Chimica Biologica A.A α-elica foglietto β reverse turn

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Chimica Biologica A.A α-elica foglietto β reverse turn"

Transcript

1 Chimica Biologica A.A α-elica foglietto β reverse turn

2 Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse turn - circa il % degli amminoacidi delle proteine globulari assume la conformazione regolare tipica di uno dei tre tipi di struttura secondaria - i segmenti di catena polipeptidica che non sono in α elica, foglietto β o turn, assumono la conformazione chiamata loop o random coil, struttura non ripetitiva né regolare, spesso priva di legami idrogeno tra gli amminoacidi che la compongono

3 Str. Secondaria sperimentalmente osservata: α elica - struttura secondaria più frequentemente adottata dalla catena polipeptidica delle proteine (~32-38% degli amminoacidi delle proteine globulari di struttura 3D nota) - una α elica destrorsa è caratterizzata da: (φ, ψ) = (-57, -47 ) n = 3.6 residui per giro p = 5.4 Å d = 1.5 Å - le α eliche di tipo sinistrorso molto rare e limitate a pochi amminoacidi e sono caratterizzate da valori (φ, ψ) = (+57, +47 ) e da stessi valori per n e p rispetto a quelle destrorse ( ma n negativo).

4 α elica - legami a H fra il gruppo carbonilico dell amminoacido n e il gruppo amminico dell amminoacido n+4. (distanza N O quasi ottimale, di 2.8 Å) - legami a H unidirezionali paralleli all asse dell elica - tutti i gruppi NH e CO saranno legati da legami a H, eccetto i primi 3 gruppi NH e gli ultimi 3 gruppi CO alle estremità dell elica - ottimizzazione interazioni di van der Waals fra gli atomi lungo l intero asse dell elica C-term N-term struttura fortemente impaccata dell α elica (schematizzata come cilindro pieno)

5 α elica - catene laterali rivolte verso l esterno e verso l estremità N-term dell elica (struttura ad albero di Natale ) minimizzazione interferenze steriche con catena polipeptidica principale e catene laterali - una α elica sinistrorsa si trova raramente nelle proteine (3-5 amminoacidi) perché le catene laterali interferirebbero stericamente con la catena principale

6 α elica - all α elica è associato un macrodipolo - tutti gli n dipoli associati all unità peptidica sono allineati lungo l asse dell elica (momento di dipolo totale ~ n 3.5 Debye) se q = carica agli estremi del macrodipolo e n d è la lunghezza del dipolo (d = 1.5 Å) n 3.5 Debye = n d q q = 3.5 Debye/1.5 Å = 3.5 ( Cm)/ m = = 3.5 ( ) / ( ) = e - ~ 0.5 e - parziale carica positiva e negativa rispettivamente alle estremità N- e C-terminali dell α elica tale distribuzione di carica può attrarre ligandi di carica opposta.

7 Propensione ad α-elica Ciascuno dei 20 amminoacidi mostra una specifica propensione, o meno, per assumere conformazione in α elica. Ala, Glu, Leu, Met: buoni iniziatori di α eliche Gly, Tyr, Ser: deboli iniziatori di α eliche Pro: impossibile la formazione del legame a H con il gruppo CO. La prolina si adatta bene nel primo giro dell α elica, mentre se si trova in qualunque altra posizione nell elica di solito produce una significativa distorsione dell asse dell elica dalla linearità (circa 25 ).

8 Propensione ad α-elica Le α eliche possono essere: - completamente esposte al solvente - completamente sepolte nel cuore della proteina - sulla parte esterna della superficie proteica (un lato affacciato sul solvente e l altro all interno idrofobico della proteina) tendenza delle catene laterali a cambiare da idrofobiche a idrofiliche con una periodicità di 3-4 residui.

9 Altri tipi di elica Variazioni dell α elica, in cui la catena polipeptidica è avvolta più o meno strettamente, con legami a H fra coppie di amminoacidi (n n+3) o (n n+5), sono chiamate elica 3 10 ed elica π Elica 3 10 : (φ, ψ) = (-49, -26 ) Elica π: (φ, ψ) = (-57, -70 ) - entrambe sono ai limiti della regione permessa per le strutture elicoidali destrorse nel plot di Ramachandran: - le elica 3 10 e π ricorrono poco frequentemente nelle proteine -le eliche 3 10 possono essere presenti alle estremità delle α eliche, come segmenti molto corti (3-4 amminoacidi)

10 Altri tipi di elica

11 Str. Secondaria sperimentalmente osservata: foglietto β - struttura secondaria assai frequentemente nella catena polipeptidica delle proteine (~20-28% degli a.a. delle proteine globulari di struttura 3D nota) L unità costituente i foglietti β èil filamento β (β-strand), lungo in media da 5 a 10 a.a., con la catena polipeptidica quasi completamente estesa Il filamento β si può considerare un tipo speciale di elica, con n = 2 residui per giro e una traslazione d = 3.4 Å per amminoacido

12

13 Foglietto-β I foglietti β nelle proteine globulari sono costituiti da 2 a 15 filamenti β abbinati lateralmente, con un valor medio di 6 I filamenti β sono allineati uno vicino all altro, in modo tale che si possano formare legami a H tra i gruppi CO di un filamento e i gruppi NH del filamento β adiacente e viceversa

14 Foglietto-β foglietto-β antiparallelo foglietto-β parallelo (φ, ψ) = (-139, 135 ) (φ, ψ) = (-119, 113 ).

15 Foglietto-β foglietto-β misto I filamenti β si possono anche combinare a formare un foglietto β misto, con alcune coppie di filamenti antiparalleli ed altre paralleli I foglietti β misti sono meno frequenti dei foglietti β paralleli ed antiparalleli

16 Foglietto-β I foglietti β formati da un certo numero di filamenti β sono pieghettati (pleated) Le catene laterali degli puntano alternativamente sopra e sotto il foglietto β. Spesso un lato del foglietto β può presentare tutte catene laterali polari e l altro tutte non polari

17 Foglietto-β - i foglietti β antiparalleli sono più stabili di quelli paralleli: i legami-h hanno nei primi una geometria più favorevole - i foglietti β non hanno momento dipolare - tutti i foglietti β osservati (paralleli, antiparalleli e misti) presentano una torsione (twist) destrorsa (fino a 30 ) di ciascun filamento β che li compone compromesso tra l ottimizzazione dell energia conformazionale delle catene polipeptidiche costituenti i filamenti β e il mantenimento della geometria dei legami idrogeno

18 Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone Molte di queste inversioni sono dovute alla presenza di un comune elemento strutturale, chiamato reverse turn Gli amminoacidi coinvolti nella formazione dei reverse turn si trovano generalmente sulla superficie delle proteine e hanno natura polare e/o carica Esistono vari tipi di reverse turn, a seconda del numero di amminoacidi che li costituiscono e degli elementi di struttura secondaria che collegano: β-turn γ-turn Ω-loop

19 Reverse turn β-turn E il tipo di turn più comune per collegare due filamenti β antiparalleli adiacenti. In questo caso sono due gli amminoacidi non coinvolti nei legami idrogeno tra i filamenti β Ogni β-turn è caratterizzato da un legame idrogeno fra il gruppo CO dell aminoacido 1 e il gruppo NH dell amminoacido 4, anche se spesso si osservano deviazioni (fino a 30 ) da questa conformazione ideale che impediscono la formazione di questo legame idrogeno Spesso in posizione 1 si trovano gli amminoacidi Asn, Asp, Ser e Cys, le cui catene laterali possono formare legami idrogeno con il gruppo NH dell amminoacido in posizione 3 Esistono 3 tipi di β-turn: tipo I, tipo II e tipo III

20 Struttura Proteine Reverse turn β-turn: Tipo I Angoli diedri (φ, ψ) 2 = (-60, -30 ) Angoli diedri (φ, ψ) 3 = (-90, 0 ) 3 4 I β-turn di tipo I si possono considerare un breve tratto distorto di elica 3 10 Nei β-turn di tipo I l amminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta 2 1 Essi sono circa 2-3 volte più frequenti di quelli di tipo II

21 Struttura Proteine Reverse turn β-turn: Tipo II Angoli diedri (φ, ψ) 2 = (-60, 120 ) Angoli diedri (φ, ψ) 3 = (90, 0 ) I β-turn di tipo II differiscono da quelli di tipo I per un flip di 180 dell unità peptidica che collega gli 2 amminoacidi in posizione 2 e 3 1 Nei β-turn di tipo II l amminoacido in posizione 2 spesso è Pro, poiché facilmente può assumere la conformazione voluta, mentre l amminoacido in posizione 3 spesso è una Gly, per evitare che l atomo di carbonio della catena laterale sia troppo vicino all atomo di ossigeno dell amminoacido in posizione 2 3 4

22 Struttura Proteine γ-turn Reverse turn - si osserva quando solo un amminoacido non è coinvolto nei legami idrogeno caratteristici del foglietto β - legame a H fra il gruppo CO dell amminoacido i e il gruppo NH dell amminoacido i+2 - inusuali valori degli angoli diedri per l amminoacido i+1 (φ = 75, ψ = -65 ) i+1 - spesso Pro in posizione 2 (i+1) (γ-turn inverso φ = -75, ψ = 65 )

23 Struttura Proteine Ω-loop (Ansa Ω) Reverse turn Quasi tutte le proteine globulari con un numero di amminoacidi superiore a 60 contengono uno o più loop lunghi da 6 a 16 amminoacidi, le cui estremità distano meno di 10 Å - Ω-loop (forma della lettera greca omega) - forma compatta e non disordinata poiché le catene laterali degli amminoacidi che li compongono tendono a riempire le loro cavità interne, rendendoli piuttosto stabili - spesso localizzati sulla superficie delle proteine e possono avere un importante ruolo nel riconoscimento dei processi biologici

24 Struttura Proteine Random coil (loop) Le regioni della catena polipeptidica che non assumono alcun tipo di struttura secondaria - struttura irregolare nel senso che le coppie (φ, ψ) degli amminoacidi che li compongono assumono valori tra i più svariati e non costanti - generalmente flessibili e possono adottare diverse conformazioni: per questo motivo molto spesso sono difficili da rilevare sperimentalmente Per esempio: estremità N- e C-terminali, zone particolarmente ricche di amminoacidi carichi (Lys in particolare) - oltre ad avere la funzione di collegare elementi di struttura secondaria, possono anche partecipare alla formazione di siti di legame e di siti attivi negli enzimi, per cui possono essere disordinati in assenza della molecola specifica e ordinati in presenza della molecola che legano

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra). Strutture secondarie (b) Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi.

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi. Il legame peptidico Il legame peptidico La polimerizzazione di AA viene raggiunta per eliminazione di una molecola d acqua tra il gruppo carbossilico di un AA e il gruppo amminico del successivo. Il legame

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Modello Watson-Crick del DNA

Modello Watson-Crick del DNA Modello Watson-Crick del DNA Diffrazione raggi X (Wilkins & Franklin) Modello atomico a doppia elica (B-DNA, Watson & Crick) VMD 1 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

LE MEMBRANE CELLULARI

LE MEMBRANE CELLULARI LE MEMBRANE CELLULARI Sono strutture sovramolecolari che racchiudono e delimitano l ambiente intracellulare e negli eucarioti anche gli organuli citoplasmatici. Hanno funzione di Protezione. Sostegno.

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

- Φ e ψ Presenta 3,6 residui per spira -HB between C=O n residue n and NH n+4. - α-helix

- Φ e ψ Presenta 3,6 residui per spira -HB between C=O n residue n and NH n+4. - α-helix Structure Basic elements - Φ e ψ -60-50. -Presenta 3,6 residui per spira -HB between C=O n residue n and NH n+4. - α-helix Β-sheet Red oxygen Blu nitrogen white hydrogen black Cα Violet lateral chain -at

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

Esercizi sulle Forze Intermolecolari

Esercizi sulle Forze Intermolecolari Insegnamento di Chimica Generale 083424 - CCS CHI e MAT A.A. 2015/2016 (I Semestre) Esercizi sulle Forze Intermolecolari Prof. Dipartimento CMIC Giulio Natta http://iscamap.chem.polimi.it/citterio Esercizio

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali

Dettagli

STRUTTURA E FUNZIONI

STRUTTURA E FUNZIONI STRUTTURA E FUNZIONI Typical Cell Membrana plasmatica Chiamata anche membrana cellulare Circonda ogni cellula Separa il contenuto cellulare dal cio che la circonda Separa il LIC dal LEC Controlla il movimento

Dettagli

materiale didattico disponibile su tozzini/didattica.html

materiale didattico disponibile su  tozzini/didattica.html materiale didattico disponibile su http://homepage.sns.it/ tozzini/didattica.html Sommario Proteine Funzioni principali Legame peptidico Struttura primaria Struttura secondaria Struttura terziaria Struttura

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Macromolecole Biologiche. Metodi di simulazione

Macromolecole Biologiche. Metodi di simulazione Metodi di simulazione Dinamica molecolare Tecnica di simulazione che permette lo studio del moto e delle proprietà di un sistema di particelle. Moti localizzati (da 0.01 a 5 Å, da 10-15 a 10-1 s) - fluttuazioni

Dettagli