Domini nelle Proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Domini nelle Proteine"

Transcript

1 Struttura secondaria, Motivi e Domini nelle Proteine

2 Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali.

3 Proprietà generali Tutti gli aminoacidi (ad eccezione della glicina) derivati da proteine sono otticamente attivi, cioè ruotano il piano di polarizzazione della luce. Le molecole otticamente attive sono asimmetriche in modo da non essere sovrapponibili con le loro immagini speculari (enantiomeri). Ciò è caratteristico di molecole contenenti atomi di carbonio tetraedrici con 4 diversi sostituenti. L atomo centrale si dice centro chirale.

4 Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H

5 Il legame peptidico pp Il legame peptidico C N è 0.13 Å più corto del legame singolo N C α e0.08å più lungo di un doppio legame C=N. Il legame peptidico, quindi, presenta per il 60 % una natura di legame singolo e per il 40 % una natura di legame doppio.

6 Il legame peptidico Generalmente il gruppo peptidico assume la conformazione trans trans -atomi (C α ) n e(c α ) n+1 opposti legame peptidico C N. rispetto al In alcuni casi il gruppo peptidico può assume la conformazione cis (~8 kj mol -1 meno stabile della conformazione trans. Problemi sterici, perché distanza C α -C α =2.8Å). cis

7 Il legame peptidico O Il gruppo peptidico ha un momento di dipolo. Gli atomi O e N sono rispettivamente più elettronegativi di C ed H. La conseguente delocalizzazione di carica porta alla N formazione di due dipoli (CO ed NH) con analoga direzione e verso nel gruppo H peptidico. Il momento di dipolo risultante è di circa 3.5 Debye. C

8 Gli aminoacidi Gli aminoacidi sono generalmente classificati a seconda della polarità delle loro catene laterali. li Infatti, il ripiegamento della catena polipeptidica nella sua conformazione nativa è dovuto principalmente alla tendenza che hanno le catene laterali idrofobiche a sfuggire il contatto con il solvente e le catene laterali idrofiliche ad essere esposte all acqua. Si possono quindi distinguere 3 gruppi principali di aminoacidi: - gruppo Rnonpolare - gruppo R polare non carico - gruppo R polare carico

9 Gruppo R non polare Gruppo R polare non carico Glicina Gly G Serina Ser S Alanina Ala A TreoninaThr T Valina Val V Asparagina Asn N Leucina Leu L Glutammina Gln Q Isoleucina Ile I Tirosina Tyr Y Metionina Met M Cisteina Cys C Prolina Pro P Fenilalanina Phe F Triptofano Trp W Gruppo R polare carico Lisina Lys K Arginina i Arg R Istidina His H Acido Aspartico Asp D Acido Glutammico Glu E

10 Proprietà acido-base pk a degli aminoacidi I valori di pk a del gruppo carbossilico ed aminico ii degli altri aminoacidi sono simili a quelli della glicina. Alcuni aminoacidi contengono anche catene laterali ionizzabili: Asp, Glu, His, Cys, Tyr, Lys e Arg. Il pk delle catene laterali ionizzabili Il pk a delle catene laterali ionizzabili degli aminoacidi è compreso tra i valori 3.9 (Asp) e 12.5 (Arg).

11 Angoli diedri φ e ψ Proprietà fondamentale del legame peptidico è di essere rigido e planare. Isoligradidilibertàdell unità peptidica rigida sono: - rotazione intorno al legame N C α (angolo φ) - rotazione intorno al legame C α C (angolo ψ) A ciascun aminoacido viene associata una coppia di angoli diedri (φ, ψ), che determina in modo univoco la conformazione della catena principale. i

12 Angoli diedri φ e ψ Molte combinazioni di angoli (φ, ψ) per gli aminoacidi non sono permesse, a causa delle collisioni steriche fra atomi della catena principale e/o delle catene laterali. I valori di (φ, ψ) stericamente permessi si possono determinare calcolando le distanze fra gli atomi di un tripeptide in corrispondenza di tutti i valori (φ, ψ) per l unità peptidica centrale. Le conformazioni stericamente proibite sono quelle per cui la distanza interatomica di un interazione non covalente è inferiore alla corrispondente somma di raggi di van der Waals.

13 Plot di Ramachandran Le coppie (φ, ψ) permesse per gli aminoacidi sono riportate in un diagramma chiamato plot di Ramachandran, dal nome del fisico indiano G.N. Ramachandran che per primo (fine anni 60) calcolò le regioni stericamente permesse. Ramachandran e colleghi usarono il modello che schematizza gli atomi come sfere rigide e fissa le geometrie dei legami. Mi iù i d l l t di R h d i lt d l l l d ll Misure più precise del plot di Ramachandran risultano dal calcolo delle energie relative a ciascuna conformazione, permettendo una certa flessibilità per i contatti di van der Waals e per gli angoli di legame, e calcolando i contributi di tutte le interazioni favorevoli e non.

14 Plot di Ramachandran Plot di Ramachandran relativo ad un tripeptide costituito da Ala. Qualunque scelta accettabile si faccia del raggio di van der Waals, si ottengono comunque solo 3 regioni del plot di Ramachandran fisicamente accessibili alla catena polipeptidica. Le zone in azzurro sono quelle largamente permesse, mentre le zone in verde indicano le conformazioni, comunque possibili, che hanno distanze di van der Waals al limite inferiore dell accettabilità.

15 Plot di Ramachandran

16 Plot di Ramachandran Le regioni del plot di Ramachandran sono indicate con il nome della conformazione risultante in un peptide p se i corrispondenti angoli (φ, ψ) sono ripetuti negli aminoacidi successivi lungo la catena polipeptidica. α-eliche destrorse filamenti β antiparalleli e paralleli α-eliche sinistrorse

17 Plot di Ramachandran Valori di (φ, ψ) relativi a ciascuna struttura secondaria

18 La struttura secondaria Le strutture secondarie sono disposizioni regolari della catena polipeptidica principale, che vengono classificate senza fare riferimento al tipo di aminoacidi. Esse sono stabilizzate da legami idrogeno fra il gruppo aminico e il gruppo carbonilico della catena principale. La regolarità della conformazione risulta dalla regolarità della struttura atomica della catena polipeptidica, ed è evidenziata dai valori degli angoli diedri (φ, ψ) di ciascun aminoacido, che si ripetono quasi costantemente all interno di ogni elemento di struttura secondaria.

