le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA"

Transcript

1 STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con elementi di struttura secondaria (α-eliche e β-foglietti, β- turns) vanno incontro ad un ulteriore ripiegamento della catena polipeptidica sino ad assumere una struttura fortemente impaccata Residui lontani nella struttura primaria sono avvicinati dal ripiegamento in modo da stabilire interazioni tra le loro catene R (interazioni a lungo raggio)

2 Il ripiegamento (folding) di una proteina non è mai un processo casuale Ma sempre dettato dalla sequenza amminoacidica della proteina. Infatti, Il modo in cui una catena proteica si avvolge dipende dal tipo di interazioni che si stabiliscono fra le catene laterali dei suoi residui amminoacidici. Una proteina, fra tutti i possibili ripiegamenti che può assumere, addotta quello in cui le interazioni fra le catene R dei suoi residui sono OTTIMALI e consentono di raggiungere la maggiore stabilità (e quindi uno stato di minima energia) La proteina addotta la sua conformazione nativa. Il ripiegamento inizia durante la sintesi proteica ed è assistito da chaperoni molecolari Processo cooperativo: le prime interazioni che si formano tra le catene laterali dei residui amminoacidici innescano le successive. Processo rapido E un processo che è innescato dall effetto idrofobico

3 La catena polipeptidica si ripiega in modo da costringere le catene non polari ad associarsi tra loro in un CORE core idrofobico da cui sono escluse le molecole d H 2 O. H 2 O Durante l avvolgimento le catene laterali polari tendono ad essere spinte sulla superficie esterna della proteina, a contatto con le molecole d H 2 O della sfera di solvatazione. Sotto la spinta dell effetto idrofobico la proteina collassa su stessa e assume una struttura più ordinata, quindi diminuisce l entropia del polipeptide e aumenta quella del solvente (dal core della proteina vengono espulse molecole d H 2 O). II processo risulta energeticamente favorito dalla formazione di numerosissime interazioni tra le catene laterali degli amminoacidi che vengono avvicinati.

4 La struttura terziaria è stabilizzata dalle seguenti interazioni tra le catene laterali R dei residui amminoacidici: Ser Non covalenti Interazioni idrofobiche Interazioni di van der Waals Legami idrogeno Interazioni ioniche Covalenti Ponti disolfuro Lys Tyr Leu 2 Cys Phe Asp

5 Durante il processo di avvolgimento della catena polipeptidica più strutture secondarie riconoscibili si combinano a formare i MOTIVI O STRUTTURE SUPERSECONDARIE ansa β-α-β Elica-ansa-elica es: proteine leganti calcio Barilotto β Motivo complesso caratteristico dell α-emolisina di Staphylococcus aureus (tossina che uccide le cellule formando pori nella membrana)

6 DOMINI Più motivi si possono associare a formare dei DOMINI: Unità distinte di una stessa proteina che si ripiegano e si compattano indipendentemente (da 30 a 300 residui amminoacidici). Hanno una struttura riconoscibile e sono in genere associati a particolari funzioni. Sono connessi da anse e legati tra loro da interazioni deboli. Non tutte le proteine globulari hanno un organizzazione a domini. piruvato chinasi: 1 catena polipeptidica organizzata in 3 domini

7 STRUTTURA QUATERNARIA Presente in proteine costituite da 2 o più subunità, quindi da 2 o + catene polipetidiche. Le subunità (o monomeri) possono essere identiche o diverse I monomeri si associano nelle superfici di contatto per mezzo di Interazioni idrofobiche, Forze elettrostatiche, legami idrogeno, ponti disolfuro

8 Emoglobina Chaperonina

9 DENATURAZIONE DI UNA PROTEINA è la perdita della struttura tridimensionale che si accompagna anche alla perdita della funzione della proteina. Può essere reversibile. AGENTI DENATURANTI: -CALORE (agisce sui legami idrogeno) -ph ESTREMI (agiscono sulle interazioni ioniche e legami idrogeno) -SOLVENTI o SOLUTI ORGANICI (es. alcooli, acetone, urea, cloruro di guanidinia) - (agiscono su interazioni idrofobiche) -DETERGENTI (es. SDS) - (agiscono su interazioni idrofobiche) -AGENTI RIDUCENTI (β-mercaptoetanolo, ditiotreitolo) (agiscono sui ponti disolfuro) Aggiunta di urea e mercaptoetanolo Rimozione di urea e mercaptoetanolo Ribonucleasi A nativa, cataliticamente attiva Ribonucleasi A denaturata e cataliticamente inattiva Ribonucleasi A rinaturata con i ponti disolfuro riformati correttamente, cataliticamente attiva

10 Modificazioni delle proteine POST-TRASLAZIONALI = avvengono dopo la sintesi proteica COTRASLAZIONALI = avvengono durante la sintesi proteica Le proteine nella loro forma matura o per essere attivate nella loro funzionalità spesso subiscono delle modificazioni che comprendono una serie di trasformazioni chimiche della catena polipeptidica e sono mediate generalmente (ma non sempre!) da enzimi specifici. Sono numerose e interessano determinati residui amminoacidici che si trovano all interno di specifiche sequenze consenso o in particolari motivi strutturali. Tali modificazioni possono essere di natura covalente (ponti disolfuro, Acetilazione, Ossidazioni, Fosforilazioni, Tagli proteolitici, Glicosilazioni..) o non covalente (coniugazioni con metalli o gruppi prostetici attraverso interazioni polari o idrofobiche)

11 fosforilazione su serina Acetilazione sull N-terminale NH- C- CH3 O Anche i residui di Thr e Tyr possono essere fosforilati COO -

12 A B Taglio del peptide segnale: si ottiene la Proinsulina in cui le due porzioni N-terminale (sequenza B) e C-terminale (sequenza A) sono legate da 2 ponti disolfuro Taglio proteolitico che rimuove la sequenza di connessione interna: si ottengono due peptidi A e B tenuti insieme dai 2 ponti disolfuro >>> INSULINA MATURA

13 GLICOPROTEINE La glicosilazione è la più comune forma di modificazione subita dalle proteine e può essere co-traduzionale (N-glicoproteine) o post-traduzionale (O-glico-proteine). Le glicoproteine svolgono importanti funzioni biologiche in svariati processi cellulari: riconoscimento recettoriale e immunologico, trasporto transmembrana di proteine, infiammazione, patogenicità, metastasi

14 2) 1) L attacco degli zuccheri avviene attraverso un legame N-glicosidico oppure O-glicosidico. Proteine N-glicosilate gli zuccheri sono legati ad un residuo di asparagina (Asn). Legame β-n-glicosidico Proteine O-glicosilate gli zuccheri sono generalmente legati ad un residuo di serina (Ser) o treonina (Thr). Legame β-o-glicosidico N H N O Asn - X - Ser/Thr Ser/Thr 3) Nelle proteine N-glicosilate il primo zucchero è sempre N-Acetilglucosamina (NAcGlc) Nelle proteine O-glicosilate il primo zucchero è frequentemente l N-Acetilgalattosamina (NAcGal), ma potrebbe essere anche N-Acetilglucosamina, fucosio, mannosio, galattosio o xilosio.

15 Tutti gli N-glicani hanno lo stesso core pentasaccaridico costituito da 2 N-acetilglucosammine e 3 mannosi, su 2 di questi mannosi sono caricati due rami di composizione variabile. Fuc Fuc ramo 1 ramo 2 Gal Gal NAcGlc NAcGlc Man Man Man NAcGlc Core pentasaccaridico NAcGlc --- Asn---

16 A seconda del numero di siti di glicosilazione e del tipo di glicano presente su ogni sito si possono ottenere tante glicoforme diverse della stessa Glycoprotein structure determination by mass spectrometry. Science 291, 2351 (2001); Dell A. and Morris H.R.

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Chaperonina. Emoglobina

Chaperonina. Emoglobina STRUTTURA QUATERNARIA Presente in proteine costituite da 2 o più subunità, quindi da 2 o + catene poipetidiche. Le subunità (o monomeri) possono essere identiche o diverse I monomeri si associano nee superfici

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

FUNZIONI delle MODIFICAZIONI delle proteine per GLICOSILAZIONE

FUNZIONI delle MODIFICAZIONI delle proteine per GLICOSILAZIONE FUNZIONI delle MODIFICAZIONI delle proteine per GLICOSILAZIONE - Specificare la struttura tridimensionale: La glicosilazione permette alla proteina di assumere conformazioni tridimensionali complesse.

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008. Eloise Mastrangelo

Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008. Eloise Mastrangelo Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008 Eloise Mastrangelo Perché è importante determinare la struttura primaria delle proteine? 1. La conoscenza della sequenza amminoacidica delle

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a:

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: filmato Rimanere nel citoplasma Essere trasportate dal citoplasma al nucleo Essere

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

COMPARTIMENTI INTRACELLULARI

COMPARTIMENTI INTRACELLULARI COMPARTIMENTI INTRACELLULARI ogni organello è delimitato da una, o due membrane: ciascuna di esse è costituita da un doppio strato fosfolipidico con stessa struttura della membrana plasmatica ma composizione

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

Struttura e funzione delle proteine

Struttura e funzione delle proteine Proteine Struttura e funzione delle proteine Le cellule viventi contengono un corredo estremamente diversificato di molecole proteiche, ciascuna costituita da una catena lineare di aminoacidi uniti da

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

LIVELLI DI STRUTTURA DELLE PROTEINE

LIVELLI DI STRUTTURA DELLE PROTEINE FUNZIONI E STRUTTURA DELLE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 LIVELLI

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE)

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE) REGOLAZIONE DELL ATTIVITA ENZIMATICA - Regolazione a lungo termine: la quantità di enzima può essere controllata regolando la velocità della sua sintesi o degradazione (minuti o ore) - Regolazione a breve

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE:

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE: LEZIONE 2 COMPONENTI CHIMICI DELLA CELLULA ACQUA COMPOSTI DEL CARBONIO: MACROMOLECOLE: ZUCCHERI ACIDI GRASSI PROTEINE NUCLEOTIDI percentuale di abbondanza relativa I componenti chimici di una cellula organismi

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello.

LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello. LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello.il modello a mosaico fluido descrive la struttura comune a tutte

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

Regolazione enzimatica Isoenzimi

Regolazione enzimatica Isoenzimi Regolazione enzimatica Isoenzimi Gli enzimi regolatori nel metabolismo gruppi di enzimi lavorano insieme per produrre una via metabolica in cui il prodotto del primo enzima diventa il substrato del secondo

Dettagli

Quando la sfingosina è legata ad 1 ac. grasso si forma il CERAMMIDE.

Quando la sfingosina è legata ad 1 ac. grasso si forma il CERAMMIDE. SFINGOLIPIDI (costituenti delle membrane biologiche) Lo scheletro degli sfingolipidi è la SFINGOSINA (amminoalcol) con una lunga catena idrocarburica monoinsatura che parte dal C-3, gruppi OH legati in

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

FARMACODINAMICA. La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci.

FARMACODINAMICA. La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci. FARMACODINAMICA La farmacodinamica studia gli effetti biochimici e il meccanismo d azione dei farmaci. La farmacodinamica si propone di: * identificare i siti d azione dei farmaci * delineare le interazioni

Dettagli

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica combustibili intermedi metabolici Impalcatura del DNA e RNA

Dettagli

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE Nell ultima fase della sintesi proteica la catena polipeptidica neosintetizzata assume spontaneamente la sua conformazione nativa (massimo numero di legami

Dettagli

Le proteine che legano l ossigenol

Le proteine che legano l ossigenol Le proteine che legano l ossigenol Protoporfirina IX EME (Fe-protoporfirina IX) L atomo di ferro del gruppo eme può formare sei legami Struttura della mioglobina di capodoglio (J. Kendrew, anni 50)

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

Folding delle Proteine

Folding delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Folding delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 11 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari, e lavorano in condizioni blande di temperatura e ph (sono in grado di aumentare la velocità delle

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

06_citologia_SER_golgi 1

06_citologia_SER_golgi 1 1 La sintesi proteica inizia sempre nello stesso modo: aggancio della piccola subunità ribosomale al estremità 5 dell mrna. si aggancio la grande subunità ribosomale In corrispondenza del codone di inizio

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

INIZIO DELLA TRADUZIONE. Proteine citoplasmatiche (ed anche nucleari,mitocondriali ecc. Proteine integrali di membrana. Proteine di secrezione

INIZIO DELLA TRADUZIONE. Proteine citoplasmatiche (ed anche nucleari,mitocondriali ecc. Proteine integrali di membrana. Proteine di secrezione INIZIO DELLA TRADUZIONE Proteine citoplasmatiche (ed anche nucleari,mitocondriali ecc. Proteine integrali di membrana Proteine di secrezione RER MITOCONDRI / CLOROPLASTI proteine di secrezione PROTEINE

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Composizione della sostanza azotata del latte vaccino (% rel)

Composizione della sostanza azotata del latte vaccino (% rel) Composizione della sostanza azotata del latte vaccino (% rel) s1 29-35 Caseine s2 8-10 35-40 78 10-15 Materia Azotata Proteica ( ) lattoglobulina 4-8 8-9 94-95 Materia Azotata Totale (N*6,38) Proteine

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE Principi basilari: 1.Le funzioni di molte proteine richiedono il legame reversibile con altre molecole (LIGANDO) Un ligando può essere di natura diversa,

Dettagli