Macromolecole Biologiche. I domini (I)

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Macromolecole Biologiche. I domini (I)"

Transcript

1 I domini (I)

2 I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica o parte di essa che si ripiega indipendentemente in una struttura stabile. I domini sono unità funzionali e spesso a domini diversi di una proteina sono associate funzioni diverse.

3 I domini Le proteine possono essere costituite da un singolo dominio o da molti (anche diverse dozzine).

4 I domini I domini sono costituiti da diverse combinazioni di elementi di struttura secondaria e di motivi. Le α eliche e i filamenti β costituenti i motivi sono adiacenti uno all altro nella struttura tridimensionale e connessi da regioni di loop; a loro volta, i motivi adiacenti o formati da regioni consecutive della catena polipeptidica sono vicini nella struttura tridimensionale. Il numero di combinazioni dei motivi a formare i domini è limitato e alcune combinazioni sono strutturalmente favorite rispetto ad altre. Spesso, domini simili ricorrono in proteine diverse che hanno funzioni diverse e sequenza aminoacidica completamente diversa.

5 I domini Michael Levitt and Cyrus Chothia, sulla base di semplici considerazioni sulla connessione dei motivi, hanno classificato i domini in 3 gruppi principali, a seconda delle strutture secondarie e dei motivi coinvolti nella loro formazione: - domini α - domini β - domini α/β - altro

6 Domini α: Coiled coil α eliche Il modo più semplice di associazione compatta di α eliche è quello di impaccarsi a coppie. Nel 1953 Francis Crick mostrò che le interazioni fra le catene laterali degli aminoacidi sono massime se le 2 α eliche non sono bastoncini diritti, ma si avvolgono una con l altra a formare un arrangiamento chiamato coiled coil, una sorta di avvolgimento intrecciato. I coiled coil sono la base di alcune proteine fibrose, quali l α cheratina e la miosina, e di proteine che legano DNA o RNA.

7 Domini α: Coiled coil α eliche Nella superelica sinistrorsa costituita da 2 α eliche destrorse, il numero di aminoacidi per giro in ciascuna elica viene ridotto da 3.6 a 3.5 (portando ad una leggera distorsione della geometria delle α eliche), in modo tale che le interazioni delle catene laterali fra le 2 eliche si ripetano ogni 7 aminoacidi, cioè esattamente ogni 2 giri di elica. Ciò si riflette nella sequenza delle catene polipeptidiche che formano la superelica coiled coil, che si ripetono con un periodo di 7 aminoacidi. I 7 aminoacidi (eptapeptide) vengono indicati con le lettere a-g.

8 Domini α: Coiled coil α eliche L aminoacido d è idrofobico (Leu o Ile): quando 2 eliche formano la struttura coiled coil le catene laterali dei relativi aminoacidi d si impaccano insieme ogni 2 giri delle α eliche. L aminoacido a è idrofobico e anch esso si impacca con il corrispondente dell altra elica. Gli aminoacidi a e d formano il core idrofobico della superelica coiled coil.

9 Domini α: Coiled coil α eliche Gli aminoacidi e e g, spazialmente adiacenti alla zona idrofobica definita da a e d, sono carichi (Glu, Asp, Arg, Lys) e le loro catene laterali formano interazioni fra le 2 α eliche (ponti salini), definendo così la relativa orientazione e allineamento delle 2 catene polipeptidiche.

10 Domini α: Coiled coil α eliche Le 2 α eliche che formano la superelica coiled coil si impaccano in modo tale che le catene laterali di un elica cadano nelle zone vuote tra le catene laterali dell altra elica e viceversa. L inclinazione relativa degli assi delle due α eliche è di 18. Ciascun aminoacido di un elica è circondato da 4 aminoacidi appartenenti all elica opposta.

11 Domini α: α helical bundle L α helical bundle è costituito da 4 α eliche disposte in modo tale che i loro assi siano reciprocamente quasi paralleli. Le catene laterali idrofobiche degli aminoacidi di ciascuna α elica sono orientate verso l interno dell α helical bundle, mentre le catene laterali idrofiliche degli aminoacidi sono rivolte verso l esterno. Le catene laterali idrofobiche rivolte verso l interno dell α helical bundle sono così strettamente impaccate che non c è spazio per molecole d acqua.

12 Domini α: α helical bundle L α helical bundle è un tipo di dominio che ricorre in svariate proteine (mioemeritrina, citocromo c' e b 562, ferritina, proteina del capside del virus del mosaico del tabacco). In questi casi le α eliche sequenzialmente vicine sono sempre antiparallele.

13 Domini α: α helical bundle L α helical bundle si può anche formare con arrangiamenti topologici delle α eliche diversi, come nel caso dell ormone umano della crescita. In questo caso, l α helical bundle è formato da 2 coppie di eliche parallele che sono disposte in modo antiparallelo nell α helical bundle. L impaccamento antiparallelo delle α eliche conferisce loro maggiore stabilità in quanto i macrodipoli associati a ciascuna α elica si annullano a vicenda.

14 Domini α: α helical bundle Le α eliche che costituiscono l α helical bundle si impaccano con la modalità cresta-solco. Le creste e i solchi sono costituiti dalle catene laterali di aminoacidi separati da 3-4 residui (fig. c e b rispettivamente). La geometria dei solchi e delle creste di un α elica dipende dalla geometria dell elica ma anche dalla sua sequenza aminoacidica.

15 Domini α: α helical bundle Nel caso dell α helical bundle, le creste formate dagli aminoacidi ogni 3 residui vanno a corrispondere con i solchi formati dagli aminoacidi ogni 4 residui. Le creste della prima α elica sono inclinate di circa 45 rispetto alla direzione dell asse dell elica, mentre le creste della seconda α elica sono inclinate di circa 25 rispetto all asse dell elica. Quando le 2 eliche si impaccano, dopo che un elica viene ruotata di 180, si otterrà la massima corrispondenza fra le creste e i solchi delle 2 eliche in seguito ad un inclinazione di circa 20 (45-25 ) fra le 2 eliche.

16 Domini α: Globin fold Un altro impaccamento tipico delle α eliche è quello osservato nel globin fold, caratteristico di emoglobine, mioglobine e ficocianine. Il globin fold è costituito da 8 α eliche, indicate con le lettere A-H, collegate da loop piuttosto corti, in modo da disporsi a formare la tasca del sito attivo, che in mioglobina e emoglobina, ospita il gruppo eme. La lunghezza delle α eliche varia considerevolmente: da 7 aminoacidi per l elica C a 28 aminoacidi per l elica H. Le α eliche sono disposte in direzioni diverse, in modo tale che α eliche adiacenti in sequenza non lo sono nella struttura, con l eccezione delle eliche G e H (sandwich 3/3, BEF/AGH).

17 Domini α: Globin fold Nel caso del globin fold, le creste formate dagli aminoacidi ogni 4 residui vanno a corrispondere con i solchi formati dagli aminoacidi ogni 4 residui. Le creste di entrambe le α eliche sono inclinate di circa 25 rispetto alla direzione dell asse delle eliche. Quando le 2 eliche si impaccano, dopo che un elica viene ruotata di 180, si otterrà la massima corrispondenza fra le creste e i solchi delle 2 eliche in seguito ad un inclinazione di circa 50 ( ) fra le 2 eliche.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte

Dettagli

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Seminario. Domini modulari delle proteine 1

Seminario. Domini modulari delle proteine 1 Seminario Proteine della matrice DOMINI E MODULI Domini modulari delle proteine 1 La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette

Dettagli

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2 Domini modulari delle proteine 1 Proteine della matrice DOMINI E MODULI La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette domini,

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA Email: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria Macromolecole Biologiche Chimica Biologica A.A. 2010-2011 Struttura Terziaria Domini e struttura terziaria Struttura terziaria L arrangiamento spaziale degli amminoacidi di una singola catena polipeptidica

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 7 La struttura delle proteine Concetti chiave: La struttura terziaria di una proteina descrive il ripiegamentodei suoi elementi

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)

Dettagli

strutture di Proteine

strutture di Proteine Laboratorio di Bioinformatica I Database di strutture di Proteine Dott. Sergio Marin Vargas (2014 / 2015) Dal gene alla proteina La funzione della proteina è nella sua struttura 3D. Struttura delle proteine

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

Rappresentazione dei Dati Biologici

Rappresentazione dei Dati Biologici Rappresentazione dei Dati Biologici CORSO DI BIOINFORMATICA C.d.L. Ingegneria Informatica e Biomedica Outline Proteine ed Amminoacidi Rappresentazione di Amminoacidi Rappresentazione delle strutture Proteiche

Dettagli

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Gerarchia della struttura delle proteine

Gerarchia della struttura delle proteine Si indica con CONFORMAZIONE la disposizione tridimensionale degli atomi di una molecola, cioè la loro organizzazione spaziale. Gerarchia della struttura delle proteine struttura primaria: sequenza degli

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

La funzione delle proteine dipende dalla loro struttura tridimensionale

La funzione delle proteine dipende dalla loro struttura tridimensionale La funzione delle proteine dipende dalla loro struttura tridimensionale La struttura dipende dal ripiegamento di particolari sequenze aminoacidiche La sequenza aminoacidica della catena polipeptidica è

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Prof.ssa Gamba Sabrina. Lezione 7: IL DNA. Duplicazione e sintesi delle proteine

Prof.ssa Gamba Sabrina. Lezione 7: IL DNA. Duplicazione e sintesi delle proteine Prof.ssa Gamba Sabrina Lezione 7: IL DNA Duplicazione e sintesi delle proteine concetti chiave della lezione Costituzione fisico-chimica del DNA Basi azotate Duplicazione Concetto di geni Rna Trascrizione

Dettagli

APPUNTI DI MATEMATICA ALGEBRA \ INSIEMISTICA \ TEORIA DEGLI INSIEMI (1)

APPUNTI DI MATEMATICA ALGEBRA \ INSIEMISTICA \ TEORIA DEGLI INSIEMI (1) ALGEBRA \ INSIEMISTICA \ TEORIA DEGLI INSIEMI (1) Un insieme è una collezione di oggetti. Il concetto di insieme è un concetto primitivo. Deve esistere un criterio chiaro, preciso, non ambiguo, inequivocabile,

Dettagli

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui Durante la traduzione l informazione di ripiegamento codificata nella sequenza aminoacidica diventa disponibile in maniera vettoriale la struttura tridimensionale può essere ottenuta solo per Un intero

Dettagli

PROVE SULLA MACCHINA A CORRENTE CONTINUA

PROVE SULLA MACCHINA A CORRENTE CONTINUA LABORATORIO DI MACCHINE ELETTRICHE PROVE SULLA MACCHINA A CORRENTE CONTINUA PROVE SULLA MACCHINA A C. C. Contenuti Le prove di laboratorio che verranno prese in esame riguardano: la misura a freddo, in

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi.

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi. Sommario La molecola di DNA è deputata a conservare le informazioni genetiche necessarie per lo sviluppo ed il funzionamento degli organismi viventi. Poiché contiene le istruzioni per la costruzione delle

Dettagli

Il metabolismo dell RNA. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

Il metabolismo dell RNA. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie Il metabolismo dell RNA I vari tipi di RNA Il filamento di DNA che dirige la sintesi dello mrna è chiamato filamento stampo o filamento antisenso. L altro filamento che ha sequenza identica a quella dello

Dettagli

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA Svolgono la loro funzione legando reversibilmente l OSSIGENO. Aumentano la solubilità dell ossigeno nel plasma, da 3ml/L a 220 ml/l. La mioglobina

Dettagli

Relazione struttura-funzione

Relazione struttura-funzione Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Relazione struttura-funzione Marco Nardini Dipartimento di Scienze

Dettagli

Introduzione 2. Serie P20 4. Serie P28 6. Serie P35 8. Serie P39 10. Serie P42 12. Serie P57 14. Serie P60 16. Serie P85 18.

Introduzione 2. Serie P20 4. Serie P28 6. Serie P35 8. Serie P39 10. Serie P42 12. Serie P57 14. Serie P60 16. Serie P85 18. INDICE Introduzione 2 Serie P20 4 Serie P28 6 Serie P35 8 Serie P39 10 Serie P42 12 Serie P57 14 Serie P60 16 Serie P85 18 Serie P110 20 Schemi di connessione 22 Codifica 23 Note 24 Motori Passo Passo

Dettagli

La spirale iperbolica: Fu descritta per la prima volta da Pierre Varignon (1654-1722). L equazione, espressa in coordinate polari, è del tipo:

La spirale iperbolica: Fu descritta per la prima volta da Pierre Varignon (1654-1722). L equazione, espressa in coordinate polari, è del tipo: Esistono delle forme geometriche che sono in grado, per complessi fattori psicologici non del tutto chiariti, di comunicarci un senso d equilibrio, di gradimento e di benessere. Tra queste analizzeremo

Dettagli

Trasformazioni Geometriche 1 Roberto Petroni, 2011

Trasformazioni Geometriche 1 Roberto Petroni, 2011 1 Trasformazioni Geometriche 1 Roberto etroni, 2011 Trasformazioni Geometriche sul piano euclideo 1) Introduzione Def: si dice trasformazione geometrica una corrispondenza biunivoca che associa ad ogni

Dettagli

GENETICA... lessico. Genetica: studio dei geni e dell'ereditarietà

GENETICA... lessico. Genetica: studio dei geni e dell'ereditarietà GENETICA... lessico Genetica: studio dei geni e dell'ereditarietà Geni: porzioni di DNA contenenti un'informazione che permette di decodificare una certa proteina. Es: gene che determina il colore dei

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

INTEGRALI DEFINITI. Tale superficie viene detta trapezoide e la misura della sua area si ottiene utilizzando il calcolo di un integrale definito.

INTEGRALI DEFINITI. Tale superficie viene detta trapezoide e la misura della sua area si ottiene utilizzando il calcolo di un integrale definito. INTEGRALI DEFINITI Sia nel campo scientifico che in quello tecnico si presentano spesso situazioni per affrontare le quali è necessario ricorrere al calcolo dell integrale definito. Vi sono infatti svariati

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Corrispondenze e funzioni

Corrispondenze e funzioni Corrispondenze e funzioni L attività fondamentale della mente umana consiste nello stabilire corrispondenze e relazioni tra oggetti; è anche per questo motivo che il concetto di corrispondenza è uno dei

Dettagli

SINTESI PROTEICA. Replicazione. Trascrizione. Traduzione

SINTESI PROTEICA. Replicazione. Trascrizione. Traduzione Replicazione SINTESI PROTEICA Trascrizione Traduzione 61 codoni codificanti 3 triplette non senso (STOP) AUG codone di inizio codone per Met Caratteristiche del codice genetico Specificità Il codice genetico

Dettagli

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani

LE MOLECOLE INFORMAZIONALI. Lezioni d'autore Treccani LE MOLECOLE INFORMAZIONALI Lezioni d'autore Treccani Introduzione (I) I pionieri della biologia molecolare, scoperta la struttura degli acidi nucleici, pensarono di associare al DNA una sequenza di simboli,

Dettagli

Il magnetismo nella materia

Il magnetismo nella materia Le orbite degli elettroni in atomo di idrogeno Forma spaziale degli Orbitali elettronici di atomo di idrogeno Un solido Il magnetismo nella materia ferrimagnetismo Dr. Daniele Di Gioacchino Istituto Nazionale

Dettagli

La regolazione genica nei eucarioti

La regolazione genica nei eucarioti La regolazione genica nei eucarioti Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri Differenziamento negli eucarioti pluricellulari Negli eucarioti le cellule specializzate dei vari tessuti contengono

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Il concetto di valore medio in generale

Il concetto di valore medio in generale Il concetto di valore medio in generale Nella statistica descrittiva si distinguono solitamente due tipi di medie: - le medie analitiche, che soddisfano ad una condizione di invarianza e si calcolano tenendo

Dettagli

Regione cerniera monomero regione cerniera

Regione cerniera monomero regione cerniera Regione cerniera Tutte le Ig, sia quelle secrete che quelle presenti sulla membrana plasmatica dei linfociti B, sono costituite da quattro catene proteiche, due pesanti (H, da heavy, in rosso nel disegno)

Dettagli

LA CHERATINA. CORSO COSMETOLOGIA- DOTT.SSA B. SCARABELLI (www.cosmesinice.it) PROTEINA: unione di più aminoacidi

LA CHERATINA. CORSO COSMETOLOGIA- DOTT.SSA B. SCARABELLI (www.cosmesinice.it) PROTEINA: unione di più aminoacidi PROTEINA: unione di più aminoacidi LA CHERATINA AMINOACIDO: molecola unità di base; ce ne sono 20 di cui 8 sono essenziali (da introdurre solo con i cibi) La struttura delle proteine vien suddivisa in

Dettagli

La propagazione delle onde luminose può essere studiata per mezzo delle equazioni di Maxwell. Tuttavia, nella maggior parte dei casi è possibile

La propagazione delle onde luminose può essere studiata per mezzo delle equazioni di Maxwell. Tuttavia, nella maggior parte dei casi è possibile Elementi di ottica L ottica si occupa dello studio dei percorsi dei raggi luminosi e dei fenomeni legati alla propagazione della luce in generale. Lo studio dell ottica nella fisica moderna si basa sul

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

6 Generalità Quando un pezzo presenta fori o cavità, il disegno può risultare di difficile comprensione a causa della presenza di numerose linee tratteggiate. 7 Generalità Sezionando ( tagliando ) con

Dettagli

Processo di rendering

Processo di rendering Processo di rendering Trasformazioni di vista Trasformazioni di vista Il processo di visione in tre dimensioni Le trasformazioni di proiezione 2 Rendering nello spazio 2D Il processo di rendering (visualizzazione)

Dettagli

LA TRADUZIONE E IL CODICE GENETICO

LA TRADUZIONE E IL CODICE GENETICO LA TRADUZIONE E IL CODICE GENETICO La traduzione La traduzione è il processo di sintesi di una catena polipeptidica, un polimero costituito da amminoacidi legati insieme da legami peptidici Le molecole

Dettagli

Esempi di funzione. Scheda Tre

Esempi di funzione. Scheda Tre Scheda Tre Funzioni Consideriamo una legge f che associa ad un elemento di un insieme X al più un elemento di un insieme Y; diciamo che f è una funzione, X è l insieme di partenza e X l insieme di arrivo.

Dettagli

Relazioni statistiche: regressione e correlazione

Relazioni statistiche: regressione e correlazione Relazioni statistiche: regressione e correlazione È detto studio della connessione lo studio si occupa della ricerca di relazioni fra due variabili statistiche o fra una mutabile e una variabile statistica

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it

LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it L INTENSITÀ DELLA CORRENTE ELETTRICA Consideriamo una lampadina inserita in un circuito elettrico costituito da fili metallici ed un interruttore.

Dettagli

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti Gli attivatori trascrizionali sono delle proteine modulari domini funzionali sovrapposti DIMOSTRAZIONE SPERIMENTALE DI DOMINI FUNZIONALI SEPARATI NEL TF DI LIEVITO GAL 4! Esperimenti di Ptshane. Cellule

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

Giuseppe Ruffo. Fisica: lezioni e

Giuseppe Ruffo. Fisica: lezioni e Giuseppe Ruffo Fisica: lezioni e problemi Unità A2 - La rappresentazione di dati e fenomeni 1. Le rappresentazioni di un fenomeno 2. I grafici cartesiani 3. Le grandezze direttamente proporzionali 4. Altre

Dettagli

Strumenti e metodi per la redazione della carta del pericolo da fenomeni torrentizi

Strumenti e metodi per la redazione della carta del pericolo da fenomeni torrentizi Versione 2.0 Strumenti e metodi per la redazione della carta del pericolo da fenomeni torrentizi Corso anno 2011 E. MANUALE UTILIZZO HAZARD MAPPER Il programma Hazard Mapper è stato realizzato per redarre,

Dettagli

LA MATERIA Suggerimenti didattici e schede

LA MATERIA Suggerimenti didattici e schede LA MATERIA Suggerimenti didattici e schede Iniziamo il percorso chiedendo a un bambino di consegnarci alcune cose: una gomma, una penna, un capello. Domandiamo a un altro di consegnarci una gioia, una

Dettagli

Downloaded from www.immunologyhomepage.com. Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B

Downloaded from www.immunologyhomepage.com. Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B Downloaded from www.immunologyhomepage.com Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B I geni che codificano i recettori per gli antigeni (BCR e TCR) sono presenti in uno

Dettagli

RNA non codificanti ed RNA regolatori

RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori RNA non codificanti ed RNA regolatori Piccoli RNA non codificanti RNA regolatore microrna RNAi e sirna Piccoli RNA non codificanti Gli RNA non codificanti (ncrna)

Dettagli

Estrazione del DNA. 1. Introduzione

Estrazione del DNA. 1. Introduzione Estrazione del DNA 1. Introduzione L obiettivo di questa esperienza è quello di osservare la molecola degli acidi nucleici, una volta separata dall involucro cellulare in cui è contenuta all interno della

Dettagli

1. PRIME PROPRIETÀ 2

1. PRIME PROPRIETÀ 2 RELAZIONI 1. Prime proprietà Il significato comune del concetto di relazione è facilmente intuibile: due elementi sono in relazione se c è un legame tra loro descritto da una certa proprietà; ad esempio,

Dettagli

A intervalli regolari ogni router manda la sua tabella a tutti i vicini, e riceve quelle dei vicini.

A intervalli regolari ogni router manda la sua tabella a tutti i vicini, e riceve quelle dei vicini. Algoritmi di routing dinamici (pag.89) UdA2_L5 Nelle moderne reti si usano algoritmi dinamici, che si adattano automaticamente ai cambiamenti della rete. Questi algoritmi non sono eseguiti solo all'avvio

Dettagli

Proprietà elettrostatiche dei dielettrici

Proprietà elettrostatiche dei dielettrici Proprietà elettrostatiche dei dielettrici Prendiamo in considerazione ciò che accade quando si riempie lo spazio con un isolante. Consideriamo un condensatore piano con il vuoto tra le armature. Carichiamo

Dettagli

Ogni globina ha una tasca in cui lega un gruppo EME, quindi l Hb può legare e trasportare 4 molecole di O 2

Ogni globina ha una tasca in cui lega un gruppo EME, quindi l Hb può legare e trasportare 4 molecole di O 2 Emoglobina (Hb): tetramero (le globine si associano formando due copie di dimeri αβ (α 1 β 1 e α 2 β 2 ) che si associano a formare un tetramero attraverso interazioni idrofobiche, legami H e ponti salini

Dettagli

ADESIONE CELLULARE SU MATERIALI BIOCOMPATIBILI

ADESIONE CELLULARE SU MATERIALI BIOCOMPATIBILI Capitolo 11 - studi sperimentali e di ricerca ADESIONE CELLULARE SU MATERIALI BIOCOMPATIBILI a cura di Maristella Di Carmine Marco Marchisio Sebastiano Miscia 237 Implantologia Pratica Caratterizzazione

Dettagli

REGOLAMENTO LIVE ROULETTE

REGOLAMENTO LIVE ROULETTE REGOLAMENTO LIVE ROULETTE La Live Roulette appartiene alla famiglia dei Giochi di sorte a quota fissa svolto con live dealer. Il gioco della Live Roulette prevede una pallina che, lanciata in direzione

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

You created this PDF from an application that is not licensed to print to novapdf printer (http://www.novapdf.com)

You created this PDF from an application that is not licensed to print to novapdf printer (http://www.novapdf.com) CROMATINA E CROMOSOMI UNA SCALA DI GRANDEZZE (E. coli) RNA + proteine Histon-like + DNA 4,64 Mb UNA SCALA DI GRANDEZZE (H. sapiens) TTCAGGAAATGACCCCTTTGCCCCGTCTGAAGGTAGTGCAGAGGCTGCACCTGAGCTGGACCTCTTTGCAATGAAGCCACCT

Dettagli

Lezione 4 *membrana cellulare *trasporti *specializzazioni del plasmalemma

Lezione 4 *membrana cellulare *trasporti *specializzazioni del plasmalemma Lezione 4 *membrana cellulare *trasporti *specializzazioni del plasmalemma Lezione 3 membrana cellulare Le membrane, sia quelle che delimitano e costituiscono gli organuli cellulari che quelle che rivestono

Dettagli

Appunti sulla Macchina di Turing. Macchina di Turing

Appunti sulla Macchina di Turing. Macchina di Turing Macchina di Turing Una macchina di Turing è costituita dai seguenti elementi (vedi fig. 1): a) una unità di memoria, detta memoria esterna, consistente in un nastro illimitato in entrambi i sensi e suddiviso

Dettagli

Il DNA: la molecola della vita

Il DNA: la molecola della vita Il DNA: la molecola della vita Gli acidi nucleici comprendono il DNA (acido desossiribonucleico) e l RNA (acido ribonucleico). Sono costituiti da molecole molto grandi, formate da unità dette nucleotidi,

Dettagli

Capitolo 13: L offerta dell impresa e il surplus del produttore

Capitolo 13: L offerta dell impresa e il surplus del produttore Capitolo 13: L offerta dell impresa e il surplus del produttore 13.1: Introduzione L analisi dei due capitoli precedenti ha fornito tutti i concetti necessari per affrontare l argomento di questo capitolo:

Dettagli

LA GRAFICA E LA GEOMETRIA OPERATIVA

LA GRAFICA E LA GEOMETRIA OPERATIVA LA GRAFICA E LA GEOMETRIA OPERATIVA La geometria operativa, contrariamente a quella descrittiva basata sulle regole per la rappresentazione delle forme geometriche, prende in considerazione lo spazio racchiuso

Dettagli

RNA polimerasi operone. L operatore è il tratto

RNA polimerasi operone. L operatore è il tratto La regolazione genica nei procarioti Alcune proteine vengono prodotte dalla cellula ad un ritmo relativamente costante e l attività dei geni che codificano queste proteine non è regolata in modo sofisticato.

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

APPUNTI DI MATEMATICA GEOMETRIA \ GEOMETRIA EUCLIDEA \ GEOMETRIA DEL PIANO (1)

APPUNTI DI MATEMATICA GEOMETRIA \ GEOMETRIA EUCLIDEA \ GEOMETRIA DEL PIANO (1) GEOMETRIA \ GEOMETRIA EUCLIDEA \ GEOMETRIA DEL PIANO (1) Un ente (geometrico) è un oggetto studiato dalla geometria. Per descrivere gli enti vengono utilizzate delle definizioni. Una definizione è una

Dettagli

Interruttore automatico

Interruttore automatico Interruttore automatico Dimensionamento degli interruttori automatici adeguati per inverter sotto effetti FV specifici Contenuto La scelta dell'interruttore automatico corretto dipende da diversi fattori.

Dettagli

RESISTENZA DEI MATERIALI TEST

RESISTENZA DEI MATERIALI TEST RESISTENZA DEI MATERIALI TEST 1. Nello studio della resistenza dei materiali, i corpi: a) sono tali per cui esiste sempre una proporzionalità diretta tra sollecitazione e deformazione b) sono considerati

Dettagli

Registratori di Cassa

Registratori di Cassa modulo Registratori di Cassa Interfacciamento con Registratore di Cassa RCH Nucleo@light GDO BREVE GUIDA ( su logiche di funzionamento e modalità d uso ) www.impresa24.ilsole24ore.com 1 Sommario Introduzione...

Dettagli