19 La struttura secondaria Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse turn Circa il % degli aminoacidi delle proteine globulari assume la conformazione regolare tipica di uno dei tre tipi di struttura secondaria. I segmenti di catena polipeptidica che non sono in α elica, foglietto β o turn, assumono o la conformazione o o chiamata ata loop o random coil,, struttura non ripetitiva né regolare, spesso priva di legami idrogeno tra gli aminoacidi che la compongono.

20 α elica L α elica èla struttura secondaria più frequentemente adottata dalla catena polipeptidica delle proteine: circa il % degli aminoacidi delle proteine globulari di struttura tridimensionale nota assume la conformazione ad α elica. Fu descritta per la prima volta nel 1951 da Linus Pauling e Robert Corey (California Institute of Technology), che ipotizzarono una struttura stabile ed energeticamente favorita nelle proteine, sulla base di parametri geometrici accurati per lunitàpeptidica l unità dedotti dall analisi analisi cristallografica di strutture di piccole molecole. La previsione di Pauling e Corey ricevette molto presto il supporto sperimentale dalla determinazione della struttura tridimensionale della mioglobina (John Kendrew, 1960) e dell emoglobina (Max Perutz, 1961), due proteine i cui elementi di struttura secondaria sono α eliche.

21 α elica Un α elica destrorsa è caratterizzata da: (φ, ψ) =(-57, -47 ), corrispondenti al quadrante in basso a sinistra del plot di Ramachandran; n =3.6 residui per giro p =5.4 Å d =1.5 Å Esistono anche α eliche di tipo sinistrorso (quadrante in alto a destra del plot di Ramachandran), molto rare e limitate a pochi aminoacidi. Esse sono caratterizzate da valori (φ, ψ) = (+57, +47 ) e da stessi valori per n e p (n negativo).

22 (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004)

23 α elica Le catene laterali degli aminoacidi che appartengono ad un α elica destrorsa sono rivolte verso l esterno e verso l estremità N-terminale dell elica. In questo modo si evitano interferenze steriche con la catena polipeptidica principale e tra le catene laterali stesse. Un α elica sinistrorsa i si trova molto raramente nelle proteine (solo brevi tratti di 3-5 aminoacidi) perché le catene laterali interferirebbero stericamente con la catena principale.

24 α elica All α elica è associato un macrodipolo. Ad ogni unità peptidica è associato un dipolo; nell α elica questi dipoli sono tutti allineati lungo l asse dell elica elica. I dipoli associati a ciascuna unità peptidica si sommano e un α α elica costituita da n aminoacidi avrà un momento di dipolo complessivo pari a n 3.5 Debye.

25 (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004)

26 Altri tipi di elica Variazioni dell α elica, in cui la catena polipeptidica è avvolta più o meno strettamente, con legami idrogeno fra coppie di aminoacidi (n n+3) o (n n+5), sono chiamate elica 3 10 ed elica π. Entrambe queste conformazioni si trovano ai limiti della regione permessa per le strutture elicoidali destrorse nel plot di Ramachandran: Elica 3 10 :(φ, ψ) = (-49, -26 ) Elica π: (φ, ψ) = (-57, -70 ) Elica 3 10 ed elica π ricorrono poco frequentemente nelle proteine. In Elica 3 10 ed elica π ricorrono poco frequentemente nelle proteine. In particolare, le eliche 3 10 possono essere presenti alle estremità delle α eliche, come segmenti molto corti (3-4 aminoacidi).

27 Altri tipi di elica

28 Elica 3 10 L elica 3 10 deve il suo nome al numero di aminoacidi per giro (3) e al numero di atomi (10) compresi fra un donatore ed un accettore di legame idrogeno. Secondo questa nomenclatura, l α elica sarebbe un elica Le eliche 3 10 sono meno favorite delle α eliche: - gli atomi della catena principale sono troppo strettamente impaccati, portando ad interazioni di van der Waals repulsive; - i legami idrogeno non sono lineari; - i dipoli delle unità peptidiche deviano di circa 30 rispetto all asse dell elica; - la posizione delle catene laterali (allineate) porta ad interferenze steriche.

29 Page 233 Coiled-coil di 2 α-eliche

30 Page 232 Struttura schematica dell α-cheratina

31 Coiled-coil α elica: actina emiosina Kinemage Leu_Zipper La molecola di miosina è un dimero costituito da due catene pesanti (MW 230 kda) e quattro catene leggere (MW 20 kda) e forma una coda lunga 1400 Å e due teste. Frammenti di miosina, costituiti da due catene leggere e la parte N-terminale di una delle catene pesanti, si possono separare e costituiscono il sottoframmento S1.

32 Foglietto β Nll Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica, la conformazione più ricorrente adottata dalla catena polipeptidica delle proteine è il foglietto β: circa il % degli aminoacidi nelle proteine globulari conosciute ricorre in questa conformazione. Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella zona permessa del plot di Ramachandran (quadrante in alto a sinistra).

33 Filamento β L unità costituente i foglietti β èilfilamento β (βstrand), lungo in media da 5 a 10 aminoacidi, con la catena polipeptidica quasi completamente estesa. I foglietti β nelle proteine globulari sono costituiti da 2 a 15 filamenti β abbinati lateralmente, con un valor medio di 6. Il filamento β si può considerare un tipo speciale di elica, con n = 2 residui per giro e una traslazione d =3.4Åper aminoacido. I filamenti β sono allineati uno vicino all altro, in modo tale che si possano formare legami idrogeno tra i gruppi CO di un filamento eigruppi NH del filamento β adiacente e viceversa.

34 Foglietto β I foglietti β formati da un certo numero di filamenti β sono pieghettati (pleated), con gli atomi C α degli aminoacidi adiacenti alternativamente leggermente sopra e sotto il piano del foglietto β, dando al foglietto β l apparenza di un foglietto pieghettato. Le catene laterali degli aminoacidi che compongono il foglietto β seguono lo stesso andamento, per cui puntano alternativamente sopra e sotto il foglietto β. Spesso un foglietto β può presentare tutte le catene laterali polari su una faccia e tutte le catene laterali non polari sull altra (ideale per costruire la superficie delle proteine).

35 Foglietto β (v (v. Animated_Lesson 8_1c) I filamenti β possono interagire fra loro a formare i foglietti β in due modi diversi: -gli aminoacidi nei filamenti β adiacenti hanno direzioni alternate (N-term C-term seguito da C-term N-term seguito da N-term C-term, ) esi parla di foglietto β antiparallelo; -gli aminoacidi nei filamenti β allineati vanno tutti nella stessa direzione (sempre N-term C-term) esi parla di foglietto β parallelo.

36 Foglietto β antiparallelo Angoli diedri (φ, ψ) =(-139, 135 ). Coppie di legami idrogeno poco spaziate si alternano a coppie largamente spaziate. Tali legami idrogeno sono paralleli fra loro e perpendicolari alla direzione dei filamenti β. Idipoli associati alle unità peptidiche costituenti un filamento β si annullano.

37 Foglietto β parallelo Angoli diedri (φ, ψ) =(-119, 113 ). Coppie di legami idrogeno uniformemente spaziati, non sono paralleli fra loro né perpendicolari alla direzione dei filamenti β. I dipoli associati alle unità peptidiche costituenti un filamento β si annullano. I foglietti β paralleli sono meno frequenti di quelli antiparalleli.

38 Foglietto β misto I filamenti β si possono anche combinare aformare un foglietto β misto, con alcune coppie di filamenti antiparalleli ed altre paralleli. I foglietti β misti sono meno frequenti di dei foglietti β antiparalleli e paralleli.

39 Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni sono dovute alla presenza di un comune elemento strutturale, chiamato reverse turn. Gli aminoacidi coinvolti nella formazione dei reverse turn si trovano generalmente sulla superficie delle proteine e hanno natura polare e/o carica. Esistono vari tipi di reverse turn, a seconda del numero di aminoacidi che li costituiscono e degli elementi di struttura secondaria che collegano: β β-turn γ-turn Ω-loop

40 β-turn Tipo I Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-90, 0 ) 3 4 I β-turn di tipo I si possono considerare un breve tratto distorto di elica Nei β-turn di tipo I l aminoacido laminoacidoin posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta. Essi sono circa 2-3 volte più frequenti di quelli di tipo II. 2 1

41 Kinemages: Bchl_prot / Porin β-turn Tipo II Angoli diedri (φ, ψ) 2 = (-60, 120 ) Angoli diedri (φ, ψ) 3 = (90, 0 ) I β-turnditipoiidifferisconoda quelli di tipo I per un flip di 180 dell unità peptidica che collega gli 2 aminoacidi in posizione 2 e 3. 1 Nei β-turnditipoiil aminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere laconformazione voluta, mentre l aminoacido in posizione 3 spesso è una Gly, per evitare che l atomo di carbonio della catena laterale sia troppo vicino all atomo di ossigeno dell aminoacido in posizione

42 Fibroina della seta L analisi della sequenza delle fibrine della seta ha mostrato la presenza di un motivo comune: domini variabili alle estremità N- e C-terminali terminali, affiancati da ampie regioni (fino a 800 aminoacidi) caratterizzate dalla ripetizione del motivo (-Gly-Ser-Gly-Ala-Gly-Ala) n. Questi tratti ripetitivi di catena polipeptidica formano foglietti β,in cui gli aminoacidi Gly si trovano su un lato del foglietto β e Ala/Ser sull altro lato.

43 La struttura tt supersecondaria

44 La struttura supersecondaria Elementi di struttura secondaria si combinano a costituire aggregati locali con geometria specifica, che definiscono la struttura supersecondaria (o motivi). Alcuni di questi motivi si possono associare ad una particolare funzione, come ad esempio il legame del DNA, mentre altri non hanno una funzione biologica specifica, ma sono semplicemente parte di organizzazioni strutturali più ampie e complesse. I principali i motivi i individuati id nelle proteine ti sono: - motivi α - motivi β - motivi α/β

45 Motivi α Nonostante siano le strutture secondarie più frequenti nelle proteine, le α eliche isolate non sono stabili in soluzione. Nelle strutture terziarie delle proteine le α eliche si impaccano in modo adiacente una all altra attraverso interazioni tra le catene laterali idrofobiche. I principali i motivi i α sono: - α-loop-α α - EF hand

46 Motivi α: α-loop-α Il motivo α più semplice consiste di 2 α eliche antiparallele collegate da una regione di loop, chiamato α hairpin. La più breve connessione fra 2 α eliche coinvolge 2aminoacidi, di cui il secondo è sempre Gly, orientati perpendicolarmente agli assi delle eliche. Le eliche risultano cosi antparallele, e sono stabilizzate dall interazione dei loro macrodipoli. N C

47 Motivi α: α-loop loop-α α Un particolare motivo α-loop-α è caratteristico di alcune proteine che riconoscono e legano specifiche zone di DNA. (noto anche come motivo HTH) In particolare, una di queste 2 eliche si va ad inserire nel solco maggiore del DNA, e riconosce le basi nucleotidiche, mentre l altra interagisce con i gruppi fosfatof dll delloscheletro hlt desossiribosio-fosfato. Kinemage... Exercises/E19

48 Motivi α: EF hand Il secondo motivo α è specifico per il legame del calcio ed è presente in proteine che legano il calcio quali parvalbumina, calmodulina e troponina C, che regolano l attività cellulare. Questo particolare motivo, trovato per la prima volta nella parvalbumina, viene chiamato EF hand. Il loop fra le 2 eliche lega lo ione Ca 2+

49 Motivi β: β-hairpin Il motivo β più semplice è quello costituito da 2 filamenti β antiparalleli adiacenti collegati da un tratto di loop. Questo motivo, chiamato β-hairpin o unità β β, ricorre molto frequentemente nelle strutture β antiparallele, come motivo isolato o come parte di un foglietto β più complesso. La lunghezza dl del tratto di loop tra i filamenti β èvariabile, ma di solito è costituito da 2-5 aminoacidi (v. reverse-turns, come elementi di struttura secondaria). A questo motivo β non è associata nessuna funzione specifica.

50 Motivi α/β: Cross over connection Alla base dei motivi α/β sta il modo in cui 2 filamenti β paralleli vengono collegati. Due filamenti β paralleli adiacenti di solito sono connessi da un α elica, che collega l estremità C-terminale del primo filamento β con l estremità N- terminale del secondo filamento β, in modo tale che l asse dell elica li sia parallelo ai filamenti β. Questo motivo β-α-β viene chiamato cross-over connection.

51 Motivi α/β: Cross over connection La cross over connection consiste di di due filamenti β paralleli, un α elica e due loop (che possono variare notevolmente in lunghezza). L α elica si impacca con i 2 filamenti β, riparando dal solvente gli aminoacidi idrofobici dei filamenti β. La cross over connection può essere considerata come un largo giro di superelica, a partire dal primo filamento β, attraverso la connessione, fino al secondo filamento β. La cross over connection può essere di tipo destrorso () (a) osinistrorso i (b). Quasi tutte le proteine presentano una cross over connection destrorsa.

52 I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come parte di una catena polipeptidica p p (o al limite l intera catena caso particolare) che si ripiega indipendentemente in una struttura stabile. I domini possono essere unità funzionali; spesso a domini diversi di una proteina sono associate funzioni diverse.

53 I domini Le proteine possono essere costituite da un singolo dominio o da molti (anche diverse dozzine).

54 I domini Michael Levitt and Cyrus Chothia, sulla base di semplici considerazioni sulla connessione dei motivi, hanno classificato i domini in 3 gruppi principali, a seconda delle strutture secondarie e dei motivi coinvolti nella loro formazione: - domini α:α helical bundle, globin-fold. - domini β:up-and-down, chiave greca, jelly roll, β-helix - domini α/β : α/β barrel barrel, α/β open sheet, fold a ferro di cavallo - domini piccoli, contenenti metalli o ponti S-S

55 Domini α: α helical bundle L α helical bundle è costituito da 4 α eliche disposte in modo tale che i loro assi siano reciprocamente quasi paralleli. Le catene laterali idrofobiche degli aminoacidi di ciascuna α elica sono orientate verso l interno dell α helical bundle, mentre le catene laterali idrofiliche degli aminoacidi sono rivolte verso l esterno. Le catene laterali idrofobiche ri olte erso Le catene laterali idrofobiche rivolte verso l interno dell α helical bundle sono così strettamente impaccate che non c è spazio per molecole d acqua.

56 Domini α: α helical bundle L α helical bundle è un tipo di dominio che ricorre in svariate proteine (mioemeritrina, citocromo c' e b 562, ferritina, proteina del capside del virus del mosaico del tabacco). In questi casi le α eliche sequenzialmente vicine sono sempre antiparallele.

57 Domini α: α helical bundle L α helical bundle si può anche formare con arrangiamenti topologici delle α eliche diversi, come nel caso dell ormone umano della crescita. In questo caso, l α helical bundle è formato da 2 coppie di eliche parallele che sono disposte in modo antiparallelo nell α helical bundle. L impaccamento antiparallelo delle α eliche conferisce loro maggiore stabilità in quanto i macrodipoli associati a ciascuna α elica si annullano a vicenda.

58 Domini α: α helical bundle Le α eliche che costituiscono l α helical bundle si impaccano con la modalità cresta-solco. solco Le creste e i solchi sono costituiti dalle catene laterali di aminoacidi separati da 3-4 residui (fig. c e b rispettivamente). La geometria dei solchi e delle creste di un α elica dipende dalla geometria dell elica ma anche dalla sua sequenza aminoacidica.

59 Domini α: Globin fold Un altro impaccamento tipico delle α eliche è quello osservato nel globin fold, caratteristico di emoglobine, mioglobine e ficocianine. Il globin fold è costituito da 8 α eliche, indicate con le lettere A-H, collegate da loop piuttosto corti, in modo da disporsi a formare la tasca del sito attivo, che in mioglobina e emoglobina, ospita il gruppo eme. La lunghezza delle α eliche varia considerevolmente: da 7 aminoacidi per l elica C a 28 aminoacidi per l elica lelicah. Le α eliche sono disposte in direzioni diverse, in modo tale che α eliche adiacenti in sequenza non lo sono nella struttura, con l eccezione delle eliche G e H.

60 Domini i β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati sono solo 3: - up and down - chiave greca - jelly roll In generale, i filamenti β sono disposti in modo tale da formare 2 foglietti β impaccati uno con l altro, a formare un core idrofobico. Un discorso a parte meritano i domini a β elica, una struttura β recentemente scoperta.

61 Domini β: Up and down La topologia più semplice per foglietti β antiparalleli li è chiamata up and down: in essa i filamenti β adiacenti sono collegati da regioni di loop (β-hairpin). Spesso l ultimo filamento β è collegato al primo da legami idrogeno, a formare un barile (β barrel) di 8 filamentii β, comenel caso delle proteine che legano il retinolo o acidi grassi. I ti i ll d i fil ti β In questi casi, nelle sequenze dei filamenti β catene laterali idrofobiche si alternano a catene laterali polari e cariche idrofiliche, in modo tale da formare il core idrofobico all interno del barile e da interagire esternamente con il solvente.

62 Kinemage Exercises/Ig-fold Domini β: Chiave greca Se si vogliono collegare 8 filamenti β antiparalleli con una topologia diversa da quella up and down, ci sono solo 2 alternative: collegare il filamento β n a quello n+3 oppure a quello n- 3. I due casi rappresentano le 2 possibili mani, cioè 2 opposte sceltechirali:intuttelestrutturedi proteine finora note si è trovata sempre e solo la topologia a chiave greca indicata in fig. a, quella destrorsa.

63 Domini β: Chiave greca Il motivo base è costituito da 4 filamenti β: 3 presentano topologia up and down e sono collegati da β-turns, seguiti da una connessione più lunga al quarto filamento β, che è adiacente al primo. Esempi di topologia a chiave greca si osservano nelle superossido dismutasi a Cu,Zn, nei domini delle immunoglobuline e nella proteina γ cristallino.

64 Domini β: Jelly roll Un altra topologia caratteristica dei filamenti β antiparalleli è chiamata jelly roll. Consideriamo una stringa costituita da 8 filamenti β antiparalleli, collegati a 2 a 2 da legami idrogeno (coppie 1-8, 2-7, 3-6 e 4-5). Se si avvolge questa stringa intorno ad un cilindro, in modo tale che i filamenti β si trovino sulla superficie del barile mentre le regioni di loop alle 2 estremità, si ottiene la topologia jelly roll.

65 Domini β: β elica Nel 1993 fu scoperta una nuova, inaspettata, struttura di tipo β, la β elica. La β elica, che non è correlabile alle altre strutture β, fu osservata per la prima volta nella struttura dell enzima batterico pectato liasi. Successivamente, sono state determinate altre strutture proteiche contenenti β eliche (tra cui proteinasi batteriche extracellulari e la proteina tailspike del batteriofago P22). Nella β elica la catena polipeptidica si avvolge a formare un ampia elica, costituita da brevi filamenti β uniti fra loro da regioni di loop. Esistono 2tipidiβ elica: - β elica a 2 foglietti β - β elica a 3 foglietti β

66 Domini β: β elica a2 foglietti β La β elica a 2 foglietti β è la forma di β elica più semplice, osservata nelle proteinasi extracellulari batteriche. Ciascun giro di elica comprende 2 filamenti β e 2 regioni di loop. Questa unità strutturale si ripete piu volte a formare una struttura elicoidale destrorsa costituita da 2 foglietti β paralleli costituiti ciascuno da 3 filamenti β, con un core idrofobico in mezzo. L unità strutturale base della β elica a 2 foglietti β è costituita da 18 aminoacidi, 3 in ciascun filamento β e 6inciascunloop.Questaunità base è caratterizzata dalla sequenza consenso: (Gly-Gly-X-Gly-X-Asp-X-U-X) X X X) 2 [X: qualsiasi aminoacido; U: idrofobico, spesso Leu]

67 Domini β: β elica a3 foglietti β Una β elica più complessa è presente nella pectato liasi e nella proteina tailspike del batteriofago P22. Nelle β eliche a 3 foglietti β ciascun giro di elica è formata da 3 segmenti β (ciascuno costituito da 3 a 5 aminoacidi) collegati da 3 loop. La β elica quindi è costituita i da 3 foglietti β paralleli, che formano i lati di un prisma. La sezione della β elica, però, non è triangolare, a causa della disposizione dei foglietti β.

68 Domini β: β elica a 3 foglietti β Due dei foglietti β sono posizionati uno adiacente all altro, come nella β elica a 2 foglietti β, e il terzo foglietto β è quasi perpendicolare agli altri 2. Un loop (a) è corto e quasi sempre formato solo da 2 aminoacidi con conformazione invariante e forma un angolo di circa 120 fra i 2 filamenti β che unisce. Gli altri 2 loop (b,, c) ) sono più lunghi e variano in dimensione e conformazione. I loop lunghi protrudono dai foglietti β e probabilmente formano il sito attivo sulla superficie esterna della proteina. Kinemage Exercises/PecLyC La variabilità in numero e tipo di aminoacidi che costituiscono i 2 loop lunghi impedisce di determinare una sequenza consenso per la β elica a 3 foglietti β.

69 Domini β: β elica a3 foglietti β Il numero di giri di elica nelle β eliche a 3 foglietti β è maggiore di quello trovato nelle β eliche a 2 foglietti β. La pectato liasi consiste di 7 giri di β elica (d = 4.86 Å), è lunga 34 Å e ha un diametro di Å, mentre la β elica della proteina tailspike del batteriofago P22 è formata da 13 giri.

70 Domini β: β elica sinistrorsa Nel 1995 è stata osservata una β elica sinistrorsa, nella struttura dell enzima enzima UDP-N acetilglucosammina transferasi (LpxA). La β elica sinistrorsa è l unica struttura di tipo β parallelo che puo essere interpretata come una cross-over connection fra i filamenti β paralleli di tipo sinistroso (vedi strutture supersecondarie). Gli enzimi che presentano la β elica sinistrorsa sono caratterizzati dalla ripetizione dell esapeptide: [LIV]-[GAED]-X-X-[STAV]-X

71 Id domini i α/β

72 Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro di cavallo) - α/β open sheet

73 Domini α/β Due cross over connections possono essere collegate in 2 modi diversi (tramite un α elica), per formare un foglietto β parallelo di 4 filamenti β. 1) Le α eliche stanno tutte da un lato del foglietto β parallelo. L ultimo filamento β della prima cross over connection è adiacente al primo filamento β della seconda cross over connection. I filamenti β sono nell ordine Impaccamento tipico degli α/β barrel e del fold a ferro di cavallo.

74 Domini α/β 2) Le α eliche stanno sui lati opposti del foglietto β parallelo. I primi filamenti β di ciascuna cross over connection sono adiacenti. I filamenti β sono nell ordine Impaccamento tipico degli α/β open sheet.

75 Domini α/β: α/β barrel Un α/β barrel è costituito da 8 filamenti β paralleli, posizionati in modo tale che il filamento β 8 sia adiacente e faccia legami idrogeno con quello 1. Di solito le cross over connection fra i filamenti β paralleli sono α eliche. In più c è un α elica dopo l ultimo filamento β. Esistono anche α/β barrel costituiti da 10 filamenti β paralleli. L α/β barrel è un tipo di dominio che coinvolge almeno 200 aminoacidi ed è tipico di molti enzimi. E chiamato anche TIM barrel dalla struttura dell enzima trioso fosfato isomerasi, dove fu osservato per la prima volta.

76 Kinemage Exercises/ab_barrel Domini α/β: α/β barrel Nell α/β barrel le catene laterali idrofobiche delle α eliche si impaccano con le catene laterali idrofobiche dei filamenti β. Le interazioni fra le α eliche e i filamenti β coinvolgono principalmente aminoacidi del tipo Val, Ile, Leu, che costituiscono circa il 40% degli aminoacidi che costituiscono i filamenti β del barile. Le altre catene laterali degli aminoacidi (in posizione 1, 3, 5, ) dei filamenti β sono rivolte verso l interno del barile e formano un core idrofobico strettamente impaccato. Tra le catene laterali ci sono anche Arg, Lys e Gln, che presentano un gruppo polare, rivolto verso le 2 estremità del barile, in modo da poter interagire con il solvente esterno.

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica

Dettagli

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA Email: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 7 La struttura delle proteine Concetti chiave: La struttura terziaria di una proteina descrive il ripiegamentodei suoi elementi

Dettagli

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra). Strutture secondarie (b) Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 2

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 2 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 2 Versatilità del carbonio nel formare legami covalenti La chimica degli organismi viventi è organizzata intorno al

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

Rappresentazione dei Dati Biologici

Rappresentazione dei Dati Biologici Rappresentazione dei Dati Biologici CORSO DI BIOINFORMATICA C.d.L. Ingegneria Informatica e Biomedica Outline Proteine ed Amminoacidi Rappresentazione di Amminoacidi Rappresentazione delle strutture Proteiche

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

BIOMOLECOLE STRUTTURA E FUNZIONE

BIOMOLECOLE STRUTTURA E FUNZIONE BIOMOLECOLE STRUTTURA E FUNZIONE Lo studio delle relazioni tra struttura e funzione nelle biomolecole è uno degli aspetti più importanti per la comprensione del funzionamento dei processi biologici La

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria Macromolecole Biologiche Chimica Biologica A.A. 2010-2011 Struttura Terziaria Domini e struttura terziaria Struttura terziaria L arrangiamento spaziale degli amminoacidi di una singola catena polipeptidica

Dettagli

STEREOISOMERIA carbonio ibridizzato sp3 è legato a quattro atomi o gruppi tutti diversi fra loro

STEREOISOMERIA carbonio ibridizzato sp3 è legato a quattro atomi o gruppi tutti diversi fra loro STEREOISOMERIA i sono oggetti che sono sovrapponibili alla loro immagine speculare: tutti gli oggetti di forma piana, ad esempio. osì, se prendo un alchene e lo confronto con la sua immagine allo specchio:

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

strutture di Proteine

strutture di Proteine Laboratorio di Bioinformatica I Database di strutture di Proteine Dott. Sergio Marin Vargas (2014 / 2015) Dal gene alla proteina La funzione della proteina è nella sua struttura 3D. Struttura delle proteine

Dettagli

AMMINO ACIDI. L equilibrio è regolato dal ph

AMMINO ACIDI. L equilibrio è regolato dal ph AMMINO ACIDI AMMINO ACIDI Amminoacido: un composto difunzionale che contiene nell ambito della stessa molecola una funzione amminica -NH 2 e una funzione carbossilica -COOH α-ammino acido: I due gruppi

Dettagli

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA Svolgono la loro funzione legando reversibilmente l OSSIGENO. Aumentano la solubilità dell ossigeno nel plasma, da 3ml/L a 220 ml/l. La mioglobina

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine Nelle proteine vi sono quattro livelli di organizzazione strutturale Struttura Primaria: sequenza di aminoacidi legati tra loro da legami peptidici Tutte le proteine esistenti

Dettagli

La funzione delle proteine dipende dalla loro struttura tridimensionale

La funzione delle proteine dipende dalla loro struttura tridimensionale La funzione delle proteine dipende dalla loro struttura tridimensionale La struttura dipende dal ripiegamento di particolari sequenze aminoacidiche La sequenza aminoacidica della catena polipeptidica è

Dettagli

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi Proteine Biopolimeri degli α-amino acidi. Amino acidi sono uniti attraverso il legame peptidico. Alcune funzioni: Struttura (collagene, cheratina ecc.) Enzimi (maltasi, deidrogenasi ecc) Trasporto (albumine,

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi.

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi. Sommario La molecola di DNA è deputata a conservare le informazioni genetiche necessarie per lo sviluppo ed il funzionamento degli organismi viventi. Poiché contiene le istruzioni per la costruzione delle

Dettagli

I database relazionali sono il tipo di database attualmente piu diffuso. I motivi di questo successo sono fondamentalmente due:

I database relazionali sono il tipo di database attualmente piu diffuso. I motivi di questo successo sono fondamentalmente due: Il modello relazionale I database relazionali sono il tipo di database attualmente piu diffuso. I motivi di questo successo sono fondamentalmente due: 1. forniscono sistemi semplici ed efficienti per rappresentare

Dettagli

Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Seminario. Domini modulari delle proteine 1

Seminario. Domini modulari delle proteine 1 Seminario Proteine della matrice DOMINI E MODULI Domini modulari delle proteine 1 La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Esempi di funzione. Scheda Tre

Esempi di funzione. Scheda Tre Scheda Tre Funzioni Consideriamo una legge f che associa ad un elemento di un insieme X al più un elemento di un insieme Y; diciamo che f è una funzione, X è l insieme di partenza e X l insieme di arrivo.

Dettagli

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali):

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali): AMINOAIDI. Proteine (gr. pròtos = primo) > 50% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida (o alcalina) α-aminoacidi Struttura generale degli α-aminoacidi primari (standard,

Dettagli

Trasformazioni Geometriche 1 Roberto Petroni, 2011

Trasformazioni Geometriche 1 Roberto Petroni, 2011 1 Trasformazioni Geometriche 1 Roberto etroni, 2011 Trasformazioni Geometriche sul piano euclideo 1) Introduzione Def: si dice trasformazione geometrica una corrispondenza biunivoca che associa ad ogni

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Biosintesi non ribosomiale di metaboliti peptidici bioattivi

Biosintesi non ribosomiale di metaboliti peptidici bioattivi Biosintesi non ribosomiale di metaboliti peptidici bioattivi Principali bersagli degli antibiotici Gli antibiotici derivano per la maggior parte da composti naturali Strutture di alcuni peptidi bioattivi

Dettagli

isomeria di struttura isomeria di posizione isomeria di catena stereoisomeria isomeria di conformazione isomeria di configurazione 'isomeria ottica

isomeria di struttura isomeria di posizione isomeria di catena stereoisomeria isomeria di conformazione isomeria di configurazione 'isomeria ottica ISOMERIA L'isomeria di struttura è connessa al diverso modo in cui gli atomi di due o più composti si legano tra loro in sequenza. Ci sono due forme: isomeria di posizione e isomeria di catena. La stereoisomeria

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario Il DN e la duplicazione cellulare Il DN, materiale ereditario Struttura del DN Replicazione del DN Dal DN alla proteina Il odice genetico iclo cellulare Mitosi Meiosi Da Figura 8-11 ampbell & Reece cidi

Dettagli

Le Ig sono glicoproteine costituite da 4 catene polipeptidiche:

Le Ig sono glicoproteine costituite da 4 catene polipeptidiche: Struttura delle Ig Le Ig sono glicoproteine costituite da 4 catene polipeptidiche: 2 catene pesanti H (heavy( heavy) di P.M. 50.000 D, formate da c/a 450 amminoacidi 2 catene leggere L (light) Di P.M.

Dettagli

La spirale iperbolica: Fu descritta per la prima volta da Pierre Varignon (1654-1722). L equazione, espressa in coordinate polari, è del tipo:

La spirale iperbolica: Fu descritta per la prima volta da Pierre Varignon (1654-1722). L equazione, espressa in coordinate polari, è del tipo: Esistono delle forme geometriche che sono in grado, per complessi fattori psicologici non del tutto chiariti, di comunicarci un senso d equilibrio, di gradimento e di benessere. Tra queste analizzeremo

Dettagli

I poli magnetici isolati non esistono

I poli magnetici isolati non esistono Il campo magnetico Le prime osservazioni dei fenomeni magnetici risalgono all antichità Agli antichi greci era nota la proprietà della magnetite di attirare la limatura di ferro Un ago magnetico libero

Dettagli

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2 Domini modulari delle proteine 1 Proteine della matrice DOMINI E MODULI La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette domini,

Dettagli

Transitori del primo ordine

Transitori del primo ordine Università di Ferrara Corso di Elettrotecnica Transitori del primo ordine Si consideri il circuito in figura, composto da un generatore ideale di tensione, una resistenza ed una capacità. I tre bipoli

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

Le proprietà periodiche degli elementi LA LEZIONE

Le proprietà periodiche degli elementi LA LEZIONE Le proprietà periodiche degli elementi LA LEZIONE Le proprietà degli elementi mostrano delle tendenze che possono essere predette usando il sistema periodico ed essere spiegate e comprese analizzando la

Dettagli

dieta vengono convertiti in composti dei corpi chetonici.

dieta vengono convertiti in composti dei corpi chetonici. Metabolismo degli aminoacidi Metabolismo degli aminoacidi Gli aminoacidi introdotti in eccesso con la dieta vengono convertiti in composti precursori del glucosio, degli acidi grassi e dei corpi chetonici.

Dettagli

INTRODUZIONE ALLA PROTEINE BCP 1-2

INTRODUZIONE ALLA PROTEINE BCP 1-2 INTRODUZIONE ALLA BIOCHIMICA DELLE PROTEINE BCP 1-2 Pietre miliari Lehninger 1973 Biochemistry Proteine ricombinanti Protein engineering Cristallografia, NMR, EM, MS, spettroscopie... Computing Bioinformaticai

Dettagli

3.3. UMAMI NEGLI ALIMENTI

3.3. UMAMI NEGLI ALIMENTI 3.3. UMAMI NEGLI ALIMENTI In questo capitolo saranno esaminati i vari cibi, ad esclusione di quelli ittici che verranno presi in considerazione successivamente, allo scopo di scoprire se in essi è presente,

Dettagli

Trasformazioni materia

Trasformazioni materia REAZIONI CHIMICHE Trasformazioni materia Trasformazioni fisiche (reversibili) Trasformazioni chimiche (irreversibili) È una trasformazione che non produce nuove sostanze È una trasformazione che produce

Dettagli

Peptidi, proteine ed e nzim i i 1

Peptidi, proteine ed e nzim i i 1 Peptidi, proteine ed enzimi 1 Gli amminoacidi possono formare catene Due amminoacidi possono unirsi tra loro attraverso il legame ammidico detto legame peptidico, tra il gruppo NH 2 di un amminoacido e

Dettagli

Il concetto di valore medio in generale

Il concetto di valore medio in generale Il concetto di valore medio in generale Nella statistica descrittiva si distinguono solitamente due tipi di medie: - le medie analitiche, che soddisfano ad una condizione di invarianza e si calcolano tenendo

Dettagli

Uso di base delle funzioni in Microsoft Excel

Uso di base delle funzioni in Microsoft Excel Uso di base delle funzioni in Microsoft Excel Le funzioni Una funzione è un operatore che applicato a uno o più argomenti (valori, siano essi numeri con virgola, numeri interi, stringhe di caratteri) restituisce

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

VALORE DELLE MERCI SEQUESTRATE

VALORE DELLE MERCI SEQUESTRATE La contraffazione in cifre: NUOVA METODOLOGIA PER LA STIMA DEL VALORE DELLE MERCI SEQUESTRATE Roma, Giugno 2013 Giugno 2013-1 Il valore economico dei sequestri In questo Focus si approfondiscono alcune

Dettagli

LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it

LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it LA CORRENTE ELETTRICA Prof. Erasmo Modica erasmo@galois.it L INTENSITÀ DELLA CORRENTE ELETTRICA Consideriamo una lampadina inserita in un circuito elettrico costituito da fili metallici ed un interruttore.

Dettagli

Il magnetismo nella materia

Il magnetismo nella materia Le orbite degli elettroni in atomo di idrogeno Forma spaziale degli Orbitali elettronici di atomo di idrogeno Un solido Il magnetismo nella materia ferrimagnetismo Dr. Daniele Di Gioacchino Istituto Nazionale

Dettagli

Relazione struttura-funzione

Relazione struttura-funzione Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Relazione struttura-funzione Marco Nardini Dipartimento di Scienze

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

LA MOLE : UN UNITA DI MISURA FONDAMENTALE PER LA CHIMICA

LA MOLE : UN UNITA DI MISURA FONDAMENTALE PER LA CHIMICA LA MOLE : UN UNITA DI MISURA FONDAMENTALE PER LA CHIMICA Poiché è impossibile contare o pesare gli atomi o le molecole che formano una qualsiasi sostanza chimica, si ricorre alla grandezza detta quantità

Dettagli

Regione cerniera monomero regione cerniera

Regione cerniera monomero regione cerniera Regione cerniera Tutte le Ig, sia quelle secrete che quelle presenti sulla membrana plasmatica dei linfociti B, sono costituite da quattro catene proteiche, due pesanti (H, da heavy, in rosso nel disegno)

Dettagli

Analisi della performance temporale della rete

Analisi della performance temporale della rete Analisi della performance temporale della rete In questo documento viene analizzato l andamento nel tempo della performance della rete di promotori. Alcune indicazioni per la lettura di questo documento:

Dettagli

Capitolo 13: L offerta dell impresa e il surplus del produttore

Capitolo 13: L offerta dell impresa e il surplus del produttore Capitolo 13: L offerta dell impresa e il surplus del produttore 13.1: Introduzione L analisi dei due capitoli precedenti ha fornito tutti i concetti necessari per affrontare l argomento di questo capitolo:

Dettagli

Energia nelle reazioni chimiche. Lezioni d'autore di Giorgio Benedetti

Energia nelle reazioni chimiche. Lezioni d'autore di Giorgio Benedetti Energia nelle reazioni chimiche Lezioni d'autore di Giorgio Benedetti VIDEO Introduzione (I) L energia chimica è dovuta al particolare arrangiamento degli atomi nei composti chimici e le varie forme di

Dettagli

GIROSCOPIO. Scopo dell esperienza: Teoria fisica. Verificare la relazione: ω p = bmg/iω

GIROSCOPIO. Scopo dell esperienza: Teoria fisica. Verificare la relazione: ω p = bmg/iω GIROSCOPIO Scopo dell esperienza: Verificare la relazione: ω p = bmg/iω dove ω p è la velocità angolare di precessione, ω è la velocità angolare di rotazione, I il momento principale d inerzia assiale,

Dettagli

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui Durante la traduzione l informazione di ripiegamento codificata nella sequenza aminoacidica diventa disponibile in maniera vettoriale la struttura tridimensionale può essere ottenuta solo per Un intero

Dettagli

La propagazione delle onde luminose può essere studiata per mezzo delle equazioni di Maxwell. Tuttavia, nella maggior parte dei casi è possibile

La propagazione delle onde luminose può essere studiata per mezzo delle equazioni di Maxwell. Tuttavia, nella maggior parte dei casi è possibile Elementi di ottica L ottica si occupa dello studio dei percorsi dei raggi luminosi e dei fenomeni legati alla propagazione della luce in generale. Lo studio dell ottica nella fisica moderna si basa sul

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

Forza. Forza. Esempi di forze. Caratteristiche della forza. Forze fondamentali CONCETTO DI FORZA E EQUILIBRIO, PRINCIPI DELLA DINAMICA

Forza. Forza. Esempi di forze. Caratteristiche della forza. Forze fondamentali CONCETTO DI FORZA E EQUILIBRIO, PRINCIPI DELLA DINAMICA Forza CONCETTO DI FORZA E EQUILIBRIO, PRINCIPI DELLA DINAMICA Cos è una forza? la forza è una grandezza che agisce su un corpo cambiando la sua velocità e provocando una deformazione sul corpo 2 Esempi

Dettagli

CHIMICA ORGANICA: IBRIDAZIONE & RISONANZA IBRIDIZZAZIONE. un atomo compie all atto di formazione di un composto al fine di formare un maggior

CHIMICA ORGANICA: IBRIDAZIONE & RISONANZA IBRIDIZZAZIONE. un atomo compie all atto di formazione di un composto al fine di formare un maggior CHIMICA ORGANICA: IBRIDAZIONE & RISONANZA IBRIDIZZAZIONE L ibridizzazione o ibridazione è una ricombinazione dei propri orbitali atomici che un atomo compie all atto di formazione di un composto al fine

Dettagli

Aminoacidi e proteine

Aminoacidi e proteine Prof. Giorgio Sartor Aminoacidi e proteine Copyright 2001-2012 by Giorgio Sartor. Versione 1.7.1 mar 2012 All rights reserved. Le cellule V.1.7.1 gsartor 2001-2012 Aminoacidi e proteine -2- Aminoacidi

Dettagli