30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura"

Transcript

1 Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari, idrofobici - alto contenuto in aa polari, idrofilici (Ser, Thr, Tyr), potenziali siti di fosforilazioni. 1

2 In queste condizioni il polipeptide non è in grado di creare un core idrofobico e non può quindi organizzarsi in una struttura ordinata e globulare. IDP - mancanza di una struttura stabile - grande flessibilità e plasticità - capacità di dar luogo a differenti forme fosforilate - riconoscimento di specifiche proteine - capacità di strutturarsi su di esse e di svolgere la loro azione biologica - controllo del ciclo cellulare - regolazione trascrizionale e traduzionale 2

3 Esperimento di Anfinsen RNasi nativa RNasi denaturata (gomitolo casuale o random coil) In seguito alla denaturazione la RNasi perde completamente la sua attività enzimatica. 3

4 Procedendo opportunamente è possibile rinaturare la proteina. 8 Cys 4 ponti disolfuro possibili 105 combinazioni: 104 sono inattive una sola è attiva ( strapazzate ) La rinaturazione è possibile ed è guidata dalla struttura primaria. La struttura tridimensionale corrisponde alla conformazione termodinamicamente più stabile, cioè a minor contenuto di energia libera, e questa, a sua volta, ne determina l attività biologica e quindi la funzione. 4

5 Il folding di una proteina a partire dal polipeptide neosintetizzato non può essere un processo che si svolge secondo il principio del tentativo ed errore. Se così fosse ci vorrebbe un tempo infinitamente lungo, mentre invece, di norma, il folding richiede meno di un sec. Il fatto che il folding sia così veloce (<1 sec) indica che la transizione è un processo fortemente cooperativo. Modelli di folding delle proteine m. gerarchico m. del collasso idrofobico 5

6 Modello gerarchico Si formano prima piccoli tratti di struttura secondaria che facilitano ed accelerano la produzione di elementi via via più grandi che cooperano fino ad arrivare alla forma nativa. Modello del collasso idrofobico Si forma innanzitutto una struttura compatta (molten globule), guidata dall effetto idrofobico; dopo di che la proteina acquisisce la sua corretta e definitiva struttura. 6

7 Il folding è facilitato e reso più rapido dalla presenza di chaperons molecolari tra cui le Heat Shock Proteins, Hsp70 e Hsp60 (o chaperonine) che agiscono in successione facilitando il corretto avvolgimento. Nonostante ciò, si possono verificare avvolgimenti non corretti a carico dei polipeptidi neosintetizzati ( misfolding proteico) - di essi alcuni vengono distrutti - altri sono la causa di gravi patologie. 7

8 In particolare, il misfolding proteico può causare una vasta gamma di patologie neurodegenerative, tra cui il morbo di Alzheimer, il morbo di Parkinson e le encefalopatie spongiformi. Alla base di esse vi è una anomala transizione Ciò comporta che proteine normali, solubili, precipitino in aggregati fibrillari, insolubili (placche amiloidi). Le malattie che ne derivano sono chiamate amiloidosi. 8

9 Morbo di Alzheimer Da una proteina cerebrale transmembrana deriva il cosiddetto peptide β-amiloide, che si aggrega a formare depositi di foglietti- (placche -amiloidi). 9

10 Encefalopatie spongiformi - BSE (morbo della mucca pazza) - Malattia di Creutzfeldt-Jacob malattie neurodegenerative in cui numerose lacune conferiscono al cervello un aspetto spugnoso. L agente eziologico della BSE è la versione alterata di una normale proteina prionica del cervello. L interazione della forma infettiva (foglietti- ) con la proteina normale ( -eliche) ne determina la conversione nella forma infettiva, dando inizio ad un effetto a cascata. 10

11 11

12 Struttura quaternaria Si riferisce alla disposizione nello spazio delle diverse subunità di una proteina oligomerica. È stabilizzata solo da legami deboli: -legami H - legami ionici - forze di van der Waals - interazioni idrofobiche Emoglobina Insulina L insulina non possiede struttura quaternaria. 12

13 Vantaggi della struttura quaternaria Risparmio di DNA Minimizzazione degli errori casuali durante la biosintesi proteica Regolazione allosterica Risparmio di DNA Se una certa proteina è costituita da più subunità uguali, ciascuna catena può derivare da uno stesso gene che viene tradotto più volte. 13

14 Minimizzazione degli errori Biosintesi di una proteina di aa A) Singola catena di aa B) 100 catene di 1000 aa ciascuna Se vi è una incidenza di errori pari a 1/ : A) Tutte le proteine conterranno un errore B) Solo una subunità su 100 conterrà un errore e potrà essere scartata REGOLAZIONE ALLOSTERICA La struttura quaternaria di una proteina subisce una modifica conformazionale reversibile ad opera di un ligando: si realizza così un importante meccanismo di controllo della sua attività. L emoglobina e numerosi enzimi sono un esempio di proteine allosteriche. 14

15 L Hb lega l O 2 con un meccanismo cooperativo positivo, cioè il legame dell O 2 provoca un cambio conformazionale a cui corrisponde un aumento nell affinità per l O 2. 15

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Folding delle Proteine

Folding delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Folding delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

STRUTTURA E FUNZIONE DELLE

STRUTTURA E FUNZIONE DELLE STRUTTURA E FUNZIONE DELLE PROTEINE Compongono la STRUTTURA della cellula ma hanno anche altre FUNZIONI intelaiatura citoscheletrica strutture cellulari (organelli) impalcatura di sostegno extracellulare

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA

LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA LE PROTEINE CON STRUTTURA NON NATIVA VENGONO DEGRADATE ATTRAVERSO LA VIA UBIQUITINA- PROTEASOMA IL CONTROLLO DI QUALITA GARANTISCE

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Sequenza di Kozak Inizio della TRADUZIONE Nucleotidi in blod 100% conservati, sequenza consensus (GCC) G(-6) CC A/G(-3) CC ATG G(+4)

Sequenza di Kozak Inizio della TRADUZIONE Nucleotidi in blod 100% conservati, sequenza consensus (GCC) G(-6) CC A/G(-3) CC ATG G(+4) Sequenza di Kozak Inizio della TRADUZIONE Nucleotidi in blod 100% conservati, sequenza consensus (GCC) G(-6) CC A/G(-3) CC ATG G(+4) Proteine maggior parte della massa cellulare esclusa l acqua ATP utilizzato

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Struttura e funzione delle proteine

Struttura e funzione delle proteine Proteine Struttura e funzione delle proteine Le cellule viventi contengono un corredo estremamente diversificato di molecole proteiche, ciascuna costituita da una catena lineare di aminoacidi uniti da

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

FUNZIONI delle PROTEINE

FUNZIONI delle PROTEINE FUNZIONI delle PROTEINE Ha le dimensioni del reciproco di una concentrazione (M -1 ) Ha le dimensioni di una concentrazione (M) La frazione dei siti occupati rispetto ai siti totali è definita come θ FRAZIONE

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

LA STRUTTURA DELLE PROTEINE È GERARCHICA

LA STRUTTURA DELLE PROTEINE È GERARCHICA LA STRUTTURA DELLE PROTEINE È GERARCHICA LA STRUTTURA DETERMINA LA FUNZIONE The Protein Folding Problem Cosa determina la struttura? Energia Cinetica Come si determina la struttura? Metodi Sperimentali

Dettagli

TAPPE PRINCIPALI DELLA SINTESI PROTEICA. FORMAZIONE DEI PRECURSORI ATTIVATI (Aminoacil-tRNA): accoppiamento tra codice nucleotidico ed aminoacidi

TAPPE PRINCIPALI DELLA SINTESI PROTEICA. FORMAZIONE DEI PRECURSORI ATTIVATI (Aminoacil-tRNA): accoppiamento tra codice nucleotidico ed aminoacidi TAPPE PRINCIPALI DELLA SINTESI PROTEICA FORMAZIONE DEI PRECURSORI ATTIVATI (Aminoacil-tRNA): accoppiamento tra codice nucleotidico ed aminoacidi SINTESI DEL POLIPEPTIDE SUI RIBOSOMI 3 fasi Inizio = Riconoscimento

Dettagli

Dall RNA alle proteine. La traduzione nei procarioti e negli eucarioti

Dall RNA alle proteine. La traduzione nei procarioti e negli eucarioti Dall RNA alle proteine La traduzione nei procarioti e negli eucarioti Codice genetico La sequenza dell mrna viene decodificata a gruppi di tre nucleotidi, e tradotta in una sequenza di amminoacidi 4 x

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

BIOCHIMICA APPLICATA e CLINICA

BIOCHIMICA APPLICATA e CLINICA BIOCHIMICA APPLICATA e CLINICA Regolazione Enzimatica Biosegnalazione Regolazione Ormonale Specializzazioni metaboliche (Biochimica d Organo) Integrazione del metabolismo BIOCHIMICA APPLICATA e CLINICA

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

EME (Fe-PROTOPORFIRINA IX)

EME (Fe-PROTOPORFIRINA IX) EME (Fe-PROTOPORFIRINA IX) 1,3,5,8-tetrametil 2,4-divinil 6,7-dipropionil-porfirina 1 Il ferro può formare sei legami di coordinazione 4 con gli azoti dell anello tetrapirrolico 2 perpendicolari al piano

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Università degli Studi di Napoli Federico II

Università degli Studi di Napoli Federico II Università degli Studi di Napoli Federico II Facoltà di Farmacia Corso di Laurea in Chimica e Tecnologie Farmaceutiche Tesi sperimentale in Chimica Fisica "Caratterizzazione strutturale mediante diffrazione

Dettagli

Proteine ed acidi nucleici

Proteine ed acidi nucleici Proteine ed acidi nucleici Prof.ssa Flavia Frabetti aa. 2010-11 PRTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,,,

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

FARMACODINAMICA. La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci.

FARMACODINAMICA. La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci. FARMACODINAMICA La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci. La farmacodinamica si propone di: * identificare i siti d azione dei farmaci * delineare le interazioni

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

Modulo 11 biosegnalazione

Modulo 11 biosegnalazione Modulo 11 biosegnalazione La trasduzione del segnale Capacità di ricevere e rispondere a segnali esterni alla membrana è un processo fondamentale per la vita. Organismi pluricellulari si scambiano informazioni:

Dettagli

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA Enzimi semplici Enzimi coniugati - utilizzano esclusivamente le reattività chimiche di alcuni residui AA - richiedono la reattività chimica aggiuntiva di COFATTORI o COENZIMI gruppi prostetici COENZIMI

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Alberts et al., L ESSENZIALE DI BIOLOGIA MOLECOLARE DELLA CELLULA, Zanichelli editore S.p.A. Copyright 2005

Alberts et al., L ESSENZIALE DI BIOLOGIA MOLECOLARE DELLA CELLULA, Zanichelli editore S.p.A. Copyright 2005 La conversione dell informazione da una forma ad un altra è il punto critico della trasmissione e prende il nome di: TRASDUZIONE DEL SEGNALE Nella comunicazione cellulare: Molecola segnale Proteina recettore

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina Per molti organismi, l O 2 è una molecola di importanza vitale: l'ossigeno è infatti l'accettore finale degli elettroni, che "fluendo" attraverso i complessi della catena respiratoria,

Dettagli

Modello per la struttura (presunta) di un RNA viroide: le lineette interne indicano i legami tra le basi complementari

Modello per la struttura (presunta) di un RNA viroide: le lineette interne indicano i legami tra le basi complementari Viroidi Agenti infettivi costituiti da una sola molecola di RNA circolare a singolo filamento (+ o -), ripiegato a formare regioni a doppia elica, prive di capside, sensibili a RNasi Aree a doppia elica

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Biochimica. studio della vita a livello molecolare

Biochimica. studio della vita a livello molecolare Biochimica studio della vita a livello molecolare studio della composizione molecolare dei sistemi viventi studio delle reazioni chimiche cui vanno incontro i sistemi viventi ALCUNI QUESITI DELLA BIOCHIMICA

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari (sono in grado di aumentare la velocità delle reazioni biologiche anche di 10 20 volte). Durante

Dettagli

3) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli

3) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari (sono in grado di aumentare la velocità delle reazioni biologiche anche di 10 20 volte). Durante

Dettagli

Le biomolecole si trovano negli organismi viventi

Le biomolecole si trovano negli organismi viventi Le biomolecole si trovano negli organismi viventi I viventi sono formati per la maggior parte da acqua e molecole, chiamate biomolecole. Le biomolecole sono sostanze contenenti carbonio. I composti del

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Informazioni sul corso a.a v.1. Insegnamento di Biochimica 090SM BIO/10 6 CFU 48 ore

Informazioni sul corso a.a v.1. Insegnamento di Biochimica 090SM BIO/10 6 CFU 48 ore Informazioni sul corso a.a 2017-18 v.1 Insegnamento di Biochimica 090SM BIO/10 6 CFU 48 ore Informazioni sul corso Marco Scocchi Dip. Di Scienze della Vita - Prof. Associato Tel. 040-5588704 mscocchi@units.it

Dettagli

Immunologia e Immunologia Diagnostica MATURAZIONE DEI LINFOCITI

Immunologia e Immunologia Diagnostica MATURAZIONE DEI LINFOCITI Immunologia e Immunologia Diagnostica MATURAZIONE DEI LINFOCITI Il percorso di maturazione dei linfociti Sviluppo della specicifità immunologica I linfociti B e T avviano le risposte immunitarie dopo il

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Emivita delle proteine

Emivita delle proteine Emivita delle proteine Ornitina decarbossilasi: 30 min, HMGCoA red: ~ 2-4 h Possiedono alto turn over inoltre: Enzimi nella biosintesi dei nucleotidi timinici (Ribonucleotide red, timidilato sintetasi)

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Folding e misfolding delle proteine

Folding e misfolding delle proteine Università degli Studi di Firenze Prof. Niccolò Taddei Folding e misfolding delle proteine 15 Aprile 2015, Liceo Scientifico James Joyce Ariccia (RM) LE PROTEINE Folding Il folding delle proteine è la

Dettagli

Modulo 11 biosegnalazione

Modulo 11 biosegnalazione Modulo 11 biosegnalazione La trasduzione del segnale Capacità di ricevere e rispondere a segnali esterni alla membrana è un processo fondamentale per la vita. Organismi pluricellulari si scambiano informazioni:

Dettagli

Regolazione enzimatica Isoenzimi

Regolazione enzimatica Isoenzimi Regolazione enzimatica Isoenzimi Gli enzimi regolatori nel metabolismo gruppi di enzimi lavorano insieme per produrre una via metabolica in cui il prodotto del primo enzima diventa il substrato del secondo

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE)

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE) REGOLAZIONE DELL ATTIVITA ENZIMATICA - Regolazione a lungo termine: la quantità di enzima può essere controllata regolando la velocità della sua sintesi o degradazione (minuti o ore) - Regolazione a breve

Dettagli

MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto. campo di ricerca chimico-fisica

MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto. campo di ricerca chimico-fisica MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto Un moderno e vasto campo di Ricerca Chimico-Fisica campo di ricerca chimico-fisica D. Gazzillo, A. Giacometti, e R. Fantoni Workshop

Dettagli

CLASSIFICAZIONE O.T.I.L.Is. Lig

CLASSIFICAZIONE O.T.I.L.Is. Lig GLI ENZIMI CHE COSA SONO? Sono delle proteine altamente specializzate con attività catalitica, accelerano le reazioni chimiche rimanendo inalterati al termine della reazione stessa. CLASSIFICAZIONE O.T.I.L.Is.

Dettagli

Strategie catalitiche

Strategie catalitiche Strategie catalitiche catalisi acido-base catalisi covalente catalisi da metalli Dati molecolari di alcune proteine Citocromo C (umano) Ribonucleasi A (pancreas di bue) Lisozima (bianco dell uovo) Mioglobina

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli