Adenina Adenine H H N N N N N Z

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Adenina Adenine H H N N N N N Z"

Transcript

1 Adenina Adenine Z

2 Guanina O GUAIA Z

3 Citosina CITOSIA Z O

4 Timina Thymine C3 O Z O

5 Siti di attacco elettrofilo 3

6 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA

7 Basi appaiate: Citosina-Guanina CITOSIA O GUAIA Z O 10.8 A Z

8 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

9 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

10 Legami ad idrogeno I legami ad, biologicamente più importanti,sono atomi di legati covalentemente ad atomo di O e di. E importante la posizione degli atomi di nelle basi, essi hanno localizzazioni atomiche preferite: gli atomi di legati ad anelli purinici o pirimidinici sono di solito in forma amminica solo raramente imminica. Gli atomi di O legati ai C della Guanina e della Timina hanno la forma chetonica raramente enolica.

11 LEGAMI IDROGEO I legami deboli più importanti nei sistemi biologici sono i legami di Van der Waals, i legami idrofobici, i legami idrogeno e i legami ionici. A volte la distinzione tra un legame ad idrogeno e un legame ionico è arbitraria. Le energie dei legami ad idrogeno e ionici sono comprese tra 3 e 7 kcalmol. I legami idrogeno e ionici possono formarsi solo tra molecole che posseggono una carica netta o in cui la carica è distribuita in maniera ineguale.l energia del più forte dei legamo deboli è solo dieci volte maggiore dell energia media del movimento cinetico a 25 C. Poiché esiste una significativa dispersione di energia nel movimento cinetico, a temperature fisiologiche esistono

12 sempre molte molecole con energia cinetica sufficiente per spezzare il più forte dei legami deboli.la vita media di un singolo legame debole è solo una frazione di secondo. I legami idrogeno, diversamente dai legami di Van der Waals, sono altamente direzionali. ei legami più forti, l atomo di punta direttamente verso l atomo accettore. Se la sua direzione devia di più di 30, l energia di legame è molto minore. I legami idrogeno sono molto più specifici dei legami di Van der Waals, poiché essi richiedono l esistenza di molecole con gruppi donatori e accettori di idrogeno complementari.

13 COME E FORMATA U ELICA Essa è formata da due o più pale che si inseriscono su un cilindro. Consideriamo la coppia di basi Purina-Pirimidina come le pale di un elica.la coppia di basi,durante l appaiamento, non si posiziona sullo stesso piano ma, a seconda della loro inclinazione esse formano un angolo con l asse dell elica.avremo così due differnti forme di DA: A DA e B DA A DA B DA differiscono nella distanza richiesta per fare un giro d elica completo (passo) e per l angolo di inclinazione che le basi formano con l asse dell elica. el B DA gli accoppiamenti Purina-Pirimidina sono distanti 3,4 A e sono orientati in maniera quasi perpendicolare all asse dell elica:esso appare di forma più allungata e sottile. Ci sono 11 nucleotidi in un giro d elica

14 Esiste una terza forma di DA: Z DA la cui caratteristica è di essere sinistrorsa.ciò è dovuto alla posizione Anti o Sin del glucosio che si lega con legame glucosidico alla base. Per meglio dire, nell elica sinistrorsa, l unità di ripetizione è un dinucleotide Pirimidina-Purina con il legame glucosidico in configurazione Anti nei residui Pirimidinici e in configurazione Sin nei residui Purinici. el DA destrorso. Illegame glucosidico ha sempre orientamento Anti, dunque è la differente configurazione del nucleotide purinico che genera eliche sinistrorse. Le configurazioni alternanti Anti- Sin danno all impalcatura del DA sinistrorso un aspetto a zig-zag che lo distingue dalle forme B e A.

15 DOPPIA ELICA

16 Gli acidi nucleici possono formare vari tipi di doppia elica

17 Gli acidi nucleici possono formare vari tipi di doppia elica Elica Coppie di basi per giro Rotazione tra due basi Diametro B 10 (10,4) 36 (34,6) 20 (19) A 11 32,7 23 Z

18 el A DA gli accoppiamenti Purina-Pirimidina sono distanti 2,7 A (la distanza tra le basi è minore) e sono inclinate di circa 30 (Infatti il B DA si converte in A DA per inclinazione della coppia delle basi di circa 30 ).Esso appare di forma più corta e più spessa. Ci sono 10 nucleotidi in un giro d elica. La forma B è presente normalmente nelle cellule, la forma A è presente in seguito a disidratazione. Il B DA e A DA sono destrorse.

19 TOPOISOMERASI Poiché il DA è una struttura particolarmente flessibile, essa può avvolgersi ulteriormente e questo tipo di cambiamento conformazionale (topologico) prende il nome di superavvolgimento che può essere negativo se si ha lo svolgimento della doppia elica o positivo se si ha un ulteriore avvolgimento. Le topoisomerasi sono un gruppo di enzimi che convertono uno stato topologico in un altro. La topoisomerasi II usa l ATP per generare superavvolgimenti; l azione di questo enzima è controbilanciata dalla topoisomerasi I

20 ella cellula la quantità relativa delle topoisomerasi I e II è finemente regolata in modo da mantenere la quantità corretta di superavvolgimento. Le topoisomerasi operano dei tagli temporanei e le estremità generate non sono libere ma rimangono legate all enzima. Il taglio è necessario affinchè si possa formare un varco dove un filamento di DA possa passare e generare così superavvolgimenti positivi o negativi.

21 Enzimi che alterano la topologia del DA Topoisomerasi: tipo I tipo II (girasi)

22 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

23 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

24 Enzimi per gli acidi nucleici Polimerasi: DA polimerasi RA polimerasi ucleasi: esonucleasi endonucleasi

25 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

26 Lewin, IL GEE VIII, Zanichelli editore S.p.A. Copyright 2006

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

La genetica molecolare

La genetica molecolare La genetica molecolare 1 Il materiale genetico Varia di quantità da specie a specie. Regola lo sviluppo della cellula. Ha la capacità di duplicarsi. Nome comune Numero di coppie di cromosomi zanzara 3

Dettagli

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

ACIDI NUCLEICI Il dogma centrale della biologia

ACIDI NUCLEICI Il dogma centrale della biologia ACIDI NUCLEICI Il dogma centrale della biologia DNA RNA PROTEINE DNA POLINUCLEOTIDI NUCLEOTIDI NUCLEOSIDI ZUCCHERI ACIDO FOSFORICO BASI AZOTATE Ribosio 2 deossiribosio PURINE PIRIMIDINE Adenina Guanina

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA Nucleotidi e Acidi Nucleici Nucleosidi Nucleotidi Funzioni biologiche dei nucleotidi Struttura di DNA e RNA Concatenazione e appaiamento dei nucleotidi Lo scheletro degli acidi nucleici Componenti degli

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Alcune sequenze di DNA insolite. Palindromo. Sequenze con una simmetria doppia

Alcune sequenze di DNA insolite. Palindromo. Sequenze con una simmetria doppia Alcune sequenze di DNA insolite Palindromo Sequenze con una simmetria doppia Possono formare: Struttura a croce dette anche anse cruciformi DNA rilassato DNA parzialmente disavvolto DNA cruciforme Struttura

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto Topoisomerasi Il DNA di batteri, mitocondri, plastidi e alcuni virus è costituito da una doppia elica circolare. Consideriamo una molecola di DNA circolare a doppia elica rilassata e chiusa, formata da

Dettagli

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto Gli acidi nucleici, DA (acido deossiribonucleico) e RA (acido ribonucleico), sono polimeri biologicamente importanti in quanto svolgono ruoli fondamentali nell ereditarietà e nella sintesi proteica. Sono

Dettagli

Gli Acidi Nucleici DNA RNA

Gli Acidi Nucleici DNA RNA Gli Acidi Nucleici DNA RNA Gli Acidi nucleici Gli acidi nucleici sono il: DNA (acido desossiribonucleico) RNA (acido ribonucleico) Essi sono formati dai polimeri (molecole molto grosse) i cui monomeri

Dettagli

Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA...

Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA... ACIDI NUCLEICI...2 FUNZIONI DEL DNA...5 FUNZIONI DELL RNA...5 I NUCLEOTIDI...6 Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE

Dettagli

Il DNA conserva l informazione genetica

Il DNA conserva l informazione genetica Il DNA conserva l informazione genetica Gli esperimenti di Frederick Griffith (1928) Gli esperimenti di Oswald Avery (1944) + Estratti dal ceppo IIIS ucciso al calore di Polisaccaridi Lipidi Proteine Acidi

Dettagli

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di atomi. La formazione del legame covalente si basa

Dettagli

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica.

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica. NUCLEOTIDI a) Forma di energia utilizzata nel metabolismo cellulare (ATP, GTP) b) Entrano a far parte della struttura di cofattori enzimatici (coenzimi) e intermedi metabolici c) Costituiscono gli ACIDI

Dettagli

N H. 9H-purine. Le pirimidine che si trovano nel DNA sono citosina e timina: mentre nell RNA ritroviamo citosina e uracile:

N H. 9H-purine. Le pirimidine che si trovano nel DNA sono citosina e timina: mentre nell RNA ritroviamo citosina e uracile: Lezione del 5 Maggio 2009 ucleotidi ed acidi nucleici Pirimidine e Purine Al fine di comprendere la struttura e le proprietà del DA e del RA, abbiamo bisogno di guardare in dettaglio ai loro componenti

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

CELLULA PROCARIOTICA PROCARIOTE

CELLULA PROCARIOTICA PROCARIOTE CELLULA PROCARIOTICA O PROCARIOTE CELLULA EUCARIOTICA O EUCARIOTE Sany0196.jpg IL NUCLEO Provvisto di due membrane (interna ed esterna) che congiungendosi in alcuni punti formano i pori nucleari attraverso

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Modello Watson-Crick del DNA

Modello Watson-Crick del DNA Modello Watson-Crick del DNA Diffrazione raggi X (Wilkins & Franklin) Modello atomico a doppia elica (B-DNA, Watson & Crick) VMD 1 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Modulo 8: I nucleotidi e gli acidi nucleici

Modulo 8: I nucleotidi e gli acidi nucleici Modulo 8: I nucleotidi e gli acidi nucleici Modulo 10: Acidi nucleici Filamento di DNA fuoriuscito da una cellula di Escherichia coli Struttura e funzioni dei nucleotidi Funzioni dei nucleotidi: Unità

Dettagli

2. DUPLICAZIONE DNA. 1. COMPOSIZIONE e STRUTTURA 3. CROMOSOMI

2. DUPLICAZIONE DNA. 1. COMPOSIZIONE e STRUTTURA 3. CROMOSOMI 2. DUPLICAZIONE DNA 1. COMPOSIZIONE e STRUTTURA 3. CROMOSOMI 1 1. COMPOSIZIONE e STRUTTURA Ma che cos è il DNA? è un contenitore di informazioni... scritte come sequenza di basi azotate 2 Acidi Nucleici:

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

estremità 5' DNA O - P O H 2 C O H H H H G N H O H 2 C P O H H T N ponte fosfodiestere O 3 P O estremità 3' etc.

estremità 5' DNA O - P O H 2 C O H H H H G N H O H 2 C P O H H T N ponte fosfodiestere O 3 P O estremità 3' etc. estremità 5' 5 3 - P N 5 2 C 3 ponte fosfodiestere P A 1 2 C 5 P 3 G N 1 2 C 5 3 P T N 1 5 2 C 3 etc. DNA C N 1 estremità 3' zucchero N 1 C 3 4 3 timina N adenina N N 1 6 N N 9 N zucchero N zucchero citosina

Dettagli

David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita

David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita 1 David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis Biologia La scienza della vita 2 B - L ereditarietà e l evoluzione Il linguaggio della vita 3 Il materiale genetico

Dettagli

Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson

Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Una divisione equa Quando una cellula si divide, si formano due nuove cellule che contengono esattamente

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Acidi Nucleici. Contenuto:

Acidi Nucleici. Contenuto: Acidi Nucleici Contenuto: Il DNA e' l'unica molecola depositaria dell'informazione genetica, ossia del progetto nel quale sono immagazzinate istruzioni precise per tutte le caratteristiche ereditarie autoduplicazione

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

D'Addario - Biologia Molecolare

D'Addario - Biologia Molecolare 2. Struttura del DNA contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale gli acidi nucleici, acido desossiribonucleico (DNA)

Dettagli

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1)

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise da coppie di atomi. Legami covalenti Importanza dei legami non covalenti in Biologia

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

ACIDI NUCLEICI ESPERIMENTI

ACIDI NUCLEICI ESPERIMENTI ACIDI NUCLEICI ESPERIMENTI 1869 FRIEDRICK MIESCHER Isolò per la prima volta una sostanza zuccherina leggermente acida contenente fosforo Questa sostanza venne chiamata: acido nucleico perché scoperta nel

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Prof. Antimo Di Maro Anno Accademico 2016-17 Lezione 11 fattore trasformante L'esperimento

Dettagli

STRUTTURE DEGLI ACIDI NUCLEICI, CODICE GENETICO E REPLICAZIONE DEL DNA

STRUTTURE DEGLI ACIDI NUCLEICI, CODICE GENETICO E REPLICAZIONE DEL DNA IL LABORATORIO DI BIOLOGIA MOLECOLARE: Introduzione alle tecniche e alle loro applicazioni STRUTTURE DEGLI ACIDI NUCLEICI, Il DNA nell arte: Susan Rankaitis 2002, DNA2 CODICE GENETICO E REPLICAZIONE DEL

Dettagli

20/12/2013. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/12/2013. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Importanza dei legami non covalenti in Biologia Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di

Dettagli

1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick

1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick 1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick Il genoma di E. coli ha 4.0 milioni di nucleotidi Le dimensioni del DNA in vivo Organismo

Dettagli

LE BASI AZOTATE PIRIMIDINE PURINE

LE BASI AZOTATE PIRIMIDINE PURINE LE BASI AZTATE PURIE PIRIMIDIE Le basi azotate sono composti eterociclici aromatici con azoti portanti doppietti basici. Possono avere un solo anello (pirimidine) o due (purine). Le basi adenina, guanina

Dettagli

La nuova biologia.blu

La nuova biologia.blu David Sadava, David M. Hillis, H. Craig Heller, May R. Berenbaum La nuova biologia.blu Genetica, DNA ed evoluzione PLUS 2 Capitolo B2 Il linguaggio della vita 3 Le basi molecolari dell ereditarietà Prima

Dettagli

MODALITA DI REPLICAZIONE

MODALITA DI REPLICAZIONE MODALITA DI REPLICAZIONE In teoria è ipotizzabile che il DNA possa duplicarsi con modalità: 1) semi-conservativa se alla generazione successiva passano due doppie eliche entrambi costituite da un'elica

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Dimensioni di Genomi

Dimensioni di Genomi Dimensioni di Genomi plasmids viruses bacteria fungi plants algae insects mollusks bony fish amphibians Il Genoma umano è costituito da circa 3 miliardi di bp e contiene un numero di geni pari a circa

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Nucleotidi 24/10/2012. Studenti: Biotec _ Nucleotidi (1) Ribosio Vs. Desossirbosio

Nucleotidi 24/10/2012. Studenti: Biotec _ Nucleotidi (1) Ribosio Vs. Desossirbosio I Nucleotidi Hanno Tre Componenti Nucleotidi Studenti: Biotec _ 2012 Nucleotidi (1) Ribosio Vs. Desossirbosio Un Nucleotide è una molecola costituita da un composto ad anello contenente azoto (N) legato

Dettagli

La trascrizione è simile alla replicazione ma esistono alcune importanti differenze

La trascrizione è simile alla replicazione ma esistono alcune importanti differenze LA TRASCRIZIONE processo nel quale il DNA stampo viene copiato in una molecola di RNA La molecola di RNA è identica in sequenza all elica codificante e complementare a quella stampo. La trascrizione è

Dettagli

Nucleotidi 26/10/2014. Nucleotidi (1)

Nucleotidi 26/10/2014. Nucleotidi (1) I Nucleotidi Hanno Tre Componenti Base azotata Nucleotidi https://www2.chemistry.msu.edu/faculty/reusch/virttxtjml/nucacids.htm Base azotata Qualsiasi composto che manifesta proprietà basiche per via della

Dettagli

DNA DNA DNA Legge di complementarietà delle basi Se in un filamento è presente una T nell altro filamento deve essere presente una A. Se è presente una C nell altro ci dovrà essere una G. E possibile

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 19 Acidi nucleici Concetti chiave: Le basi azotate dei nucleotidi comprendono due tipi di purine e tre tipi di pirimidine.

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE. Dott.ssa A. Fiarè

CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE. Dott.ssa A. Fiarè CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE Dott.ssa A. Fiarè IL DNA (ACIDO DESOSSIRIBONUCLEICO) E UN ACIDO NUCLEICO DEFINITO POLINUCLEOTIDE, IN QUANTO E UNA MOLECOLA FORMATA

Dettagli

Strutture alternative e strutture superiori degli acidi nucleici

Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative La struttura a doppia elica proposta da Crick e Watson, e che abbiamo sopra descritto, è quella ottenuta mediante

Dettagli

Funzioni dei nucleotidi

Funzioni dei nucleotidi Funzioni dei nucleotidi monomeri degli acidi nucleici esempi di altre funzioni ATP: moneta energetica GTP: fonte di energia nella sintesi proteica camp: secondo messaggero nella trasduzione del segnale

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

Gerard Tortora, Brian Derrickson. Conosciamo

Gerard Tortora, Brian Derrickson. Conosciamo 1 Gerard Tortora, Brian Derrickson Conosciamo il corpo umano Capitolo 1 L organizzazione del corpo umano 1. Che cosa sono l anatomia e la fisiologia 2. I livelli di organizzazione e gli apparati del corpo

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI

02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI Tutti gli esseri viventi sono composti da cellule Eubatteri Procarioti unicellulari Archebatteri LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI -Autoconservazione mantenimento della

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni I LEGAMI CIMICI In natura sono pochi gli elementi che presentano atomi allo stato libero. Gli unici elementi che sono costituiti da atomi isolati si chiamano gas nobili o inerti, formano il gruppo VIII

Dettagli

IL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene

IL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene IL MATERIALE EREDITARIO Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene Caratteristiche del materiale ereditario 1 Replicarsi accuratamente durante crescita e divisione

Dettagli

Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi

Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi Gli organismi sono fatti da MATERIA*. (*qualsiasi cosa che occupa uno spazio e ha una massa) Gli antichi filosofi greci dicevano che la materia deriva da 4 ingredienti di base o ELEMENTI (ARIA, ACQUA,

Dettagli

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Corso di BIOCHIMICA Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Materiale didattico e esercizi su: http://moodle2.units.it/ Password: BioFarma

Dettagli

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi Il DNA Il DNA è una sostanza che si trova in ogni cellula e contiene tutte le informazioni sulla forma e sulle funzioni di ogni essere vivente: eppure è una molecola incredibilmente semplice. COME È FATTO?

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona

Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona Scientists with lab coats: Corso di laboratorio Chimico-Biologico Dott.ssa Valeria Berton Università di Verona Il DNA Il DNA contiene l informazione genetica di un organismo Scritta in un codice chimico

Dettagli

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole Introduzione alla chimica organica 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole La chimica organica tratta di pochissimi atomi che si possono combinare in moltissimi modi Grande importanza

Dettagli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari (sono in grado di aumentare la velocità delle reazioni biologiche anche di 10 20 volte). Durante

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Le macromolecole, a loro volta, derivano dall associazione di piccole molecole che risultano formate da atomi. LA MATERIA E GLI ATOMI

Le macromolecole, a loro volta, derivano dall associazione di piccole molecole che risultano formate da atomi. LA MATERIA E GLI ATOMI 7. Biologia 7 La biologia (dal greco bìos vita e lògos discorso) è la scienza della vita; essa comprende tutte le discipline che studiano la forma e la struttura (per esempio l anatomia e la citologia),

Dettagli

q In che modo viene conservato il materiale genetico? q Come viene decodificata l informazione contenuta nel materiale genetico?

q In che modo viene conservato il materiale genetico? q Come viene decodificata l informazione contenuta nel materiale genetico? La vita dipende dalla capacità delle cellule di immagazzinare, recuperare e tradurre le informazioni genetiche necessarie per costruire e mantenere un organismo vivente. q L informazione viene trasmessa

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Nucleotidi 20/12/2013. Nucleotidi (1) Ribosio Vs. Desossirbosio

Nucleotidi 20/12/2013. Nucleotidi (1) Ribosio Vs. Desossirbosio I Nucleotidi Hanno Tre Componenti Nucleotidi https://www2.chemistry.msu.edu/faculty/reusch/virttxtjml/nucacids.htm Nucleotidi (1) Ribosio Vs. Desossirbosio Un Nucleotide è una molecola costituita da un

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

CHIMICA ORGANICA = STUDIO DEI COMPOSTI DEL CARBONIO. energia superiore. energia inferiore. orbitale s

CHIMICA ORGANICA = STUDIO DEI COMPOSTI DEL CARBONIO. energia superiore. energia inferiore. orbitale s CIMICA ORGANICA = STUDIO DEI COMPOSTI DEL CARBONIO C elemento del secondo periodo della tavola periodica; numero atomico = 6 configurazione elettronica del C 2p 2s 1s energia superiore energia inferiore

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

CHIMICA BIOLOGICA. Università degli Studi della Campania Luigi Vanvitelli. Antimo Di Maro. Lezione 0. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Università degli Studi della Campania Luigi Vanvitelli. Antimo Di Maro. Lezione 0. Corso di Laurea in Scienze Biologiche Università degli Studi della Campania Luigi Vanvitelli Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 0 Chimica Biologica o Biochimica

Dettagli

DNA e replicazione del DNA

DNA e replicazione del DNA DNA e replicazione del DNA 1928: EXP di Griffith Scoperto il fattore trasformante Struttura elicoidale del DNA Struttura del DNA Subunità nucleotidiche Struttura del DNA Subunità nucleotidiche La replicazione

Dettagli

Contenuto di DNA aploide in alcune specie

Contenuto di DNA aploide in alcune specie Contenuto di DNA aploide in alcune specie 1-10 2 kb 10 3 kb 10 4 kb 10 5-10 8 kb Dimensioni del genoma Paradosso del valore C Non c è una correlazione tra la quantità di DNA e la complessità di un organismo

Dettagli

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente)

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente) OVERVIEW Atomo: più piccola porzione di un elemento che mantiene le proprietà chimiche dello stesso Teoria atomica e tavola periodica Legami e interazioni degli atomi Acqua e le sue proprietà Acidi e basi

Dettagli

La chimica della vita

La chimica della vita La chimica della vita La materia presente nell universo è formata da 92 elementi Gli elementi si legano tra loro per formare le molecole che costituiscono i composti Legame covalente O H H Molecola Composto

Dettagli

SDD Seconde Gli acidi nucleici. Gli acidi nucleici

SDD Seconde Gli acidi nucleici. Gli acidi nucleici 1 Capire come le informazioni genetiche sono immagazzinate nelle cellule e come avviene la trasformazione di queste informazioni nei meccanismi metabolici delle cellule. Quattro mattoncini La cellula ha

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli