LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO"


1 LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche AL CENTRO SI TROVA UN GRUPPO R ( CATENA LATERALE) e questo che Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO A cui sono legati UN GRUPPO CARBOSSILICO -COOH UN GRUPPO AMMINICO UN ATOMO DI H Catene idrocarburiche e gruppi funzionali diversi


3 Le catene polipeptidiche possono avvolgersi lungo il proprio asse o formare interazioni tra due tratti di catena proteica struttura β



6 R neutro polare (IDROFILICO)







AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi


Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi


Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico


Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche


Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine



PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine



BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)


Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e


Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia



30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio


scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico


LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici



L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente


Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:


Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH


Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche


Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse


Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare


Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.


Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole


Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il


Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione


sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina


LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale


2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente


Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine


BIOMOLECOLE. I mattoni delle cellule.

BIOMOLECOLE. I mattoni delle cellule. BIMLECLE I mattoni delle cellule PRINCIPALI GRUPPI FUNZINALI I gruppi funzionali sono gruppi di atomi, uniti da legami covalenti, che conferiscono alla molecola di cui fanno parte un comportamento chimico


Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono


MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine


La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso


La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi


Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari


Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni


Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica


1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:


Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina


α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica



CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%



STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA


CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 3 GLI AMMINOACIDI PROTEICI Le


Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti


Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo


9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione


Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)


le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con


Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare





Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni






AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente



CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p


Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro


LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole


Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti


amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico



BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi


La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza


Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione


Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,



SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)


Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»


Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine


Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo


lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi


Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica


Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi


La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono


Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza



RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi


lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni Biochimica Matricole dispari 1 1^ lezione Prof. Spina LA BIOCHIMICA 15 20 miliardi di anni fa l universo comparve sotto forma di eruzioni d l f d inimmaginabili di particele subatomiche ricche di energia


Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica


MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole


Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono



STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica


ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico

ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico ACIDI CARBOSSILICI ac. formico ac. acetico ac. benzoico Nomenclatura Nomenclatura acido malonico Acidi bicarbossilici a catena alifatica Proprietà fisiche I primi termini della serie sono liquidi incolori


6C0 2+ 6H2O + LUCE SOLARE ==(clorofilla)==> C6H12O6 + 6O2

6C0 2+ 6H2O + LUCE SOLARE ==(clorofilla)==> C6H12O6 + 6O2 Scienze - capitolo 3 1) I carboidrati sono biomolecole essenziali per gli organismi viventi perché rappresentano riserve di energia a breve termine. Essi si dividono in monosaccaridi, disaccaridi e polisaccaridi.


Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j


Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame


Bioingegneria Elettronica I

Bioingegneria Elettronica I Bioingegneria Elettronica I Macromolecole biologiche A. Bonfiglio Composizione della cellula Acqua, ioni e piccole molecole costituiscono circa il 74% in peso di una cellula di mammifero. L acqua da sola


Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 8 La chimica dell acqua 3 Sommario 1. Come si formano i legami chimici 2. I legami covalenti ionici 3. La molecola dell acqua


Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari


Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole



PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente


Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.


Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle


Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel.

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel. Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276104 Fax.:+39-049-8073310 E-mail: fulvio.ursini@unipd.it Funzioni delle



BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI Seconda Università degli Studi di Napoli DiSTABiF Anno Accademico 2016-17 Corso di Laurea Magistrale in SCIENZE DEGLI ALIMENTI E DELLA NUTRIZIONE UMANA Insegnamento di BIOCHIMICA e BIOTECNOLOGIE degli


biomolecole: le molecole della vita

biomolecole: le molecole della vita biomolecole: le molecole della vita La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La ellula è un organismo vivente. rganizzazione Le strutture biologiche hanno un


Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria



INTERAZIONI INTERMOLECOLARI NELLE PROTEINE INTERAZIONI INTERMOLECOLARI NELLE PROTEINE 1 RICHIAMI DI TERMODINAMICA 2 Entalpia Entropia Energia Libera di Gibbs ENERGIA INTERNA (U) L energia interna riassume tutti i contributi cinetici e potenziali





La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La Cellula è un organismo vivente.

La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La Cellula è un organismo vivente. biomolecole La cellula, la vita, è formata da molecole. Le molecole non sono organismi viventi. La ellula è un organismo vivente. rganizzazione Le strutture biologiche hanno un organizzazione gerarchica


Rappresentano il 14-18% dell organismo umano Ci sono miliardi di differenti tipi di proteine di cui oltre solo nell uomo 10% 15%

Rappresentano il 14-18% dell organismo umano Ci sono miliardi di differenti tipi di proteine di cui oltre solo nell uomo 10% 15% Proteine Il loro nome significa che occupa il primo posto per indicare il ruolo che rivestono negli organismi Le macromolecole proteiche vanno da 50 a 500 amminoacidi. Catene più corte sono dette peptidi


Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

