LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO"

Transcript

1 LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche AL CENTRO SI TROVA UN GRUPPO R ( CATENA LATERALE) e questo che Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO A cui sono legati UN GRUPPO CARBOSSILICO -COOH UN GRUPPO AMMINICO UN ATOMO DI H Catene idrocarburiche e gruppi funzionali diversi

2 LA STRUTTURA DELLE PROTEINE PUO ESSERE FORMATA UNA SOLA CATENA PEPETIDICA UNA PROTEINA PIU CATENE PEPETIDICHE CHE SI ATTORCIGLIANO SU SE STESSE O SI RIPIEGANO STRUTTURA PRIMARIA E LA SEQUENZA DEGLI AMMINOACIDI CHE FORMANO UNA SINGOLA CATENA PEPETIDICA LA CUI STRUTTURA VIENE DISTINTA SECONDO 4 LIVELLI STRUTTURA SECONDARIA E IL MODO IN CUI UNA CATENA PEPTIDICA SI DISPONE NELLO SPAZIO PER ESEMPIO ATTORCIGLIANDOSI A SPIRALE STRUTTURA TERZIARIA E IL RISULTATO DEL RIPIEGAMENTO DI UNA CATENA PEPTIDICA IN UNA FORMA PIU COMPLESSA STRUTTURA QUATERNARIA QUANDO PIU CATENE SI RIPIEGANO TRA LORO ASSUMENDO FORME PARTICOLARI

3 Le catene polipeptidiche possono avvolgersi lungo il proprio asse o formare interazioni tra due tratti di catena proteica struttura β

4 NEGLI AMMINOACIDI IL GRUPPO AMMINICO (BASICO) E IL GRUPPO CARBOSSILICO (ACIDO) INTERAGISCONO, FORMANDO UNO IONE DIPOLARE (ZWITTERIONE). IL PH AL QUALE L AA E SOTTO FORMA DI ZWITTERIONE SI DICE PH ISOELETTRICO (E CARATTERISTICO PER OGNI AMMINOACIDO) R PERCIO GLI AA SONO SOLUBILI IN ACQUA (PRESENZA DI GRUPPI IONICI ) MENTRE A TEMPERATURA AMBIENTE GLI AA SONO SOLIDI A CAUSA DEI LEGAMI IONICI TRA GLI IONI DIPOLARI. H C NH 3 + COO - GLI AMMINOACIDI MOSTRANO QUINDI SIA PROPRIETA ACIDE CHE BASICHE E IL PH DELLE LORO SOLUZIONI DIPENDE DALLA FORZA DEI GRUPPI NH 3+ E COO -, TUTTAVIA ALCUNI AA CONTENGONO PIU DI UN GRUPPO ACIDO O BASICO E QUINDI DA QUESTO DIPENDE IL PH DELLE LORO SOLUZIONI

5 A SECONDA DELLA NATURA R apolare (IDROFOBICO) DEL RADICALE R, GLI AMMINOACIDI SI CLASSIFICANO IN: AMMINOACIDI CON R POLARE (IDROFILICO) R APOLARE (IDROFOBICO) R CATIONICO (BASICO) R ANIONICO (ACIDO)

6 R neutro polare (IDROFILICO)

7 R CARICO ACIDO R CARICO BASICO LA PREVALENZA DI AMMINOACIDI BASICI SU QUELLI NEUTRI ED ACIDI CONFERISCE ALLA LANA UN CARATTERE BASICO E QUESTO NE DETERMINA UN ELEVATA AFFINITÀ PER I COLORANTI ACIDI

8 NELLA LANA MERINA LA SEQUENZA DEGLI AMMINOACIDI E : ALA PRO ARG CYS CYS SER VAL ARG THR GLY PRO ALA THR THR ILE CYS SER SER CYS THR SER PRO LEU CYS VAL GLY CYS ARG CYS PHE LYS ASP

9 SI POSSONO FORMARE LEGAMI INTRACATENA (TRA ATOMI DENTRO LA STESSA CATENA): LEGAMI A PONTE CISTINICI (PONTE DI SOLFURO S-S- TRA 2 UNITA DI CISTEINA LEGAMI A IDROGENO (TRA GRUPPI POLARI NON CONSECUTIVI DELLA STESSA CATENA) OPPURE SI POSSONO FORMARE LEGAMI INTERCATENA (TRA 2 CATENE PEPTIDICHE) LEGAMI INTERCATENA= FAVORISCONO LA FORMAZIONE DI ZONE CRISTALLINE LEGAMI INTRACATENA= FAVORISCONO LA FORMAZIONE DI ZONE AMORFE (PONTI AD H STABILIZZANO LA STRUTTURA ALFA ELICA DELLA CHERATINA) LEGAMI A PONTE SALINO (DI TIPO IONICO TRA RESIDUI ANIONICI COO - E CATIONICI NH 3 + LEGAMI A PONTE CISTINICI (TRA UNITA DI CISTEINA, LEGAMI COVALENTI S-S-) LEGAMI A IDROGENO (LEGAMI PIU DEBOLI)

10 LEGAMI INTERCATENA (INTER CHAIN) LEGAMI A PONTE CISTINICI (PONTE DI SOLFURO S-S- TRA 2 UNITA DI CISTEINA DI CATENE DIVERSE) LEGAMI INTRACATENA (INTRA CHAIN) LEGAMI A PONTE CISTINICI (PONTE DI SOLFURO S-S- TRA 2 UNITA DI CISTEINA CONTIGUE)

11 LA CHERATINA DELLA LANA ( E ANCHE DEI CAPELLI E DELLE UNGHIE)PRESENTA LA FORMA STRUTTURALE AD ALFA ELICA I RESIDUI AMMINOACIDICI (-R) SPORGONO ESTERNAMENTE DAL FILAMENTO SPIRALIZZATO (ELICA) MA QUANDO E SOTTOPOSTA A TENSIONE ASSUME LA FORMA A FOGLIETTO O BETA. due o più filamenti beta tendono ad affiancarsi lateralmente ed a legarsi tramite ponti a idrogeno, generando strutture estese, pieghettate, dette foglietti β

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

BIOMOLECOLE. I mattoni delle cellule.

BIOMOLECOLE. I mattoni delle cellule. BIMLECLE I mattoni delle cellule PRINCIPALI GRUPPI FUNZINALI I gruppi funzionali sono gruppi di atomi, uniti da legami covalenti, che conferiscono alla molecola di cui fanno parte un comportamento chimico

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 3 GLI AMMINOACIDI PROTEICI Le

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE:

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE: LEZIONE 2 COMPONENTI CHIMICI DELLA CELLULA ACQUA COMPOSTI DEL CARBONIO: MACROMOLECOLE: ZUCCHERI ACIDI GRASSI PROTEINE NUCLEOTIDI percentuale di abbondanza relativa I componenti chimici di una cellula organismi

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza

Dettagli

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi

Dettagli

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni Biochimica Matricole dispari 1 1^ lezione Prof. Spina LA BIOCHIMICA 15 20 miliardi di anni fa l universo comparve sotto forma di eruzioni d l f d inimmaginabili di particele subatomiche ricche di energia

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico

ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico ACIDI CARBOSSILICI ac. formico ac. acetico ac. benzoico Nomenclatura Nomenclatura acido malonico Acidi bicarbossilici a catena alifatica Proprietà fisiche I primi termini della serie sono liquidi incolori

Dettagli

6C0 2+ 6H2O + LUCE SOLARE ==(clorofilla)==> C6H12O6 + 6O2

6C0 2+ 6H2O + LUCE SOLARE ==(clorofilla)==> C6H12O6 + 6O2 Scienze - capitolo 3 1) I carboidrati sono biomolecole essenziali per gli organismi viventi perché rappresentano riserve di energia a breve termine. Essi si dividono in monosaccaridi, disaccaridi e polisaccaridi.

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Bioingegneria Elettronica I

Bioingegneria Elettronica I Bioingegneria Elettronica I Macromolecole biologiche A. Bonfiglio Composizione della cellula Acqua, ioni e piccole molecole costituiscono circa il 74% in peso di una cellula di mammifero. L acqua da sola

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 8 La chimica dell acqua 3 Sommario 1. Come si formano i legami chimici 2. I legami covalenti ionici 3. La molecola dell acqua

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

PROTIDI: LE PROTEINE E GLI AMMINOACIDI

PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel.

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel. Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276104 Fax.:+39-049-8073310 E-mail: fulvio.ursini@unipd.it Funzioni delle

Dettagli

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI Seconda Università degli Studi di Napoli DiSTABiF Anno Accademico 2016-17 Corso di Laurea Magistrale in SCIENZE DEGLI ALIMENTI E DELLA NUTRIZIONE UMANA Insegnamento di BIOCHIMICA e BIOTECNOLOGIE degli

Dettagli

biomolecole: le molecole della vita

biomolecole: le molecole della vita biomolecole: le molecole della vita La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La ellula è un organismo vivente. rganizzazione Le strutture biologiche hanno un

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE

INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La Cellula è un organismo vivente.

La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La Cellula è un organismo vivente. biomolecole La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La ellula è un organismo vivente. rganizzazione Le strutture biologiche hanno un organizzazione gerarchica

Dettagli

Rappresentano il 14-18% dell organismo umano Ci sono miliardi di differenti tipi di proteine di cui oltre solo nell uomo 10% 15%

Rappresentano il 14-18% dell organismo umano Ci sono miliardi di differenti tipi di proteine di cui oltre solo nell uomo 10% 15% Proteine Il loro nome significa che occupa il primo posto per indicare il ruolo che rivestono negli organismi Le macromolecole proteiche vanno da 50 a 500 amminoacidi. Catene più corte sono dette peptidi

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli