Macromolecole Biologiche Interazioni non covalenti

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Macromolecole Biologiche Interazioni non covalenti"

Transcript

1 Interazioni non covalenti D H A δ - δ + δ -

2 Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto a 83 kcal/mol per un legame C C). Questi legami deboli possono formarsi sia fra parti diverse della stessa macromolecola, sia fra parti di macromolecole diverse. Essi giocano un ruolo fondamentale in molti processi biologici, fra cui la fedele replicazione del DNA, il folding delle proteine, il riconoscimento specifico di substrati da parte di enzimi, il riconoscimento di molecole segnale. Le interazioni non covalenti si possono classificare in: - interazioni elettrostatiche - legami idrogeno - interazioni di van der Waals - effetto idrofobico

3 Le interazioni non covalenti Energie di legame associate alle principali interazioni non covalenti: Tipo di interazione non covalente Energia di legame (kcal/mole) Interazioni elettrostatiche Legame idrogeno Interazioni di van der Waals Nel considerare i vari contributi energetici che stabilizzano una proteina non si può prescindere dal fatto che la proteina è immersa in un solvente, che è costituito principalmente da acqua. Le proprietà fisiche del solvente sono estremamente importanti per la stabilità della proteina.

4 Effetto idrofobico Le interazioni fra acqua e superfici non polari non sono favorevoli: proprio come l olio disperso nell acqua tende a raccogliersi in un unica goccia, anche i gruppi non polari nelle proteine tendono ad aggregarsi, per ridurre la superficie apolare a contatto con l acqua. Questa preferenza di specie non polari per ambienti non acquosi viene detto effetto idrofobico: esso è uno dei principali fattori di stabilità delle proteine. L effetto idrofobico fa sì che sostanze non polari minimizzino il loro contatto con l acqua, e molecole anfipatiche (come per esempio i detergenti) formino micelle in soluzioni acquose. Il meccanismo fisico per cui entità non polari sono escluse da soluzioni acquose è di carattere entropico.

5 Effetto idrofobico Le molecole d acqua allo stato liquido formano dinamicamente un alto numero di legami idrogeno, in funzione della temperatura. L introduzione di una molecola non polare nell acqua liquida crea una sorta di cavità nell acqua, che temporaneamente rompe alcuni legami idrogeno fra le molecole d acqua, poiché un gruppo non polare non può né accettare né donare legami idrogeno con le molecole d acqua. Le molecole d acqua spostate si riorientano per formare il maggior numero di nuovi legami idrogeno, creando una struttura ordinata, una specie di gabbia, detta clatrato, intorno alla molecola non polare.

6 Effetto idrofobico Poiché il numero di modi con cui le molecole d acqua formano legami idrogeno sulla superficie di un gruppo non polare è inferiore a quello che farebbero in sua assenza si ha una diminuzione di entropia del sistema. Anche se, da un punto di vista entalpico, il sistema clatrato è più stabile (ΔH < 0, per una debole liberazione di energia dovuto alla formazione di legami idrogeno ed interazioni di van der Waals), globalmente: ΔG = ΔH TΔS > 0 processo non spontaneo Quindi perchè il processo sia spontaneo (DG<0) occorre l aggregazione dei gruppi non polari in modo da minimizzare l area superficiale della cavità occupata dal gruppo apolare e quindi la perdita di entropia del sistema. acqua C 6 H 14 C 6 H 14 acqua 2xC 6 H 14

7 Effetto idrofobico & Folding L effetto idrofobico rappresenta una interazione chiave per il folding delle proteine, in cui residui con catene laterali idrofobiche si ripiegano verso l interno della proteina lasciando esposti al solvente in superficie residui polari. Ribosoma Proteina estesa (unfolded) (U) Unfolded Molten globule ΔG FOLDING = G F G U = ΔH TΔS Proteina globulare (folded) Folded (F) < 0 processo spontaneo di folding > 0 processo non spontaneo

8 Effetto idrofobico & Folding ΔH = variazione di entalpia fra stato finale ed iniziale (interazioni di van der Waals, elettrostatiche, legami idrogeno). ΔH risulta << 0. T = temperatura assoluta (K) ΔG FOLDING = G F -G U = ΔH - T(S F -S U ) ΔS = variazione di entropia (disordine del sistema) fra stato finale ed iniziale. Poiché S U >> S F ΔS << 0 Nel ΔG FOLDING il contributo TΔS è positivo e sia ΔH che TΔS assumono valori grandi (migliaia di kcal/mol). Al contrario ΔG FOLDING ha valori piccoli: ΔG FOLDING = -10, -15 kcal/mol Quindi il processo di folding avviene grazie ad un minimo prevalere di ΔH su TΔS; è sufficiente un piccolo aumento di T per causare denaturazione della proteina.

9 Effetto idrofobico & Folding Responsabile della variazione di entropia è l effetto idrofobico. ΔS FOLDING = S F S U = ΔS CATENA + ΔS SOLVENTE sempre < 0 Nel caso di un soluto apolare in un mezzo acquoso, le molecole d acqua che formano il clatrato attorno alla molecola apolare sono caratterizzate da una variazione di entropia negativa. Spontaneamente le molecole apolari si riuniscono in modo da minimizzare la variazione negativa di ΔS SOLVENTE. Nel caso del folding proteico, si formano tasche idrofobiche prive di molecole d acqua che, nella forma proteica unfolded erano coinvolte nella formazione dei clatrati attorno alle catene laterali degli aminoacidi idrofobici.

10 Effetto idrofobico Superficie accessibile al solvente di una proteina (o di catena laterale) La superficie proteica è definita dall insieme dei punti degli atomi esterni, ciascuno descritto come una sfera rigida avente come raggio il raggio di van der Waals (superficie di van der Waals). Le molecole d acqua sono considerate sfere con raggio di van der Waals pari a 1.4 Å. La superficie accessibile al solvente (ASA) è definita come l area descritta dal centro di una molecola d acqua che rotola sopra la superficie di van der Waals della proteina (o della catena laterale). superficie di van der Waals

11 Effetto idrofobico Superficie accessibile al solvente di una proteina (o di catena laterale) La superficie accessibile al solvente non corrisponde a quella di van der Waals della proteina. Infatti, esistono zone della proteina (o della catena laterale) non accessibili alla molecola d acqua usata come probe : per esempio le fenditure.

12 Effetto idrofobico ΔG di trasferimento delle catene laterali degli aminoacidi E stato misurato il ΔG di trasferimento di ciascun aminoacido dall acqua ad un solvente organico (per esempio etanolo o diossano). Per avere la misura del ΔG di trasferimento della sola catena laterale, bisogna non considerare il contributo della catena principale (che falserebbe la misura, avendo sempre una carica negativa del gruppo carbossilico COO - e una positiva del gruppo aminico NH 3+ ). Ciò equivale a sottrarre dal valore di ΔG di trasferimento di ciascun aminoacido il ΔG di trasferimento della Gly. ΔG cat.lat. = ΔG aa - ΔG Gly

13 Effetto idrofobico Esiste una relazione lineare tra ΔG di trasferimento (dall acqua ad un solvente apolare) e superficie accessibile al solvente per catene laterali completamente non polari. Nel caso di aminoacidi moderatamente polari (Thr, Ser, Met, Tyr e Trp) una relazione analoga è relativamente valida, applicando una diminuzione di circa 1.5 kcal/mole nel ΔG di trasferimento.

14 Effetto idrofobico Si può quindi dire che il ΔG di trasferimento è proporzionale alla superficie non polare accessibile al solvente. La costante di proporzionalità (coefficiente angolare della retta) vale: kcal/mole Å 2. Questo significa che si guadagnano kcal/mole (o equivalentemente 25 cal/mole) per ogni Å 2 di superficie non polare che si seppellisce nel cuore di una proteina.

15 Effetto idrofobico Correlazione effetto idrofobico con la temperatura Si consideri il trasferimento di una molecola A da un solvente organico ad uno polare (acqua). ΔG = ΔH TΔS ΔG = RT lnk Quindi: RT lnk = ΔH TΔS [A] H2O K = [A] ORG Org H 2 O A ΔH ΔS lnk = + RT R relazione di van t Hoff

16 Effetto idrofobico Correlazione effetto idrofobico con la temperatura ΔH ΔS lnk = + relazione di van t Hoff RT R Esiste quindi una relazione lineare fra lnk e 1/T. [A] H2O K = [A] ORG All aumentare di T, lnk (e quindi K) diminuisce aumenta la concentrazione di A ORG. L effetto idrofobico è favorito dall aumento della temperatura T (naturalmente deve essere complessivamente ΔG < 0).

17

18 Il legame peptidico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. Il legame peptidico C N si ha quando il gruppo carbossilico di un peptide condensa con il gruppo amminico del peptide successivo mediante l eliminazione di una molecola d acqua. Le proteine sono molecole che consistono di una o più catene polipeptidiche.

19 Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H

20 Il legame peptidico Il legame peptidico C N è 0.13 Å più corto del legame singolo N C α e 0.08 Å più lungo di un doppio legame C=N. Il legame peptidico, quindi, presenta per il 60 % una natura di legame singolo e per il 40 % una natura di legame doppio.

21 Il legame peptidico Generalmente il gruppo peptidico assume la conformazione trans trans -atomi (C α ) n e (C α ) n+1 opposti rispetto al legame peptidico C N. In alcuni casi il gruppo peptidico può assume la conformazione cis (~8 kj mol -1 meno stabile della conformazione trans. Problemi sterici, perché distanza C α -C α = 2.8 Å). cis

22 Il legame peptidico Il gruppo peptidico ha un momento di dipolo. O Gli atomi O e N sono rispettivamente più elettronegativi di C ed H. La conseguente delocalizzazione di carica porta alla formazione di due dipoli (CO ed NH) con analoga direzione e verso nel gruppo peptidico. C N Il momento di dipolo risultante è di circa 3.5 Debye. H

23 Il legame peptidico Come si ricava il valore del momento di dipolo del gruppo peptidico: momento dipolo C=O (frazione di carica distanza atomi C ed O): μ A = = 0.52 eå momento dipolo N H (frazione di carica distanza atomi N ed H): μ B = = 0.20 eå Il momento di dipolo risultante sarà dato dalla somma: μ = μ A + μ B = 0.72 eå Nel sistema internazionale il momento di dipolo è espresso in Cm, quindi: = Cm carica e - Åin metri poiché 1 Debye = Cm, ne deriva che Cm equivale a circa 3.5 Debye.

24 Il legame peptidico I polipeptidi sono catene lineari in cui ciascun aminoacido è legato al suo prossimo in modo coda-testa, senza formare diramazioni. La catena si dice estendersi dal suo termine amminico (N-terminale) al suo termine carbossilico (C-terminale). La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro polipeptidico da cui protrudono le catene laterali dei diversi aminoacidi. R i+1 R n R i R i+2 L unità base ripetuta lungo la catena principale è (NH C α H C=O), che deriva dalle parti comuni degli aminoacidi dopo che si è formato il legame peptidico.

25 Il legame peptidico Per ciascun aminoacido costituente la catena polipeptidica si presentano 20 diverse possibilità di catena laterale (o residui), per cui è facile immaginare l enorme numero di diverse catene polipeptidiche che possono essere costituite. Se si considera un dipeptide, si avranno 20 2 = 400 possibili dipeptidi diversi. Se si considera un tripeptide, si avranno 20 3 = 8000 possibili tripeptidi diversi. Nel caso delle proteine, una piccola proteina è costituita da una singola catena polipeptidica di circa 100 residui, per cui si avranno = possibili catene polipeptidiche diverse! Gli organismi sulla terra sintetizzano un gran numero di proteine, con caratteristiche fisico-chimiche differenti, che derivano dalle diverse proprietà dei 20 aminoacidi standard e da come questi si combinano nella catena polipeptidica.

Interazioni non-covalenti

Interazioni non-covalenti BCP 3-4 Interazioni non-covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono

Dettagli

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti:

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti: Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto ad esempio a 83 kcal/mol

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Capitolo 16 L energia si trasferisce

Capitolo 16 L energia si trasferisce Capitolo 16 L energia si trasferisce 1. L «ABC» dei trasferimenti energetici 2. Le reazioni scambiano energia con l ambiente 3. Durante le reazioni varia l energia chimica del sistema 4. L energia chimica

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Corso di BIOCHIMICA Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Materiale didattico e esercizi su: http://moodle2.units.it/ Password: BioFarma

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

FORZE INTERMOLECOLARI o LEGAMI DEBOLI

FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

Dettagli

FORZE INTERMOLECOLARI

FORZE INTERMOLECOLARI FORZE INTERMOLECOLARI Le forze intermolecolari sono forze di attrazione che si stabiliscono tra le molecole che costituiscono una sostanza Determinano la tendenza delle molecole ad avvicinarsi. Per ogni

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Equilibri chimici. Consideriamo la seg. reazione chimica in fase omogenea: aa + bb î cc + dd Definiamo, in ogni istante della reazione:

Equilibri chimici. Consideriamo la seg. reazione chimica in fase omogenea: aa + bb î cc + dd Definiamo, in ogni istante della reazione: Equilibri chimici Consideriamo la seg. reazione chimica in fase omogenea: aa + bb î cc + dd Definiamo, in ogni istante della reazione: con A, B, C, D espressi come concentrazioni molari. Il sistema si

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

FORZE INTERMOLECOLARI o LEGAMI DEBOLI

FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E

Dettagli

Elettronegatività Elettronegatività

Elettronegatività Elettronegatività Elettronegatività Nel legame covalente tra atomi uguali, la nuvola elettronica è simmetrica rispetto ai due nuclei (es. H 2, Cl 2, F 2 ) legame covalente apolare. Nel legame covalente tra atomi con Z eff

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Interazioni deboli. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Interazioni deboli. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Interazioni deboli 1 Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Legami deboli o interazioni deboli La forza di un legame chimico viene stabilita in base alla energia del

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Esploriamo la chimica

Esploriamo la chimica 1 Valitutti, Tifi, Gentile Esploriamo la chimica Seconda edizione di Chimica: molecole in movimento Capitolo 15 La termodinamica e la cinetica 1. Le reazioni producono energia 2. Il primo principio della

Dettagli

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole Introduzione alla chimica organica 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole La chimica organica tratta di pochissimi atomi che si possono combinare in moltissimi modi Grande importanza

Dettagli

Entropia, energia libera ed equilibrio. Capitolo 17

Entropia, energia libera ed equilibrio. Capitolo 17 Entropia, energia libera ed equilibrio Capitolo 17 Processi chimici e fisici spontanei Una cascata cade verso il basso Una zolletta di zucchero si scioglie in una tazza di caffé Ad 1 atm, l acqua ghiaccia

Dettagli

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara ATOMI E MOLECOLE Psicobiologia Lezione nr. 1 Prof. Lasaponara La struttura dell atomo I legami chimici e le molecole I componenti elementari della materia vivente 20 miliardi di anni fa Caratteristiche

Dettagli

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame.

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Non necessariamente i due elettroni che concorrono alla formazione del legame devono provenire da entrambi gli atomi

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 19 L energia si trasferisce 3 Sommario (I) 1. L «ABC» dei trasferimenti energetici 2. Durante le reazioni varia l energia chimica

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Il Legame Chimico e la Struttura Molecolare

Il Legame Chimico e la Struttura Molecolare A.A.2016 2017 CCS-Biologia CCS-Scienze Geologiche 1 Il Legame Chimico e la Struttura Molecolare Energia di interazione di due atomi di idrogeno Cap 8. 1-7, 9, 10(a/b), 17-20, 27-28, 31-33, 37-40, 52, 93-96

Dettagli

LE MEMBRANE CELLULARI

LE MEMBRANE CELLULARI LE MEMBRANE CELLULARI Sono strutture sovramolecolari che racchiudono e delimitano l ambiente intracellulare e negli eucarioti anche gli organuli citoplasmatici. Hanno funzione di Protezione. Sostegno.

Dettagli

Il paradosso (termodinamico) degli organismi viventi e la soluzione bioenergetica

Il paradosso (termodinamico) degli organismi viventi e la soluzione bioenergetica Università di Modena & Reggio Emilia DIPARTIMENTO di BIOLOGIA ANIMALE Laboratorio di Biochimica Il paradosso (termodinamico) degli organismi viventi e la soluzione bioenergetica Nicola Volpi, Prof. Associato

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Termodinamica. Scienza che studia le relazioni tra il calore e le altre forme di energia coinvolte in un processo fisico o chimico

Termodinamica. Scienza che studia le relazioni tra il calore e le altre forme di energia coinvolte in un processo fisico o chimico Termodinamica Scienza che studia le relazioni tra il calore e le altre forme di energia coinvolte in un processo fisico o chimico La termodinamica fa uso di modelli astratti per rappresentare sistemi e

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Cr Mn Fe Co Ni Cu Zn. Chimica Inorganica Biologica Vita ed Energia

Cr Mn Fe Co Ni Cu Zn. Chimica Inorganica Biologica Vita ed Energia Vita ed Energia I processi chimici alla base della chimica della vita sono due: Uso dell E solare per produrre materia e O 2 da CO 2 e H 2 O Produzione di E mediante ossidazione di materia con formazione

Dettagli

relazioni tra il calore e le altre forme di energia.

relazioni tra il calore e le altre forme di energia. Termodinamica i Termodinamica: ramo della scienza che studia le relazioni tra il calore e le altre forme di energia. Sistema e ambiente sistema: zona dello spazio all interno della quale studiamo i fenomeni

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

La Termodinamica è la disciplina che si occupa dello studio degli scambi di energia e di materia nei processi fisici e chimici

La Termodinamica è la disciplina che si occupa dello studio degli scambi di energia e di materia nei processi fisici e chimici La Termodinamica è la disciplina che si occupa dello studio degli scambi di energia e di materia nei processi fisici e chimici Materia = tutto ciò che possiede una massa ed occupa uno spazio Energia =

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

I componenti chimici delle cellule

I componenti chimici delle cellule I componenti chimici delle cellule Piccole molecole Macromolecole Piccole molecole C, H, N ed O costituiscono quasi il 99% del peso di una cellula Il 70 % della massa di una cellula è costituito da acqua

Dettagli

Forze intermolecolari

Forze intermolecolari Forze intermolecolari Le forze intermolecolari sono forze attrattive tra molecole, tra ioni o tra ioni e molecole. In assenza di tali forze tutte le molecole sarebbero gas le molecole possono stabilire

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte.

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. L organizzazione biologica si basa su una gerarchia di livelli strutturali Si parte dall atomo tessuti organi molecola organismo

Dettagli

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1 1. La forma delle molecole Molte proprietà delle sostanze dipendono dalla forma

Dettagli

Come si costruiscono le molecole in natura ed in laboratorio. Giuseppe Macino

Come si costruiscono le molecole in natura ed in laboratorio. Giuseppe Macino Come si costruiscono le molecole in natura ed in laboratorio Giuseppe Macino E Dio creo la luce Cosa tiene insieme tutta la materia che forma la terra? Tutto questo e costituito da ELEMENTI Gli elementi

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Corso di Chimica Generale CL Biotecnologie

Corso di Chimica Generale CL Biotecnologie Corso di Chimica Generale CL Biotecnologie STATI DELLA MATERIA Prof. Manuel Sergi MATERIA ALLO STATO GASSOSO MOLECOLE AD ALTA ENERGIA CINETICA GRANDE DISTANZA TRA LE MOLECOLE LEGAMI INTERMOLECOLARI DEBOLI

Dettagli

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto Unità n 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

Principi di Biochimica

Principi di Biochimica Principi di Biochimica Augusto Innocenti Biologo Nutrizionista Perfezionamento in Biochimica e Biologia Molecolare Phd in Neurobiologia e Neurofisiologia Materia: Atomi e Molecole La materie è costituita

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia Capitolo 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli