei legami idrogeno caratteristici del foglietto β. E caratterizzato da un legame idrogeno fra il gruppo CO dell aminoacido i e il gruppo NH dell aminoacido i+2. Questo tipo di turn, piuttosto stretto, richiede una geometria poco favorevole per il legame idrogeno e inusuali valori degli angoli diedri per l aminoacido i+1 (φ = 70, ψ = -60 ).

19 Reverse turn Ω-loop Quasi tutte le proteine globulari con un numero di aminoacidi superiore a 60 contengono uno o più loop lunghi da 6 a 16 aminoacidi, le cui estremità distano meno di 10 Å. Tali loop sono chiamati Ω-loop, perché hanno la forma della lettera greca omega maiuscola. Gli Ω-loop hanno una forma compatta e non disordinata poiché le catene laterali degli aminoacidi che li compongono tendono a riempire le loro cavità interne, rendendoli piuttosto stabili. Gli Ω-loop sono spesso localizzati sulla superficie delle proteine e possono avere un importante ruolo nel riconoscimento intermolecolare.

20 Random coil (o loop) Le regioni della catena polipeptidica che non assumono alcun tipo di struttura secondaria (α-elica, struttura β, reverse turn) vengono chiamate random coil (o loop). Essi hanno una struttura tt irregolare nel senso che le coppie (φ, ψ) ) degli aminoacidi che li compongono assumono valori tra i più svariati e non costanti. I random coil sono generalmente flessibili e possono adottare diverse conformazioni: per questo motivo molto spesso sono difficili da rilevare sperimentalmente. Per esempio: estremità N- e C-terminali, zone particolarmente ricche di aminoacidi carichi (Lys in particolare).

21 Random coil (o loop) I random coil (come i reverse turn) oltre ad avere la funzione di collegare elementi di struttura secondaria, possono anche partecipare alla formazione di siti di legame e di siti attivi negli enzimi, per cui sono disordinati in assenza della molecola specifica e ordinati in presenza della molecola che legano. Kinemages: Bchl_prot / Porin

22 Le proteine fibrose

23 Macromolecole Biologiche Kinemage E04/1-2 Coiled-coil α elica L α α elica coiled-coil è un motivo strutturale costituito da 2 o 3 α eliche, che si attorcigliano a formare una superelica sinistrorsa. Il motivo base dell α elica coiled-coil è la ripetizione di un eptapeptide (a-g), in cui spesso le posizioni a e d sono occupate da aminoacidi idrofobici, attraverso i quali le α eliche interagiscono. f b c e g d a a' d' g' e' c' b' f' Un certo numero di proteine fibrose ha questa caratteristica ti e usa i coiled-coil per formare oligomeri (soprattutto dimeri e trimeri): miosina, fibrinogeno, distrofina, cheratina, proteine neurofilamentose.

24 Coiled-coil α elica: cheratina La cheratina è una proteina meccanicamente resistente e chimicamente non reattiva. E la principale componente dello strato di epidermide più esterno, dei capelli, delle corna, delle unghie e delle piume. α cheratina (mammiferi) i) β cheratina (uccelli e rettili) Il capello (circa 20 μm di diametro), costituito principalmente di α cheratina, consiste di una gerarchia di strutture: Å - microfibrille (80 Å diametro) - macrofibrille (2000 Å diametro)

25 Coiled-coil α elica: cheratina Ogni molecola di α cheratina è costituita da 310 aminoacidi che formano la superelica coiled-coil, con entrambe le estremità N- e C-terminali globulari. Le supereliche si assemblano a formare il protofilamento (30 Å di diametro), costituito da 2 file antiparallele di supereliche allineate in modalità testacoda. Due protofilamenti formano la protofibrilla e 4 di esse formano la microfibrilla. L α cheratina è ricca di cisteine, iti che formano ponti disolfuro che collegano catene polipeptidiche adiacenti, rendendola insolubile e resistente all allungamento.

26 Coiled-coil α elica: actina emiosina Kinemage Leu_Zipper La molecola di miosina è un dimero costituito da due catene pesanti (MW 230 kda) e quattro catene leggere (MW 20 kda) e forma una coda lunga 1400 Å e due teste. Frammenti di miosina, costituiti da due catene leggere e la parte N-terminale di una delle catene pesanti, si possono separare e costituiscono il sottoframmento S1.

27 Fibroina della seta L analisi della sequenza delle fibrine della seta ha mostrato la presenza di un motivo comune: domini variabili alle estremità N- e C-terminali, affiancati da ampie regioni (fino a 800 aminoacidi) caratterizzate dalla ripetizione del motivo (-Gly-Ser-Gly-Ala-Gly-Ala) n. Questi tratti ripetitivi di catena polipeptidica formano foglietti β,in cui gli aminoacidi Gly si trovano su un lato del foglietto β e Ala/Ser sull altro lato.

28 Fibroina i dll della seta I foglietti β si impilano uno sull altro, in modo tale che le superfici con gli aminoacidi Gly siano in contatto le une con le altre, alternate a superfici con Ala/Ser, anch esse in contatto. In questo modo la distanza fra i foglietti β è alternativamente pari a 3.5 Å e a 5.7 Å. Lo stretto impaccamento dif dei foglietti i β non permette la presenza di aminoacidi diversi da Gly, Ala o Ser. La presenza di altri aminoacidi (Tyr, Val, Gln, Arg e Asp) distorce e rende disordinato questo impaccamento (zone non ordinate).

29 La struttura supersecondaria

30 La struttura supersecondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria Struttura supersecondaria

31 La struttura supersecondaria Elementi di struttura secondaria si combinano a costituire aggregati locali con geometria specifica, che definiscono la struttura supersecondaria (o motivi). Alcuni di questi motivi si possono associare ad una particolare funzione, come ad esempio il legame del DNA, mentre altri non hanno una funzione biologica specifica, ma sono semplicemente parte di organizzazioni strutturali più ampie e complesse. I principali motivi individuati nelle proteine sono: - motivi α - motivi β - motivi α/β

32 Motivi α Nonostante siano le strutture secondarie più frequenti nelle proteine, le α eliche isolate non sono stabili in soluzione. Nelle strutture terziarie delle proteine le α eliche si impaccano in modo adiacente una all altra attraverso interazioni tra le catene laterali idrofobiche. Iprincipalimotivi α sono: - α-loop-α - EF hand

33 Motivi α: α-loop-α Il motivo α più semplice consiste di 2 α eliche antiparallele collegate da una regione di loop, chiamato α hairpin. i La più breve connessione fra 2 α eliche coinvolge 2aminoacidi, di cui il secondo è sempre Gly, orientati perpendicolarmente agli assi delle eliche. Le eliche risultano cosi antparallele, e sono stabilizzate dall interazione dei loro macrodipoli. N C

34 Motivi α: α-loop-α Un particolare motivo α-loop-α è caratteristico di alcune proteine che riconoscono e legano specifiche zone di DNA. (noto anche come motivo HTH) In particolare, una di queste 2 eliche si va ad inserire nel solco maggiore del DNA, e riconosce le basi nucleotidiche, mentre l altra interagisce con i gruppi fosfato dello scheletro desossiribosio-fosfato. Kinemage... Exercises/E19

35 Motivi α: EF hand Il secondo motivo α è specifico per il legame del calcio ed è presente in proteine che legano il calcio quali parvalbumina, calmodulina e troponina C, che regolano l attività cellulare. Questo particolare motivo, trovato per la prima volta nella parvalbumina, viene chiamato EF hand. Il loop fra le 2 eliche lega lo ione Ca 2+ Kinemage Cam

36 Motivi α: EF hand Gli aminoacidi che costituiscono il loop devono avere particolari caratteristiche per formare questo motivo α: - i primi 5 aminoacidi legano il calcio e le loro catene laterali devono possedere cariche negative (Asp e Glu); - il sesto aminoacido deve essere Gly; - un certo numero di aminoacidi devono essere idrofobici per formare una piccola zona idrofobica fra le 2 α eliche.

37 Motivi β: β-hairpin Il motivo β più semplice è quello costituito da 2 filamenti β antiparalleli adiacenti collegati da un tratto di loop. Questo motivo, chiamato β-hairpin o unità β β, β ricorremoltofrequentemente nelle strutture β antiparallele, come motivo isolato o come parte di un foglietto β più complesso. La lunghezza del tratto di loop tra i filamenti β èvariabile, ma di solito è costituito da 2-5 aminoacidi (v. reverse-turns, come elementi di struttura secondaria). A questo motivo β non è associata nessunana funzione specifica.

38 Motivi α/β: Cross over connection Alla base dei motivi α/β sta il modo in cui 2 filamenti β paralleli vengono collegati. Due filamentii β paralleli li adiacenti i di solito sono connessi daun α elica, che collega l estremità C-terminale del primo filamento β con l estremità N- terminale del secondo filamento β, in modo tale che l asse dell elica sia parallelo ai filamenti β. Questo motivo β-α-β β viene chiamato cross-overover connection.

39 Motivi α/β: Cross over connection La cross over connection consiste di di due filamenti β paralleli, un α elica e due loop (che possono variare notevolmente in lunghezza). L α elica si impacca con i 2 filamenti β, riparando dal solvente gli aminoacidi idrofobici dei filamenti β. La cross over connection può essere considerata come un largo giro di superelica, a partire dal primo filamento β, attraverso la connessione, fino al secondo filamento β. La cross over connection può essere di tipo destrorso (a) o sinistrorso (b). Quasi tutte le proteine presentano una cross over connection destrorsa.

40 Kinemage... Richardson/Protour1.kin (kins 2,3) Motivi α/β: Cross over connection Di solito le proteine presentano cross-over connection di tipo destrorso, in Di solito le proteine presentano cross over connection di tipo destrorso, in modo tale da meglio adattarsi al twist destrorso tipico dei foglietti β. (oppure: il twist destrorso dei foglietti β favorisce la formazione delle crossover connection destrorse)

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse



30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio


La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena


sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina


Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro


Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia


gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-


Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi


Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale


LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche


Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro


Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi


Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole


Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina


LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici


Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi


Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica



PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine


Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una


Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine





Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione


Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche


scaricato da Proteine semplici costituite dai soli amminoacidi

scaricato da Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità



RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi


La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso



L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami


Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.


I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica


Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:


Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari


Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico


formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte


Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati


Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE



Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 11 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità


Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono



INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali


Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi



COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA


La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza


Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)



STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica


α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della


Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina


Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale


30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,



SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)



CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%



CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p


I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei


Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.


Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti


MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine


Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica


LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (


le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con


amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico


Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina


MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole


Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi





COMPOSIZIONE: - Semplici - Coniugate: Apolipoproteine Glicoproteine Nucleoproteine Metalloproteine Cromoproteine STRUTTURA: - Fibrose forma molecolare allungata struttura II - Globulari: forma molecolare


Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle


I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni I LEGAMI CIMICI In natura sono pochi gli elementi che presentano atomi allo stato libero. Gli unici elementi che sono costituiti da atomi isolati si chiamano gas nobili o inerti, formano il gruppo VIII


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente


Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,



STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche


OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ Scaricato da Le proteine con peso molecolare superiore a 50.000 sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ 1 Scaricato da Le proteine oligomeriche


La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi


1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:


Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani



BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi


Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare





Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza



ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3



LA CHIMICA DELLA VITA LA CHIMICA DELLA VITA L elemento presente in tutte le molecole caratteristiche degli esseri viventi è IL CARBONIO Il carbonio ha numero atomico 6 (Z=6). Ha valenza 4: ai suoi atomi mancano 4 elettroni


La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono



LIVELLI DI STRUTTURA DELLE PROTEINE FUNZIONI E STRUTTURA DELLE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 LIVELLI



GLI ELEMENTI STRUTTURALI DELLE PROTEINE CAPITOLO 3 GLI ELEMENTI STRUTTURALI DELLE PROTEINE Gli elementi di struttura secondaria si possono ricondurre sostanzialmente a tre diverse tipologie (Fig. 1): - α-elica - filamenti β - anse o ripiegamenti


9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione


L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno


CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina CROMATINA Complesso molecolare formato da DNA, istoni e proteine non istoniche ISTONI Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina Si conoscono


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo


Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare


Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA Nucleotidi e Acidi Nucleici Nucleosidi Nucleotidi Funzioni biologiche dei nucleotidi Struttura di DNA e RNA Concatenazione e appaiamento dei nucleotidi Lo scheletro degli acidi nucleici Componenti degli


ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara ATOMI E MOLECOLE Psicobiologia Lezione nr. 1 Prof. Lasaponara La struttura dell atomo I legami chimici e le molecole I componenti elementari della materia vivente 20 miliardi di anni fa Caratteristiche



IL LEGAME SIGMA σ E IL LEGAME PI- GRECO π IL LEGAME SIGMA σ E IL LEGAME PI- GRECO π La teoria di Lewis considera gli elettroni di valenza degli atomi che formano legami,ma prescinde totalmente dal fatto che tali elettroni sono descritti da orbitali


Il DNA conserva l informazione genetica

Il DNA conserva l informazione genetica Il DNA conserva l informazione genetica Gli esperimenti di Frederick Griffith (1928) Gli esperimenti di Oswald Avery (1944) + Estratti dal ceppo IIIS ucciso al calore di Polisaccaridi Lipidi Proteine Acidi


Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»


Lezione 1: Atomi e molecole:

Lezione 1: Atomi e molecole: Lezione 1: Atomi e molecole: La materia è costituita da elementi chimici in forma pura o in combinazioni dette composti. La vita richiede circa 25 elementi chimici. La struttura atomica determina il comportamento


20/12/2013. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/12/2013. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Importanza dei legami non covalenti in Biologia Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di


La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N


Ruolo del calcio nella cellula

Ruolo del calcio nella cellula Ruolo del calcio nella cellula I meccanismi evolutivi hanno attribuito agli ioni fosfato un importanza fondamentale poiché sono necessari per sintetizzare ATP. Per questo motivo la loro concentrazione
