Macromolecole Biologiche. I domini (II)

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Macromolecole Biologiche. I domini (II)"

Transcript

1 I domini (II)

2 Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati sono solo 3: - up and down - chiave greca - jelly roll In generale, i filamenti β sono disposti in modo tale da formare 2 foglietti β impaccati uno con l altro (sandwich o barili), a formare un core idrofobico. Un discorso a parte meritano i domini a β elica, una struttura β recentemente scoperta.

3 Domini β: Up and down La topologia più semplice per foglietti β antiparalleli è chiamata up and down: in essa i filamenti β adiacenti sono collegati da regioni di loop (β-hairpin). Spesso l ultimo filamento β è collegato al primo da legami idrogeno, a formare un barile (β barrel) di 8 filamenti β, come nel caso delle proteine che legano il retinolo o acidi grassi. Se ciò non accade si parla di β sandwich. In questi casi, nelle sequenze dei filamenti β catene laterali idrofobiche si alternano a catene laterali polari e cariche idrofiliche, in modo tale da formare il core idrofobico all interno del barile/sandwich e da interagire esternamente con il solvente.

4 Domini β: Up and down Un altro esempio di topologia up and down è rappresentato dalla neuraminidasi dal virus dell influenza. In questo caso i filamenti β non formano un barile ma 6 foglietti β che si organizzano in un β propeller. I loop di ciascun foglietto β che collegano i filamenti β 2 e 3 si trovano tutti dallo stesso lato del β propeller e formano il sito attivo della proteina.

5 Domini β: Chiave greca Un altro modo per collegare filamenti β antiparalleli è la topologia a chiave greca, che connette filamenti β sui lati opposti del barile β.

6 Domini β: Chiave greca Il motivo base è costituito da 4 filamenti β: 3 presentano topologia up and down e sono collegati da β hairpin, seguiti da una connessione più lunga al quarto filamento β, che è adiacente al primo. Esempi di topologia a chiave greca si osservano nelle superossido dismutasi a Cu,Zn e nella proteina γ cristallino.

7 Domini β: Jelly roll Un altra topologia caratteristica dei filamenti β antiparalleli è chiamata jelly roll. Consideriamo una stringa costituita da 8 filamenti β antiparalleli, collegati a 2 a 2 da legami idrogeno (coppie 1-8, 2-7, 3-6 e 4-5). Se si avvolge questa stringa intorno ad un cilindro, in modo tale che i filamenti β si trovino sulla superficie del barile mentre le regioni di loop alle 2 estremità, si ottiene la topologia jelly roll.

8 Domini β: Jelly roll Nella topologia jelly roll, le coppie di filamenti β (1-8, 2-7, 3-6 e 4-5) sono disposte in modo tale che il filamento β 1 sia adiacente al 2, il 7 al 4, il 5 al 6 e il 3 all 8. In questo modo si possono formare altri legami idrogeno fra questi filamenti β. 2 connessioni attraversano l estremità superiore del barile e 2 attraversano quella inferiore. In più ci sono 2 connessioni tra filamenti β adiacenti nell estremità superiore del barile e 1 all estremità inferiore. Esempi: proteine costituenti il capside dei virus sferici, emmaglutinina.

9 Domini β: β elica Nel 1993 fu scoperta una nuova, inaspettata, struttura di tipo β, la β elica. La β elica, che non è in nessun modo correlata alle altre strutture β, fu osservata per la prima volta nella struttura dell enzima batterico pectato liasi. Successivamente, sono state determinate altre strutture proteiche contenenti β eliche (tra cui proteinasi batteriche extracellulari e la proteina tailspike del batteriofago P22). Nella β elica la catena polipeptidica si avvolge a formare un ampia elica, costituita da filamenti β uniti fra loro da regioni di loop. Esistono 2 tipi di β elica: - β elica a 2 foglietti β - β elica a 3 foglietti β

10 Domini β: β elica a 2 foglietti β La β elica a 2 foglietti β è la forma di β elica più semplice, osservata nelle proteinasi extracellulari batteriche. Ciascun giro di elica comprende 2 filamenti β e 2 regioni di loop. Questa unità strutturale si ripete 3 volte a formare una struttura elicoidale destrorsa costituita da 2 foglietti β paralleli costituiti ciascuno da 3 filamenti β, con un core idrofobico in mezzo. L unità strutturale base della β elica a 2 foglietti β è costituita da 18 aminoacidi, 3 in ciascun filamento β e 6 in ciascun loop. Questa unità base è caratterizzata dalla sequenza consenso: (Gly-Gly-X-Gly-X-Asp-X-U-X) 2 [X: qualsiasi aminoacido; U: idrofobico, spesso Leu]

11 Domini β: β elica a 2 foglietti β Sequenza consenso: (Gly-Gly-X-Gly-X-Asp-X-U-X) 2 I primi 6 aminoacidi formano un loop e gli altri 3 un filamento β, con la catena laterale di U coinvolta nell impaccamento idrofobico dei 2 foglietti β. I loop sono stabilizzati da ioni calcio che si legano all aminoacido Asp. Questa sequenza consenso può essere utilizzata per cercare possibili strutture β elica a 2 foglietti β analizzando database di sequenze di proteine di struttura tridimensionale non nota.

12 Domini β: β elica a 3 foglietti β Una β elica più complessa è presente nella pectato liasi e nella proteina tailspike del batteriofago P22. Nelle β eliche a 3 foglietti β ciascun giro di elica è formata da 3 filamenti β (ciascuno costituito da 3 a 5 aminoacidi) collegati da 3 loop. La β elica quindi è costituita da 3 foglietti β paralleli, che formano i lati di un prisma. La sezione della β elica, però, non è triangolare, a causa della disposizione dei foglietti β.

13 Domini β: β elica a 3 foglietti β Due dei foglietti β sono posizionati uno adiacente all altro, come nella β elica a 2 foglietti β, e il terzo foglietto β è quasi perpendicolare agli altri 2. Un loop (a) è corto e quasi sempre formato solo da 2 aminoacidi con conformazione invariante e forma un angolo di circa 120 fra i 2 filamenti β che unisce. Gli altri 2 loop (b, c) sono più lunghi e variano in dimensione e conformazione. I loop lunghi protrudono dai foglietti β e probabilmente formano il sito attivo sulla superficie esterna della proteina. La variabilità in numero e tipo di aminoacidi che costituiscono i 2 loop lunghi impedisce di determinare una sequenza consenso per la β elica a 3 foglietti β.

14 Domini β: β elica a 3 foglietti β Il numero di giri di elica nelle β eliche a 3 foglietti β è maggiore di quello trovato nelle β eliche a 2 foglietti β. La pectato liasi consiste di 7 giri di β elica (d = 4.86 Å), è lunga 34 Å e ha un diametro di Å, mentre la β elica della proteina tailspike del batteriofago P22 è formata da 13 giri.

15 Domini β: β elica a 4 foglietti β Esistono anche β eliche destrorse costituite da 4 foglietti β paralleli, che possono essere considerate come un estensione di quelle a 3 foglietti β. Infatti, il foglietto β evidenziato può essere visto come un estensione N-terminale del foglietto β successivo. Queste coppie di filamenti β sono separate da un loop costituito da 1-2 aminoacidi, uno dei quali adotta sempre una conformazione α-elica sinistrorsa e cambia la direzione della catena polipeptidica principale di circa 100.

16 Domini β: β elica sinistrorsa Nel 1995 è stata osservata una β elica sinistrorsa, nella struttura dell enzima UDP-N-acetilglucosammina transferasi (LpxA). Gli enzimi che presentano la β elica sinistrorsa sono caratterizzati dalla ripetizione dell esapeptide: [LIV]-[GAED]-X-X-[STAV]-X

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte

Dettagli

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

La funzione delle proteine dipende dalla loro struttura tridimensionale

La funzione delle proteine dipende dalla loro struttura tridimensionale La funzione delle proteine dipende dalla loro struttura tridimensionale La struttura dipende dal ripiegamento di particolari sequenze aminoacidiche La sequenza aminoacidica della catena polipeptidica è

Dettagli

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,

Dettagli

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria

Macromolecole Biologiche. Chimica Biologica A.A. 2010-2011. Struttura Terziaria Macromolecole Biologiche Chimica Biologica A.A. 2010-2011 Struttura Terziaria Domini e struttura terziaria Struttura terziaria L arrangiamento spaziale degli amminoacidi di una singola catena polipeptidica

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Seminario. Domini modulari delle proteine 1

Seminario. Domini modulari delle proteine 1 Seminario Proteine della matrice DOMINI E MODULI Domini modulari delle proteine 1 La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette

Dettagli

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2 Domini modulari delle proteine 1 Proteine della matrice DOMINI E MODULI La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette domini,

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 7 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 7 La struttura delle proteine Concetti chiave: La struttura terziaria di una proteina descrive il ripiegamentodei suoi elementi

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Gerarchia della struttura delle proteine

Gerarchia della struttura delle proteine Si indica con CONFORMAZIONE la disposizione tridimensionale degli atomi di una molecola, cioè la loro organizzazione spaziale. Gerarchia della struttura delle proteine struttura primaria: sequenza degli

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui Durante la traduzione l informazione di ripiegamento codificata nella sequenza aminoacidica diventa disponibile in maniera vettoriale la struttura tridimensionale può essere ottenuta solo per Un intero

Dettagli

Relazione struttura-funzione

Relazione struttura-funzione Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Relazione struttura-funzione Marco Nardini Dipartimento di Scienze

Dettagli

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi Proteine Biopolimeri degli α-amino acidi. Amino acidi sono uniti attraverso il legame peptidico. Alcune funzioni: Struttura (collagene, cheratina ecc.) Enzimi (maltasi, deidrogenasi ecc) Trasporto (albumine,

Dettagli

LA MEMBRANA. www.fisiokinesiterapia.biz

LA MEMBRANA. www.fisiokinesiterapia.biz LA MEMBRANA www.fisiokinesiterapia.biz Struttura della membrana Le membrane sono fondamentali per la vita della cellula Racchiudono la cellula definendone i confini e mantenendo le differenze fondamentali

Dettagli

strutture di Proteine

strutture di Proteine Laboratorio di Bioinformatica I Database di strutture di Proteine Dott. Sergio Marin Vargas (2014 / 2015) Dal gene alla proteina La funzione della proteina è nella sua struttura 3D. Struttura delle proteine

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Pectinasi. PECTINA composto estratto dalla frutta- MELE E PERE- gelificante. Grado di esterificazione

Pectinasi. PECTINA composto estratto dalla frutta- MELE E PERE- gelificante. Grado di esterificazione Pectinasi Le pectine sono carboidrati complessi che fanno parte della lamella mediana delle cellule vegetali e contribuiscono al mantenimento della struttura dei tessuti vegetali. L unità di base è costituita

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

Presentazione dell antigene tramite TCR

Presentazione dell antigene tramite TCR Presentazione dell antigene tramite TCR Elena Adinolfi Il recettore della cellula T (TCR) Il TCR è il recettore per l antigene delle cellule T. In maniera analoga a quanto accade per le cellule B ad ogni

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine Nelle proteine vi sono quattro livelli di organizzazione strutturale Struttura Primaria: sequenza di aminoacidi legati tra loro da legami peptidici Tutte le proteine esistenti

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Predizione della struttura terziaria

Predizione della struttura terziaria Predizione della struttura terziaria Metodi di predizione La predizione della struttura tridimensionale è di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi

Dettagli

Rappresentazione dei Dati Biologici

Rappresentazione dei Dati Biologici Rappresentazione dei Dati Biologici CORSO DI BIOINFORMATICA C.d.L. Ingegneria Informatica e Biomedica Outline Proteine ed Amminoacidi Rappresentazione di Amminoacidi Rappresentazione delle strutture Proteiche

Dettagli

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA Email: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

La regolazione genica nei eucarioti

La regolazione genica nei eucarioti La regolazione genica nei eucarioti Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri Differenziamento negli eucarioti pluricellulari Negli eucarioti le cellule specializzate dei vari tessuti contengono

Dettagli

Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a.

Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a. Anticorpi generalità Riconoscimento antigene Anticorpi Molecole MHC Recettore per l Ag dei linfociti T (TCR) Anticorpi riconoscono diversi tipi di strutture antigeniche macromolecole proteine, lipidi,

Dettagli

STEREOISOMERIA carbonio ibridizzato sp3 è legato a quattro atomi o gruppi tutti diversi fra loro

STEREOISOMERIA carbonio ibridizzato sp3 è legato a quattro atomi o gruppi tutti diversi fra loro STEREOISOMERIA i sono oggetti che sono sovrapponibili alla loro immagine speculare: tutti gli oggetti di forma piana, ad esempio. osì, se prendo un alchene e lo confronto con la sua immagine allo specchio:

Dettagli

Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Trasduzione del Segnale da Recettori di Superfice

Trasduzione del Segnale da Recettori di Superfice Trasduzione del Segnale da Recettori di Superfice MEMBRANA 1. Legame recettore-ligando 2. oligomerizzazione 3. Attivazione TYR-K -Dominio citosolico dei RTK -Reclutamento TYR-K (src, jak, fak, abl) 4.

Dettagli

Peptidi, proteine ed e nzim i i 1

Peptidi, proteine ed e nzim i i 1 Peptidi, proteine ed enzimi 1 Gli amminoacidi possono formare catene Due amminoacidi possono unirsi tra loro attraverso il legame ammidico detto legame peptidico, tra il gruppo NH 2 di un amminoacido e

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

LA TRADUZIONE E IL CODICE GENETICO

LA TRADUZIONE E IL CODICE GENETICO LA TRADUZIONE E IL CODICE GENETICO La traduzione La traduzione è il processo di sintesi di una catena polipeptidica, un polimero costituito da amminoacidi legati insieme da legami peptidici Le molecole

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

La regolazione genica nei virus

La regolazione genica nei virus La regolazione genica nei virus Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri I VIRUS INDICE Caratteristiche dei virus: il capside e il genoma virale Classificazione virale Fasi del ciclo riproduttivo

Dettagli

corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata lunga catena di ammino acidi struttura spaziale organizzata

corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata lunga catena di ammino acidi struttura spaziale organizzata STRUTTURA DELLE PROTEINE Peptide: corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata Polipeptide (proteina): lunga catena di ammino acidi struttura spaziale organizzata

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N

Dettagli

Legame al GMPciclico COOH

Legame al GMPciclico COOH Moduli strutturali delle proteine Nelle proteine è possibile individuare alcune strutture caratterizzate da omologia, che svolgono particolari funzioni, e che si ritrovano in proteine diverse. Si può parlare

Dettagli

ITIS Marconi - Padova Esame di Stato 2011/2012. Tesina sperimentale NEURAMINIDASI E FARMACI ANTI-INFLUENZALI

ITIS Marconi - Padova Esame di Stato 2011/2012. Tesina sperimentale NEURAMINIDASI E FARMACI ANTI-INFLUENZALI ITIS Marconi - Padova Esame di Stato 2011/2012 Tesina sperimentale NEURAMINIDASI E FARMAI ANTI-INFLUENZALI andidato: Marcello Dolano 5 I Relatore: prof. Mauro Tonellato NEURAMINIDASI E FARMAI ANTI-INFLUENZALI

Dettagli

BIOMOLECOLE STRUTTURA E FUNZIONE

BIOMOLECOLE STRUTTURA E FUNZIONE BIOMOLECOLE STRUTTURA E FUNZIONE Lo studio delle relazioni tra struttura e funzione nelle biomolecole è uno degli aspetti più importanti per la comprensione del funzionamento dei processi biologici La

Dettagli

Strutture molecolari della cellula: Bio-macromolecole. Prof. C. Guarino

Strutture molecolari della cellula: Bio-macromolecole. Prof. C. Guarino Strutture molecolari della cellula: Bio-macromolecole Prof. C. Guarino INTRO Ogni cellula vivente racchiude una pluralità di molecole diverse L acqua è l elemento dominante, nelle cellule vegetali e nei

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Capitolo 17. Risposte alle domande interne al capitolo. 17.1 (p. 501) a. glicina. b. prolina. c. treonina. d. aspartato

Capitolo 17. Risposte alle domande interne al capitolo. 17.1 (p. 501) a. glicina. b. prolina. c. treonina. d. aspartato apitolo 17 Risposte alle domande interne al capitolo 17.1 (p. 501) a. glicina b. prolina c. treonina d. aspartato e. 17.2 (p. 501) a. La glicina è un aminoacido idrofobico. b. La prolina è un aminoacido

Dettagli

DI REGOLAZIONE A DUE COMPONENTI

DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac

Dettagli

C2. Il rilascio del fattore sigma marca il passaggio alla fase di allungamento della trascrizione.

C2. Il rilascio del fattore sigma marca il passaggio alla fase di allungamento della trascrizione. Soluzioni ai problemi del Capitolo 12 Domande concettuali C1. A. I geni dei trna codificano molecole di trna e i geni degli rrna le molecole di rrna che si trovano nei ribosomi. Esistono anche dei geni

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Downloaded from www.immunologyhomepage.com. Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B

Downloaded from www.immunologyhomepage.com. Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B Downloaded from www.immunologyhomepage.com Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B I geni che codificano i recettori per gli antigeni (BCR e TCR) sono presenti in uno

Dettagli

Funzioni delle proteine del sangue:

Funzioni delle proteine del sangue: PROTEINE DEL SANGUE Funzioni delle proteine del sangue: 1. Funzioni nutrizionali 2. Regolazione dell equilibrio acido base 3. Ripartizione dell acqua nei vari distretti 4. Funzione di trasporto 5. Coagulazione

Dettagli

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali

Dettagli

Misura di e/m. Marilena Teri, Valerio Toso & Ettore Zaffaroni (gruppo Lu4)

Misura di e/m. Marilena Teri, Valerio Toso & Ettore Zaffaroni (gruppo Lu4) Misura di e/m Marilena Teri, Valerio Toso & Ettore Zaffaroni (gruppo Lu4) 1 Introduzione 1.1 Introduzione ai fenomeni in esame Un elettrone all interno di un campo elettrico risente della forza elettrica

Dettagli

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale.

E il server più utilizzato, permette di tracciare tutte le operazioni che svolge e di impostare alcuni parametri importanti per il risultato finale. Homology modelling L omology modeling delle proteine è il tipo di predizione di struttura terziaria più semplice ed affidabile. Viene richiesta soltanto una (o più) sequenze di riferimento su cui modellare

Dettagli

Cromatografia Dal greco chroma : colore, graphein : scrivere 1903 Mikhail Twsett (pigmenti vegetali su carta)

Cromatografia Dal greco chroma : colore, graphein : scrivere 1903 Mikhail Twsett (pigmenti vegetali su carta) Cromatografia Dal greco chroma : colore, graphein : scrivere 1903 Mikhail Twsett (pigmenti vegetali su carta) E il termine generico che indica una serie di tecniche di separazione di molecole simili in

Dettagli

Proteine integrali di membrana legate sul versante esterno a gruppi di carboidrati. Formati da diverse subunità che circoscrivono un poro acquoso che

Proteine integrali di membrana legate sul versante esterno a gruppi di carboidrati. Formati da diverse subunità che circoscrivono un poro acquoso che Canali ionici Proteine integrali di membrana legate sul versante esterno a gruppi di carboidrati. Formati da diverse subunità che circoscrivono un poro acquoso che permette il passaggio selettivo di ioni.

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi.

Figura 1. Rappresentazione della doppia elica di DNA e struttura delle differenti basi. Sommario La molecola di DNA è deputata a conservare le informazioni genetiche necessarie per lo sviluppo ed il funzionamento degli organismi viventi. Poiché contiene le istruzioni per la costruzione delle

Dettagli

Biologia Cellulare e DNA «Bigino»

Biologia Cellulare e DNA «Bigino» Biologia Cellulare e DNA «Bigino» Giulio Barigelletti www.baveno.net Premesse 2 Sempre più frequentemente si sente parlare di DNA, Proteine, Amminoacidi, etc., relazionati all esistenza dell essere umano.

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Motorino elettrico fatto in casa

Motorino elettrico fatto in casa Realiz zato da Giovanni Gerardi VA P.N.I. a.s. 2010-11 Motorino elettrico fatto in casa Premesse. In una lezione di fisica verso metà marzo la professoressa di matematica e fisica Maria Gruarin ha introdotto

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

Le idee della chimica

Le idee della chimica G. Valitutti A.Tifi A.Gentile Seconda edizione Copyright 2009 Zanichelli editore Capitolo 25 Le basi della biochimica 1. I carboidrati 2. I lipidi 3. Gli amminoacidi, i peptidi e le proteine 4. La struttura

Dettagli

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti Gli attivatori trascrizionali sono delle proteine modulari domini funzionali sovrapposti DIMOSTRAZIONE SPERIMENTALE DI DOMINI FUNZIONALI SEPARATI NEL TF DI LIEVITO GAL 4! Esperimenti di Ptshane. Cellule

Dettagli