La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:"

Transcript

1 Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza aminoacidica eliche (foglietti e ripiegamenti) Catena polipeptidica Disposizione subunità 1

2 La funzione delle proteine può essere compresa analizzando la loro struttura. La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: 1) La struttura primaria è la sequenza amminoacidica di una catena polipeptidica determinata quindi dai legami covalenti ammidici tra gli amminoacidi Con le 20 differenti scelte a disposizione si possono costruire un numero elevatissimo di proteine differenti Una proteina composta da n residui le possibili sequenze sono 20 n Proteina di 100 a.a ,27 x Le proteine (polipeptidi) contengono almeno 40 residui Più piccole si parla di peptidi La catena polipeptidica più lunga è la proteina TITINA residui La maggior parte delle proteine da 100 a 1000 residui Le proteine possono essere costituite da più subunità Alcune proteine vengono sintetizzate in un unica catena polipeptidica e poi vengono tagliate rimanendo legate per alcuni legami covalenti (INSULINA) 2

3 Poiché ciascun tipo di proteina ha una specifica sequenza amminoacidica è logico che la sequenza ha un ruolo fondamentale nel determinare la struttura della proteina e quindi anche la sua funzione. Questo è vero ma non del tutto La disposizione spaziale degli atomi di una proteina è detta CONFORMAZIONE. Le proteine possono assumere vari stati di conformazione (quando una qualsiasi molecola (LIGANDO) lega una proteina ne cambia la conformazione). Quando si trovano in uno degli stati conformazionali funzionale le proteine sono dette NATIVE. STRUTTURA PRIMARIA di una proteina rappresenta la sequenza linere degli amminoacidi STRUTTURA SECONDARIA è la conformazione spaziale assunta a livello locale dagli atomi dello scheletro polipeptidico senza tenere in considerazione la disposizione delle sue catene laterali. STRUTTURA TERZIARIA si riferisce alla distribuzione tridimenzionale degli atomi di un intero peptide, compresa quella delle catene laterali STRUTTURA QUATERNARIA, si riferisce a proteine costituite da più subunità, e indica la disposizione spaziale dell insieme di queste subunità 3

4 RIPIEGAMENTO REGOLARE DELLA CATENA POLIPEPTIDICA Il legame planare peptidico determina la STRUTTURA SECONDARIA R = residuo amminoacidico Φ = 180 Ψ = 180 I sei atomi del gruppo peptidico giacciono sullo stesso piano e l atomo di ossigeno del gruppo carbonilico è in posizione trans rispetto all idrogeno dell azoto ammidico. 4

5 Fattori che determinano la struttura secondaria Il gruppo peptidico L ossigeno carbonilico possiede una parziale carica negativa e l azoto ammidico una positiva, generando un piccolo dipolo elettrico. Configurazione trans, cis porterebbe ad interferenze steriche tra catene laterali, a meno che nel legame peptidico non sia impegnata la pro 5

6 Il termine si riferisce alla conformazione locale di alcune parti di un polipeptide ed è determinata da legami specifici : legami idrogeno tra l ossigeno carbonilico di un legame peptidico e l idrogeno legato all azoto di un altro legame peptidico ed è determinata dalla struttura planare dello stesso LEGAME PEPTIDICO. Φ = 180 Ψ = 180 Il gruppo peptidico possiede una struttura rigida, PLANARE, in conseguenza di interazioni di risonanza che conferiscono al legame peptidico circa il 40% di carattere di doppio legame. Con poche eccezioni, i gruppi peptidici assumono la conformazione TRANS. LEGAME PEPTIDICO CIS E TRANS 6

7 La conformazione della catena principale può essere descritta in termini di ANGOLI DI TORSIONE intorno ai due legami del carbonio in α Φ = angolo di rotazione N Cα Ψ = angolo di rotazione Cα C La libertà di conformazione dello scheletro polipeptidico è sottoposta a limitazioni steriche Atomi a stretto contato che non rispettano le distanze di wan der Waals 7

