Parametri dell α-elica. residui/giro 3.6. passo dell elica

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Parametri dell α-elica. residui/giro 3.6. passo dell elica"

Transcript

1 GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1

2 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica tra gruppi R carichi (Asp, Glu, Lys, Arg) vicinanza tra Asn, Ser, Thr, Lys presenza di Val, Thr, Ile presenza di Pro e Gly La Gly interrompe l α-elica perché è piccola e dotata di elevata flessibilità. Pro è incompatibile con l α-elica perché, essendo un iminoacido ciclico - ha l angolo φ fisso - il legame carboimidico non ha l H per generare il legame H 2

3 Gly e Pro sono frequentemente presenti nei β-turns, ripiegamenti della catena, che ne consentono l inversione della direzione. I β-turns - avvengono sia in tratti di α-elica che di β-struttura - comprendono 4 residui: il residuo n forma un legame H con l n+3 Gly, piccola e flessibile, occupa in genere la terza posizione Pro assume facilmente la configurazione cis adattandosi bene ad uno stretto cambio di direzione 3

4 La β-struttura (o foglietto β) è caratterizzata da catene completamente distese che possono presentare lo stesso o opposti orientamenti. La β-struttura è stabilizzata da legami H intercatena perpendicolari alle stesse catene. I gruppi R sporgono al di fuori della struttura alternativamente da una parte e dall altra. 4

5 Proteine fibrose - α-cheratine (α-elica) - fibroina della seta (β-struttura) - collageno (tripla elica) Le α-cheratine sono ricche di residui di Cys che formano ponti disolfuro con le catene adiacenti. Il numero dei ponti S-S ne determina la durezza o la flessibilità (pelle, capelli, unghie). 5

6 Una tipica proteina fibrosa che forma foglietti-β antiparalleli è la fibroina della seta, ricca di residui di Ala e Gly. 6

7 STRUTTURA TERZIARIA Si riferisce all arrangiamento spaziale di una catena polipeptidica a formare la struttura compatta delle proteine globulari. L effetto idrofobico guida l avvolgimento della catena in modo tale che: - i gruppi R idrofobici si trovino all interno - i gruppi R polari si trovino sulla superficie 7

8 La struttura terziaria è stabilizzata da interazioni tra i gruppi R appartenenti ad aa anche molto distanti nella sequenza lineare: -Legami H - Legami ionici - Interazioni idrofobiche - Forze di van der Waals - Ponti disolfuro (gli unici covalenti, non sempre presenti) La stabilità della conformazione di una proteina è dovuta alla cooperazione di un grandissimo numero di legami deboli 8

9 Proteine globulari contengono % variabili di α-elica e β-struttura Il resto dei residui è: - non regolarmente strutturato (coils) - presente nei β-turns (loops) 9

10 Può esistere una gerarchia nell organizzazione della struttura terziaria Elementi di struttura secondaria si organizzano in strutture supersecondarie (o motivi strutturali). Più motivi strutturali possono dar luogo a due o più unità globulari compatte, dette domini, che conferiscono un aspetto bi- o multilobato. Ciascun dominio mantiene la struttura e la funzione anche quando viene separato dalla proteina. 10

11 Un esempio di dominio è il cosiddetto ripiegamento di Rossman, presente in numerose deidrogenasi, caratterizzato da un motivo β-α-β-α-β, che ha il compito di legare il NAD +. La sequenza determina la conformazione e quindi la funzione. La forma nativa, funzionale, corrisponde alla conformazione termodinamicamente più stabile, cioè a minor contenuto di energia libera. 11

12 Esperimento di Anfinsen RNasi nativa RNasi denaturata (gomitolo casuale o random coil) In seguito alla denaturazione la RNasi perde completamente la sua attività enzimatica. Procedendo opportunamente è possibile rinaturare la proteina. 8 Cys 4 ponti disolfuro possibili 105 combinazioni: 104 non sono attive una sola è attiva ( strapazzate ) La rinaturazione è possibile ed è guidata dalla struttura primaria. 12

13 Se il folding di una catena polipeptidica neosintetizzata si svolgesse secondo il principio del tentativo ed errore, sarebbe necessario un tempo infinitamente lungo (miliardi di anni) per avere la proteina nativa. Il folding dura invece di norma un tempo inferiore al secondo: ciò indica che la transizione è un processo fortemente cooperativo. Modelli di folding delle proteine Modello gerarchico Si formano prima piccoli tratti di struttura secondaria che facilitano ed accelerano la produzione di elementi via via più grandi che cooperano fino ad arrivare alla forma nativa. 13

14 Modello del collasso idrofobico Si forma innanzitutto una struttura compatta (molten globule), guidata dall effetto idrofobico; dopo di che la proteina si cerca la sua corretta e definitiva struttura. Il folding è facilitato e reso più rapido dalla presenza di chaperons molecolari. Tra essi: le Heat Shock Proteins, Hsp70 e Hsp60. Le Hsp70 si legano ai segmenti idrofobici di proteine nascenti, proteggendole da un aggregazione aspecifica. A traduzione ultimata entrano in azione le Hsp60 (o chaperonine) che proteggono con il loro complesso a forma di botte la proteina da contatti con altre proteine, facilitando così la transizione nella giusta conformazione. 14

15 Patologie da misfolding proteico Il morbo di Alzheimer e la malattia di Creutzfeldt- Jacob sono malattie neurodegenerative, alla base delle quali vi è una anomala transizione Ciò comporta che proteine normali, solubili, precipitano in aggregati fibrillari, insolubili (placche amiloidi). Morbo di Alzheimer Da una proteina cerebrale transmembrana deriva il cosiddetto peptide β-amiloide, che si aggrega a formare depositi di foglietti-β (placche β-amiloidi). 15

16 - Malattia di Creutzfeldt-Jacob - BSE (morbo della mucca pazza) sono anche dette encefalopatie spongiformi per la presenza di numerose lacune che conferiscono al cervello un aspetto spugnoso. 16

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Folding delle Proteine

Folding delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Folding delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto. campo di ricerca chimico-fisica

MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto. campo di ricerca chimico-fisica MATERIA CONDENSATA SOFFICE Materia Condensata Soffice: un moderno e vasto Un moderno e vasto campo di Ricerca Chimico-Fisica campo di ricerca chimico-fisica D. Gazzillo, A. Giacometti, e R. Fantoni Workshop

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

20/12/ tipi di amino acidi: parecchie combinazioni

20/12/ tipi di amino acidi: parecchie combinazioni 20 tipi di amino acidi: parecchie combinazioni Le proteine sono polimeri di amino acidi 1 SEMPLICI : costituite solo da amino acidi PROTEINE CONIUGATE Apoproteina = parte proteica Gruppo prostetico = parte

Dettagli

LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding)

LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding) LEZIONE DEL 21/03/2017 Struttura terziaria: foglietti β, α-eliche uniti tra loro - la proteina acquisisce la onformazione privilegiata (il falding) Una s. terziaria mi dà le percentuali di: - random coil

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Università degli Studi di Napoli Federico II

Università degli Studi di Napoli Federico II Università degli Studi di Napoli Federico II Facoltà di Farmacia Corso di Laurea in Chimica e Tecnologie Farmaceutiche Tesi sperimentale in Chimica Fisica "Caratterizzazione strutturale mediante diffrazione

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale

La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale La struttura terziaria di una proteina definisce la disposizione di tutti i suoi atomi nello spazio tridimensionale La struttura secondaria si riferisce a una speciale disposizione spaziale di residui

Dettagli

Principi di Citologia e Istologia. Prof. Pucci, La Matrice Extracellulare

Principi di Citologia e Istologia. Prof. Pucci, La Matrice Extracellulare Principi di Citologia e Istologia. Prof. Pucci, 2003 La Matrice Extracellulare La matrice extracellulare è composta da quattro classi di macromolecole Collageni Proteoglicani Elastina Glicoproteine Essa

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA

LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA LE PROTEINE SINTETIZZATE VENGONO SOTTOPOSTE AD UN CONTROLLO DI QUALITA LE PROTEINE CON STRUTTURA NON NATIVA VENGONO DEGRADATE ATTRAVERSO LA VIA UBIQUITINA- PROTEASOMA IL CONTROLLO DI QUALITA GARANTISCE

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

COMPOSIZIONE: - Semplici - Coniugate: Apolipoproteine Glicoproteine Nucleoproteine Metalloproteine Cromoproteine STRUTTURA: - Fibrose forma molecolare allungata struttura II - Globulari: forma molecolare

Dettagli

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra). Strutture secondarie (b) Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo

Dettagli

Classificazione dell Architettura Proteica

Classificazione dell Architettura Proteica Classificazione dell Architettura Proteica struttura Primaria struttura Secondaria Super-secondaria Domini struttura Terziaria: folding struttura Quaternaria Proteine globulari Il ripiegamento della catena

Dettagli

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine MFN0366-A1 (I. Perroteau) -traduzione delle proteine trna Traduzione: mrna -------> proteine mrna MFN0366-A1 (I. Perroteau) -traduzione

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a:

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: filmato Rimanere nel citoplasma Essere trasportate dal citoplasma al nucleo Essere

Dettagli