La struttura delle proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "La struttura delle proteine"

Transcript

1 La struttura delle proteine

2 Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina

3 Struttura secondaria: ripiegamento locale della catena polipeptidica con andamento ripetitivo regolare (si considera la disposizione spaziale dello scheletro del polipeptide, senza considerare la disposizione delle catene laterali).

4 Il legame peptidico

5

6

7 Il gruppo peptidico, come conseguenza delle interazioni di risonanza, è una struttura rigida e planare con le caratteristiche tipiche del doppio legame Il legame C-N è circa 0.13 Å più corto del legame N-Cα; mentre il il legame C=O è circa 0.02 Å più lungo di quello delle aldeidi o dei chetoni.

8 I due carboni alfa sono in configurazione trans (unica possibile eccezione Pro)

9

10 Per convenzione gli angoli di torsione φ (N-Cα) e ψ (Cα-C) sono uguali a 180 quando il polipeptide è nella conformazione completamente estesa In linea di principio gli angoli φ e ψ possono assumere qualunque valore compreso tra -180 e +180, ma molti di questi valori sono impediti per problemi di interferenza sterica tra gli atomi dello scheletro polipeptidico e quelli della catena laterale

11 Collisione!!!

12 Struttura secondaria: ripiegamento locale della catena polipeptidica con andamento ripetitivo regolare (si considera la disposizione spaziale dello scheletro del polipeptide, senza considerare la disposizione delle catene laterali.

13 Il grafico di Ramachandran Le zone in verde indicano indicano gli angoli Ψ e Φ stericamente consentiti. = Alfa elica destrorsa L = Alfa elica sinistrorsa = foglietto b parallelo = foglietto b antiparallelo C = elica del collagene

14 L α elica (Pauling e Corey, 1951) 3,6 residui per giro Catene laterali verso l esterno Passo di 5,4 Å Legame idrogeno ottimale (2,8 Å) tra C=O e N-H di quattro residui successivi

15 elica vista dall alto

16 Il dipolo elettrico di un legame peptidico viene trasmesso lungo l elica mediante i legami idrogeno intercatena, generando un dipolo complessivo dell elica

17 Limitazioni alla formazione di α eliche (condizioni che alterano la stabilità) Repulsione o attrazione elettrostatica tra residui con -R carichi (consecutivi) Dimensione dei gruppi -R adiacenti (ingombro sterico) Presenza di prolina (Pro) : ripiegamento destabilizzante, impossibilità di formare il legame idrogeno con gli altri residui Presenza di glicina (Gly) : elevata flessibilità conformazionale avvolgimenti meno rigidi. Interazione tra gli amminoacidi terminali dell'elica : formazione di un dipolo elettrico (gli aa con R- vicino a N-term, aa con R+ vicino a C-term)

18 La conformazione beta delle catene polipeptidiche Pauling e Corey 1951

19 La conformazione beta delle catene polipeptidiche

20 Connessioni tra catene adiacenti nei foglietti β

21 Rappresentazione schematica della carbossipeptidasi A

22

23

24

25

26 La struttura terziaria e quaternaria delle proteine Proteine fibrose e proteine globulari

27 Proteine fibrose

28 Avvolgimento dell α-cheratina (parte centrale) Ripetizione di seq. Aa : a-b-c-d-e-f-g, con a e d non polari e allineati sui lati delle due eliche. 3,5 residui/giro passo 5,4 Å Le due eliche formano un coiled coil

29 Diversi livelli di organizzazione della cheratina

30 Sezione trasversale di un capello Cellule morte con fasci di fibrille di cheratina ad alto contenuto di S-S

31

32

33 La fibroina della seta Foglietti b antiparalleli estesi Ripetizione (-Gly-Ser-Gly-Ala-Gly-Ala-) n Flessibile ma non estensibile

34 La tripla elica del collageno Vari tipi di catene (nei mammiferi 30 catene in 19 combinazioni) Conformazione elicoidale sinistrorsa con tre residui circa per giro Tre catene si avvolgono l una sull altra con andamento destrorso Gly-X-Y spesso X = Pro Y = HyPro Prolil idrossilasi Vitamina C

35 Interazioni molecolari nel collagene I residui Gly sono vicini all asse dell elica

36 Le fibre sono stabilizzate dalle interazioni idrofobiche tra le tre eliche vicine. Ci sono anche legami covalenti trasversali. Questi NON sono ponti disolfuro, bensì

37 i legami trasversali si formano tra due residui di His e Lys (innescate dalla lisil ossidasi) e aumentano con l età.

38 Conformazioni diverse conferiscono alle proteine proprietà diverse dimensioni e forme diverse

39 Proteine globulari

40 Le eliche e i foglietti possono combinarsi in vari modi

41 Motivi proteici

42 Distribuzione delle catene laterali

43 I polipeptidi di grandi dimensioni si organizzano in domini G3PD

44 La struttura quaternaria ha aspetti funzionali rilevanti Meno informazione genetica Maggiore fedeltà di sintesi Molteplicità dei siti funzionali Migliore possibilità di regolazione

45 Simmetria nelle proteine oligomeriche

46 Ripiegamento e stabilità delle proteine La conformazione nativa di una proteina è quella a cui si associa la sua funzione biologica. Il termine stabilità può essere definito come la tendenza a mantenere la conformazione nativa In condizioni fisiologiche le proteine sono solo marginalmente stabili ( G compreso tra 15 e 65 kj/mole)

47 Forze che stabilizzano le proteine Effetto idrofobico tendenza delle sostanze non polari a minimizzare il contatto con l acqua Interazioni elettrostatiche ad es. formazione di ponti H, forze di Van der Waals Legami chimici trasversali ad es. ponti disolfuro

48 Profilo di idropaticità

49 Denaturazione e rinaturazione delle proteine

50 I legami disolfuro possono essere rotti da agenti riducenti

51

52 Gli agenti caotropici

53

54 L esperimento di Anfinsen (1957) 1 2

55 3 4

56 Il paradosso di Levinthal Come fa una proteina a raggiungere la sua conformazione nativa? - Proteina di 100 amminoacidi - Supponiamo almeno 10 diverse conformazioni per aminoacido = conformazioni possibili - Se il ripiegamento è casuale e richiede, ad esempio, sec per sperimentare ciascuna conformazione possibile, ci vorrebbero anni per testare tutte le conformazioni possibili alla ricerca della migliore.

57 L avvolgimento (folding) delle proteine avviene attraverso un numero limitato di intermedi

58

59 Disolfuro isomerasi

60 Gli chaperoni molecolari 7 x GroES 7 x GroEL/ATP 7 x GroEL Consentono il folding all interno di una cavità, impedendo l interazione con altre molecole proteiche

61

62 Alcune patologie sono legate ad un errato ripiegamento delle proteine Proteina del Prione Nativa aggregata altre proteine

63 Le proteine sono molecole flessibili mioglobina

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding)

LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding) LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding) Una s. terziaria mi dà le percentuali di: - random coil

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Modificazioni delle proteine

Modificazioni delle proteine Modificazioni delle proteine POST-TRADUZIONALI = avvengono dopo la sintesi proteica CO-TRADUZIONALI = avvengono durante la sintesi proteica Sono modificazioni chimiche della catena polipeptidica ad opera,

Dettagli

CLASSIFICAZIONE DEI PEPTIDI

CLASSIFICAZIONE DEI PEPTIDI terminale). PEPTIDI Gli amminoacidi si legano tra di loro attraverso una reazione che coinvolge COOH di un amminoacido e NH 2 di un altro amminoacido, con la liberazione di una molecola di acqua per ogni

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale

La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale La struttura secondaria si riferisce a una speciale disposizione spaziale di residui

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

IL COLLAGENO. E la specie proteica più abbondante nella maggior parte dei vertebrati, in tutti gli organi è presente la molecola di collageno.

IL COLLAGENO. E la specie proteica più abbondante nella maggior parte dei vertebrati, in tutti gli organi è presente la molecola di collageno. IL COLLAGENO E la specie proteica più abbondante nella maggior parte dei vertebrati, in tutti gli organi è presente la molecola di collageno. Fibre di collageno formano la matrice dell osso su cui precipitano

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

Peptidi, proteine ed e nzim i i 1

Peptidi, proteine ed e nzim i i 1 Peptidi, proteine ed enzimi 1 Gli amminoacidi possono formare catene Due amminoacidi possono unirsi tra loro attraverso il legame ammidico detto legame peptidico, tra il gruppo NH 2 di un amminoacido e

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

GLI AMMINOACIDI E LE PROTEINE

GLI AMMINOACIDI E LE PROTEINE UNITÀ VET. DIDATTICA DI PROPEDEUTICA BIOCHIMICA GLI AMMINOACIDI E LE PROTEINE Roberto Giacominelli Stuffler INTRODUZIONE Tutte le proteine, sia nei batteri, sia nelle forme di vita più complesse, sono

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU)

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) Roberto Giacominelli Stuffler IL CORSO MONODISCIPLINARE DI BIOCHIMICA È SUDDIVISO IN DUE UNITÀ

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi.

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi. Il legame peptidico Il legame peptidico La polimerizzazione di AA viene raggiunta per eliminazione di una molecola d acqua tra il gruppo carbossilico di un AA e il gruppo amminico del successivo. Il legame

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ Scaricato da Le proteine con peso molecolare superiore a 50.000 sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ SunHope.it 1 Scaricato da Le proteine oligomeriche

Dettagli

Le proteine e i suoi costituenti

Le proteine e i suoi costituenti Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da pròteios = primario, Mulder 1839) Funzioni:

Dettagli