8 Gli angoli φ e ψ potrebbero assumere tutti i valori compresi tra 180 e -180 ma in realtà alcuni valori sono proibiti a causa di interferenze steriche I valori permessi possono essere riportati su di un grafico in cui ψ viene analizzato in funzione di φ, indagine che va sotto il nome di GRAFICO DI RAMACHANDRAN Influenza dei gruppi laterali s u l l a conformazione del polipeptide Eccezi oni: Conformazione in CIS Pro -35 <Φ <-85 Gly Minori limitazioni La prolina è il residuo con le maggiori restrizioni conformazionali. La glicina è il residuo con minor impedimento sterico e quindi con maggiori possibilità conformazionali 8

9 C (gradi) α L α (gradi) La più semplice disposizione che una catena polipeptidica può assumere con i legami peptidici rigidi è una struttura elicoidale( avvolgimento a spirale): 9

10 Carbonio Idrogeno Ossigeno Azoto Gruppo R Nell α-elica gli atomi di idrogeno dello scheletro sono disposti in modo tale che ogni ossigeno carbonilico del legame C=O di un dato residuo forma un legame idrogeno con l idrogeno amidico N-H di 4 residui più avanti (ansa di 13 atomi). Tutti i CO e gli NH sono impegnati in un legame idrogeno 3,6 residui per giro di elica Passo pari a 5,4 Å Le α eliche nelle proteine hanno in media una lunghezza di 12 residui corrispondenti a 3 giri d elica e circa 18 Å Le catene laterali dei residui amminoacidici sono proiettate verso l esterno e verso il basso. 10

11 Le ramificazioni del carbonio β della valina treonina e isoleucina tendono a destabilizzare l elica a causa del loro ingombro sterico. Anche la serina l aspartato e l asparagina perché contengono gruppi che possono fare legami idrogeno e competere con i gruppi CO e NH della catena principale. La prolina infine destabilizza l elica in quanto priva del gruppo NH. La conformazione β organizza le catene polipeptidiche in foglietti I l foglietto β Anti parallelo Organizzazione sfalsata Gli stessi legami che caratterizzano la struttura ad α elica ma questa volta tra amminoacidi anche molto lontani nella s e q u e n z a amminoacidica Esistono due tipi di foglietto: Il foglietto β antiparallelo Le catene polipeptidiche adiacenti sono unite da legami idrogeno con direzionalità opposta 11

12 Il foglietto β parallelo Il foglietto β parallelo Le catene unite da legame idrogeno hanno la stesso direzionalità E n t r a m b e presentano un aspetto ondulato e pieghettato Questi foglietti contenuti nelle proteine sono formati da un minimo di 5 a un massimo di 22 filamenti polipeptidici. Ciascun filamento può contenere fino a 15 residui. 12

13 I legami che determinano e stabilizzano le strutture secondarie sono i legami idrogeno tra l idrogeno di un gruppo amminico e l ossigeno del gruppo carbossilico di un altro a.a. della stessa catena polipeptidica Ripiegamenti Le catene polipeptidiche possono invertire la loro direzione mediante ripiegamenti o anse e poichè le anse si trovano di solito sulla superficie delle proteine sono solitamente composte da amminoacidi con gruppi R idrofilici 13

14 Le proteine possono essere classificate come FIBROSE O GLOBULARI Le proteine fibrose costituiscono un supporto strutturale alle cellule. L αcheratina è una proteina di sostegno non reattiva sotto il profilo chimico ed è presente in tutti i vertebrati. È la componente principale dello strato epidermico esterno corneo e delle sue appendici correlate quali peli, corna, unghie e piume. L α-cheratina è formata da due eliche destrorse che si avvolgono tra loro formando una superelica sinistrorsa detta avvolgimento avvolto α Ciascuna catena polipeptidica è costituita da ripetizioni di sette residui alcuni dei quali sono idrofobici. I residui idrofobici si associano con quelli dell altra catena e poiché la ripetizione dei residui idrofobici è inferiore al giro di α elica e due catene si ripiegano a formare un avvolgimento avvolto 14

15 La cheratina è ricca di cisteine che formano ponti di-solfuro che consentono di legare catene polipeptidiche adiacenti. CHERATINE DURE più ricche in cisteine (peli, corna unghie) meno flessibili CHERATINE MORBIDE nella cute e nei calli neno ricche in cisteine, più flessibili I ponti disolfuro possono essere scissi per via riduttiva quando vengono trattati con mercaptani. Il collagene è la proteina più abbondante nei mammiferi contiene tre catene polipeptidiche di circa 1000 a.a. dove la GLICINA ricorre ogni tre residui. L interno della superelica formato da tre catene polipeptidiche è molto compatto grazie alla presenza della GLICINA l unico amminoacido che può essere presente all interno di una superelica. Gli altri residui sono : prolina, 4-idrossiprolina (Hyp) ma anche se in quantità minore 3-idrossiprolina e 5-idrossilisina(Hyl) Questi residui si formano dopo la sintesi proteica per azione della prolina idrossilasi enzima che richiede acido ascorbico per la sua attività. SCORBUTO malattia dovuta all assenza di vitamina C nella dieta colpisce il collagene dei tessuti connettivi 15

16 Il grande numero di proline impediscono la formazione dell α-elica. Il polipeptide del collagene assume una struttura ad elica sinistrorsa con circa 3 residui per giro. Tre catene si avvolgono in una avvolgimento destrorso per dare origine alla struttura a tripla elica del collagene 16

17 SINGOLA CATENA POLIPEPTIDICA La struttura terziaria di una proteina descrive il ripiegamento dei suoi elementi strutturali secondari (α eliche e β foglietti ripiegati) e specifica la posizione nello spazio di ogni atomo della molecola proteica. 17

18 Nelle proteine globulari le catene laterali degli a.a. sono distribuite spazialmente in base alla loro polarità: Residui non polari (Val, Leu, Ile, Met e Fhe : si trovano prevalentemente nella parte interna della proteina al di fuori del contatto con il solvente acquoso I residui polari carichi (Arg, His, Lys, Asp e Glu): sono localizzati sulla superficie della proteina in contatto con il solvente acquoso Residui polari non carichi (Ser, Thr, Asp, Gln e Tyr) solitamente si trovano sulla superficie proteica ma anche nella parte interna a formare legami idrogeno con altri gruppi. La struttura terziaria è stabilizzata da forze elettrostatiche tra residui amminoacidici, anche molto lontani nella sequenza amminoacidica. Le interazioni tra le catene laterali amminoacidiche indirizzano il ripiegamento del polipeptide e la conseguente formazione di una struttura compatta Gli ioni metallici Zinco Interazioni idrofobiche Legami ad idrogeno Interazioni ioniche Interazioni elettrostatiche Legami disolfuro 18

19 Un ulteriore legame che determina la struttura terziaria è IL LEGAME DISOLFURO che avviene tra due cisteine. REAZIONE REDOX Denaturazione e ripiegamento delle proteine Un ulteriore legame che determina la struttura terziaria è IL LEGAME DISOLFURO che avviene tra due cisteine. REAZIONE REDOX 19

20 La struttura terziaria è f o r m a t a d a l l e combinazioni degli elementi secondari strutturali. L ordine con cui sono organizzate le strutture secondarie determina il criterio di classificazione delle proteine globulari βαβ Forcina β αα In numerose proteine globulari si riscontrano determinati raggruppamenti di elementi strutturali secondari denominati STRUTTURE SUPERSECONDARIE O MOTIVI 20

21 Citocromo b 562 Immunoglobulina Lattato Deidrogenasi α proteine β proteine α/β proteine I polipeptidi di grandi dimensioni, contenenti più di 200 residui, solitamente formano strutture supersecondarie o DOMINI che conferiscono a queste strutture un aspetto bi o plurilobato I domini sono le unità fondamentali e funzionali della struttura terziaria. Unità strutturalmente indipendenti che possiedono le caratteristiche di piccole proteine globulari 21

22 Molte proteine, con massa superiore a 100 KD, sono costituite da più catene polipeptidiche, chiamate SUBUNITA. La struttura quaternaria definisce la disposizione spaziale di queste subunità che sono unite attraverso quelli stessi legami che definiscono la struttura terziaria. L aumento della grandezza di una proteina attraverso l associazione di subunità identiche è un procedimento più efficiente rispetto all aumento della lunghezza della catena polipeptidica, poiché ciascuna subunità possiede un propria attività. Ancora più rilevante è il fatto che la presenza di più subunità in numerose proteine pone le basi strutturali per la regolazione della loro attività. 22

23 Interazioni tra domini, subunità, formazione di complessi Le subunità si associano attraverso legami non covalenti. Le regioni di contatto tra subunità ricordano la porzione interna di una proteina costituita da una singola subunità. Le proteine sono stabilizzate da diverse forze: Effetto idrofobico Questo effetto fa si che le sostanze non polari riducano al minimo i loro contati con l acqua e rappresenta l elemento preponderante per la stabilità della struttura nativa di una proteina. Interazioni elettrostatiche Forze di wan der Waals Legami idrogeno Associazione di gruppi ionici (ponte salino) Legami disolfuro tra cisteine 23

24 1) effetto idrofobico 2) legami idrogeno 3) forze di van der Walls 4) Interazioni elettrostatiche Forze che stabilizzano la struttura delle proteine Molecola non polare Molecola non polare Molecola non polare Molecola non polare Molecola non polare Fattori chimico-fisici che influenzano la struttura delle proteine LA SERIE DI HOFMEISTER cosmotropici stabilizzanti destabilizzanti caotrop (salting out) (salting in) La stabilità conformazionale delle proteine dipende dai seguenti fattori: 1) Temperatura; 2) Variazioni di ph, 3) Presenza di detergenti; 4) Presenza di agenti caotropici o cosmotropici. Anioni: Cationi: SOLUTI INTRACELLULARI CHE HANNO EFFETTO SULLA STABILIZZANTI STRUTTURA N-ossido-trimetilamina Betaina Sarcosina Aminoacidi Taurina Glicerolo (TMAO) Ottopina DESTABILIZZANTI Urea Arginina Guanidino 24

25 Denaturazione e ripiegamento delle proteine [Proteina denaturata], % nativa denaturata Rottura dei legami deboli che determinano la struttura proteica [denaturante] Perdita delle strutture secondarie, terziarie e quaternarie, se esistono, mediante un agente denaturante Denaturazione e ripiegamento delle proteine % F Temperatura (C ) % proteina denaturata [urea], M Quando una soluzione di Ribonucleasi A viene trattata con urea 8M la proteina denatura: si rompono tutti i legami elettrostatici rimangono solo i 4 ponti disolfuro intracatena 25

26 Denaturazione e ripiegamento delle proteine Quando la stessa proteina viene trattata con urea 8M i presenza di β- mercaptoetanolo si rompono ossidativamente anche i 4 ponti disolfuro. In entrambi i casi la proteina DENATURATA non è più funzionante. La ribonucleasi A perde la sua attività catalitica. Se dalla soluzione vengono allontanati attraverso dialisi i due denaturanti la proteina ripiega spontaneamente nella sua forma cataliticamente ATTIVA. RINATURAZIONE - Strutturali - Di trasporto - Di protezione e difesa - Di controllo e regolazione - Di movimento - Di riserva - Catalitiche: ENZIMI 26

27 1) Le proteine fibrose, di origine animale, con prevalente funzione meccanica: cheratina, collageno, elastina, fibroina, actina, miosina, ovomucina; 2) Proteine globulari, tutte le altre; 1) Proteine semplici, se dalla loro idrolisi si ottengono solo amminoacidi. La composizione elementare di queste proteine è abbastanza regolare: C 50%, O 23%, N 16%, H 7%, S max 3%; 2) Proteine coniugate, oltre alle catene polipeptidiche contengono COFATTORI, legati covalentemente o non. Cofattori 27

28 Nelle cellule le proteine costituiscono oltre il 50% della sostanza secca. Esse rappresentano il 14-18% dell'organismo animale. Grazie alla elevata dinamicità delle strutture proteiche (gli atomi sono in continuo movimento fluttuante) e per la capacità che hanno di legarsi in modo selettivo ad altre molecole, le proteine svolgono un numero elevato di funzioni (classificazione): Modulazione dell'espressione genica e intervengono nella duplicazione, trascrizione e traduzione del DNA; Regolano il metabolismo, sia come enzimi, sia come ormoni (insulina, glucagone, ecc.) Trasportano diverse molecole; Proteggono l'organismo dalle infezioni (anticorpi); Danno luogo a strutture contrattili (actina, miosina, ecc.); Sono coinvolte nella trasmissione degli impulsi nervosi (recettori dell'acetilcolina, ecc.); Intervengono nella coagulazione del sangue; Costituiscono la struttura dei tessuti di sostegno animali (collageno, cheratina, elastina, ecc.) Sono forme di deposito di principi nutritivi a cui attingono l'embrione animale o vegetale (ovoalbumina, caseina, gliadina, ecc.) 28

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

GLI AMMINOACIDI E LE PROTEINE

GLI AMMINOACIDI E LE PROTEINE UNITÀ VET. DIDATTICA DI PROPEDEUTICA BIOCHIMICA GLI AMMINOACIDI E LE PROTEINE Roberto Giacominelli Stuffler INTRODUZIONE Tutte le proteine, sia nei batteri, sia nelle forme di vita più complesse, sono

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU)

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) Roberto Giacominelli Stuffler IL CORSO MONODISCIPLINARE DI BIOCHIMICA È SUDDIVISO IN DUE UNITÀ

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Le proteine o protidi

Le proteine o protidi Le proteine o protidi A differenza di glucidi e lipidi (che di regola non contengono azoto), le proteine sono composti organici quaternari, che possiedono sempre atomi di azoto nella loro molecola (quasi

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici.

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 1 Il carbonio deve acquistare quattro elettroni per essere stabile

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Biochimica. studio della vita a livello molecolare

Biochimica. studio della vita a livello molecolare Biochimica studio della vita a livello molecolare studio della composizione molecolare dei sistemi viventi studio delle reazioni chimiche cui vanno incontro i sistemi viventi ALCUNI QUESITI DELLA BIOCHIMICA

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Modificazioni delle proteine

Modificazioni delle proteine Modificazioni delle proteine POST-TRADUZIONALI = avvengono dopo la sintesi proteica CO-TRADUZIONALI = avvengono durante la sintesi proteica Sono modificazioni chimiche della catena polipeptidica ad opera,

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Proteine ed acidi nucleici

Proteine ed acidi nucleici Proteine ed acidi nucleici Prof.ssa Flavia Frabetti aa. 2010-11 PRTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,,,

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare quattro legami covalenti. Questi

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

STRUTTURA E FUNZIONE DELLE

STRUTTURA E FUNZIONE DELLE STRUTTURA E FUNZIONE DELLE PROTEINE Compongono la STRUTTURA della cellula ma hanno anche altre FUNZIONI intelaiatura citoscheletrica strutture cellulari (organelli) impalcatura di sostegno extracellulare

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Dettagli