Macromolecole Biologiche. La struttura secondaria (I)

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Macromolecole Biologiche. La struttura secondaria (I)"

Transcript

1 La struttura secondaria (I)

2 La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria

3 La struttura secondaria Le strutture secondarie sono disposizioni regolari della catena polipeptidica principale, che vengono classificate senza fare riferimento al tipo di catena laterale degli aminoacidi. Esse sono stabilizzate da legami idrogeno fra il gruppo aminico e il gruppo carbonilico della catena principale. La regolarità della conformazione risulta dalla regolarità della struttura atomica della catena polipeptidica, ed è evidenziata dai valori degli angoli diedri (φ, ψ) di ciascun gruppo peptidico.

4 La struttura secondaria Si distinguono fondamentalmente tre tipi di strutture secondarie: foglietto β reverse turn Circa il % degli aminoacidi delle proteine globulari assume la conformazione regolare tipica di uno dei tre tipi di struttura secondaria. I segmenti di catena polipeptidica che non sono in, foglietto β o turn, assumono la conformazione chiamata loop o random coil, struttura non ripetitiva né regolare, spesso priva di legami idrogeno tra gli aminoacidi che la compongono.

5 Eliche Se la catena polipeptidica modifica la propria conformazione esattamente della stessa quantità per ciascun aminoacido, essa assume per definizione una conformazione elicoidale. Un elica può essere specificata indicando i valori degli angoli diedri (φ, ψ), oppure può essere caratterizzata da: n, numero (non necessariamente intero) di unità peptidiche per giro di elica p (passo), la distanza per giro di cui l elica aumenta lungo il suo asse d = p/n, la distanza per unità peptidica di cui l elica aumenta lungo il suo asse. Un elica ha una sua chiralità, cioè può essere destrorsa o sinistrorsa (n positivo o negativo). Per verificarla si usa le regola della mano destra.

6 Eliche

7 L è la struttura secondaria più frequentemente adottata dalla catena polipeptidica delle proteine: circa il % degli aminoacidi delle proteine globulari di struttura tridimensionale nota assume la conformazione one ad α elica. Fu descritta per la prima volta nel 1951 da Linus Pauling e Robert Corey (California Institute of Technology), che ipotizzarono una struttura stabile ed energeticamente favorita nelle proteine, sulla base di parametri geometrici accurati per l unitl unità peptidica dedotti dall analisi analisi cristallografica di strutture di piccole molecole. La previsione di Pauling e Corey ricevette molto presto il supporto sperimentale dalla determinazione della struttura tridimensionale e della mioglobina (John Kendrew,, 1960) e dell emoglobina emoglobina (Max Perutz,, 1961), due proteine i cui elementi di struttura secondaria sono α eliche.

8 Un destrorsa è caratterizzata da: (φ, ψ) ) = (-57( 57, -47 ), corrispondenti al quadrante in basso a sinistra del plot di Ramachandran; n = 3.6 residui per giro p = 5.4 Å d = 1.5 Å Esistono anche α eliche di tipo sinistrorso (quadrante in alto a destra del plot di Ramachandran), molto rare e limitate a pochi aminoacidi. Esse sono caratterizzate da valori (φ,( ψ) ) = (+57,, +47 ) ) e da stessi valori per n e p (n negativo).

9 Un è caratterizzata da legami idrogeno fra il gruppo carbonilico dell aminoacido n e il gruppo aminico dell aminoacido n+4. Tali legami idrogeno sono forti e con una distanza N O O quasi ottimale, di 2.8 Å. C-term I gruppi NH e CO sono paralleli alla direzione (dall estremit estremità N-terminale terminale a quella C-terminale) C dell asse dell elica, elica, per cui tutti i legami idrogeno hanno la stessa direzione. Tutti i gruppi NH e CO (ogni quarto aminoacido) saranno legati da legami idrogeno, eccetto i primi 3 gruppi NH e gli ultimi 3 gruppi CO alle estremità dell elica. elica. N-term

10 Le catene laterali degli aminoacidi che appartengono ad un destrorsa sono rivolte verso l esterno l esterno e verso l estremitl estremità N-terminale dell elica. elica. In questo modo si evitano interferenze steriche con la catena polipeptidica principale e tra le catene laterali stesse. Un α elica sinistrorsa si trova molto raramente nelle proteine (solo brevi tratti di 3-55 aminoacidi) perché le catene laterali interferirebbero stericamente con la catena principale.

11 Nelle proteine globulari si trovano α eliche di varia lunghezza, da 4-54 aminoacidi fino a più di 40. In media un è lunga 12 residui, che corrispondono a 3 giri di elica e ad una lunghezza di 18 Å. L è una struttura energeticamente favorita, non solo per i legami idrogeno quasi ideali che la stabilizzano, ma anche per le interazioni di van der Waals che si realizzano fra gli atomi lungo l intero l asse dell elica. elica. Tali interazioni sono possibili per la struttura fortemente impaccata dell α elica. Un viene quindi schematizzata come un cilindro pieno al suo interno.

12 All è associato un macrodipolo. Ad ogni unità peptidica è associato un dipolo; nell questi dipoli sono tutti allineati lungo l asse dell elica. I dipoli associati a ciascuna unità peptidica si sommano e un costituita da n aminoacidi avrà un momento di dipolo complessivo pari a n 3.5 Debye.

13 Un momento di dipolo di 3.5 Debye corrisponde ad un unit unità di carica di 0.5 separata da 1.5 Å (che corrisponde proprio al parametro geometrico d dell ). L effetto effetto complessivo è un macrodipolo con parziale carica positiva e negativa rispettivamente alle estremità N- e C-terminali C dell. Il valore di questo momento di dipolo corrisponde a circa unità di carica localizzate su ciascuna estremità dell elica. elica.

14 La presenza di tale distribuzione di carica può attrarre ligandi di carica opposta. In particolare, all estremit estremità N-terminale terminale dell α elica spesso si trovano gruppi fosfato, mentre all estremit estremità C-terminale gruppi carichi positivamente, anche se più raramente. Il gruppo fosfato viene ulteriormente stabilizzato dai legami idrogeno che si possono formare con i gruppi NH liberi dell.

15 Ulteriore fonte di stabilità per l α l elica è il capping box,, prevalentemente osservato all estremit estremità N-terminale dell elica. elica. All estremit estremità N-terminale terminale dell elica elica ci sono 3 gruppi NH liberi, che non formano legami idrogeno con gruppi CO, perché non esiste un giro precedente dell elica elica che fornisca i partner necessari. In questo caso i partner necessari per formare legami idrogeno vengono v forniti ai 3 gruppi NH liberi dalle catene laterali di aminoacidi polari (Ser, Thr,, Asp, Asn) ) che, in casi favorevoli, precedono l estremitl estremità dell. Tali legami idrogeno ricorrono quindi fra un elemento della catena polipeptidica principale e uno della catena laterale.

16 La catena laterale dell aminoacido che precede l inizio l dell elica elica forma un legame idrogeno con il gruppo NH della catena principale del terzo aminoacido appartenente all elica e, analogamente, la catena laterale del terzo aminoacido dell elica elica forma un legame idrogeno con il gruppo NH della catena principale dell aminoacido che precede l inizio l dell elica. elica. In questo modo vengono soddisfatte quasi tutte le potenzialità di formare legami idrogeno degli aminoacidi che compongono le 2 estremità dell. Ulteriori partner per legami idrogeno vengono forniti per esempio da molecole d acqua. d

17 Nella parte C-terminale delle α eliche che presentano l aminoacido l glicina si osservano due motivi capping. - motivo di Schellman: : caratterizzato da un legame idrogeno fra il gruppo NH del terzo aminoacido che segue la fine dell elica elica e il gruppo CO del terzultimo aminoacido dell elica, elica, e da un altro legame idrogeno fra il gruppo NH del secondo aminoacido che segue la fine dell elica elica e il gruppo CO del penultimo aminoacido dell elica; elica; - motivo alpha-l: : caratterizzato da un legame idrogeno tra il gruppo NH del secondo aminoacido che segue la fine dell elica elica e il gruppo CO del terzultimo aminoacido dell elica. elica. In entrambi i motivi di capping il secondo aminoacido dopo la fine dell elica elica deve adottare una conformazione elicoidale sinistrorsa: ciò favorisce grandemente la presenza della Gly in questa posizione, anche se talvolta si trovano anche aminoacidi con catene laterali più lunghe.

18 Ciascuno dei 20 aminoacidi mostra una specifica propensione, o meno, per assumere conformazione in. Ala, Glu, Leu, Met: buoni iniziatori di α eliche Gly, Tyr, Ser: deboli iniziatori di α eliche Pro: merita un discorso a parte. L ultimo atomo della catena laterale è legato covalentemente all atomo N della catena principale, impedendo la formazione del legame idrogeno con il gruppo CO. La prolina si adatta bene nel primo giro dell, mentre se si trova in qualunque altra posizione nell elica di solito produce una significativa distorsione dell asse dell elica dalla linearità (circa 25 ). Tali distorsioni comunque, sono presenti nelle α eliche e non sempre necessariamente dovute alla presenza di una prolina.

19 Le α eliche possono essere sia completamente esposte al solvente o completamente sepolte nel cuore della proteina. Spesso, però, esse si trovano sulla parte esterna delle proteine,, con un lato che si affaccia sul solvente e l altro l che si affaccia verso l interno l idrofobico della proteina. Si osserva quindi la tendenza delle catene laterali a cambiare da idrofobiche a idrofiliche con una periodicità di residui.

20 Altri tipi di elica Variazioni dell, in cui la catena polipeptidica è avvolta più o meno strettamente, con legami idrogeno fra coppie di aminoacidi (n n+3) o (n n+5), sono chiamate elica 3 10 ed elica π. Entrambe queste conformazioni si trovano ai limiti della regione permessa per le strutture elicoidali destrorse nel plot di Ramachandran: Elica 3 10 : (φ, ψ) = (-49, -26 ) Elica π: (φ, ψ) = (-57, -70 ) Elica 3 10 ed elica π ricorrono poco frequentemente nelle proteine. In particolare, le eliche 3 10 possono essere presenti alle estremità delle α eliche, come segmenti molto corti (3-4 aminoacidi).

21 Altri tipi di elica

22 Elica 3 10 L elica 3 10 deve il suo nome al numero di aminoacidi per giro (3) e al numero di atomi (10) compresi fra un donatore ed un accettore di legame idrogeno. Secondo questa nomenclatura, l sarebbe un elica Le eliche 3 10 sono meno favorite delle α eliche: - gli atomi della catena principale sono troppo strettamente impaccati, portando ad interazioni di van der Waals repulsive; - i legami idrogeno non sono lineari; - i dipoli delle unità peptidiche deviano di circa 30 rispetto all asse dell elica; - la posizione delle catene laterali (allineate) porta ad interferenze steriche.

23 Elica π L elica π (o elica ) è avvolta meno strettamente dell e poiché gli atomi della catena principale lungo l asse dell elica sono lontani, non sono in contatto di van der Waals. L elica π si può schematizzare come un cilindro cavo. La cavità in corrispondenza dell asse dell elica non è però tale da consentire l entrata di molecole d acqua che potrebbero stabilizzare l elica. Ciò rende l elica π una struttura poco favorita dal punto di vista energetico ed estremamente poco diffusa nelle proteine.

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Struttura secondaria, Motivi e Domini nelle Proteine

Struttura secondaria, Motivi e Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra).

Gli angoli diedri (φ, ψ) della catena polipeptidica in conformazione foglietto β cadono nella. (quadrante in alto a sinistra). Strutture secondarie (b) Foglietto β Nello stesso anno (1951) in cui proposero l α α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo

Dettagli

Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Struttura delle Proteine

Struttura delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi.

Il legame peptidico. Il legame che ne risulta è il legame peptidico. Nelle cellule il legame viene creato nei ribosomi, catalizzato da enzimi. Il legame peptidico Il legame peptidico La polimerizzazione di AA viene raggiunta per eliminazione di una molecola d acqua tra il gruppo carbossilico di un AA e il gruppo amminico del successivo. Il legame

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame.

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Non necessariamente i due elettroni che concorrono alla formazione del legame devono provenire da entrambi gli atomi

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Modello Watson-Crick del DNA

Modello Watson-Crick del DNA Modello Watson-Crick del DNA Diffrazione raggi X (Wilkins & Franklin) Modello atomico a doppia elica (B-DNA, Watson & Crick) VMD 1 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

ESERCIZI ESERCIZI. il basso d. aumenta lungo un periodo da sinistra verso

ESERCIZI ESERCIZI. il basso d. aumenta lungo un periodo da sinistra verso ESERCIZI 1) L elettronegatività di un elemento: a è l energia che esso libera acquistando un elettrone e trasformandosi in ione negativo b è l energia necessaria per trasformarlo in ione positivo c indica

Dettagli

Macromolecole Biologiche. Metodi di simulazione

Macromolecole Biologiche. Metodi di simulazione Metodi di simulazione Dinamica molecolare Tecnica di simulazione che permette lo studio del moto e delle proprietà di un sistema di particelle. Moti localizzati (da 0.01 a 5 Å, da 10-15 a 10-1 s) - fluttuazioni

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

Interazioni non-covalenti

Interazioni non-covalenti BCP 3-4 Interazioni non-covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono

Dettagli

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti:

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti: Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto ad esempio a 83 kcal/mol

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

materiale didattico disponibile su tozzini/didattica.html

materiale didattico disponibile su  tozzini/didattica.html materiale didattico disponibile su http://homepage.sns.it/ tozzini/didattica.html Sommario Proteine Funzioni principali Legame peptidico Struttura primaria Struttura secondaria Struttura terziaria Struttura

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni I LEGAMI CIMICI In natura sono pochi gli elementi che presentano atomi allo stato libero. Gli unici elementi che sono costituiti da atomi isolati si chiamano gas nobili o inerti, formano il gruppo VIII

Dettagli

Fondamenti di chimica organica Janice Gorzynski Smith Copyright 2009 The McGraw Hill Companies srl

Fondamenti di chimica organica Janice Gorzynski Smith Copyright 2009 The McGraw Hill Companies srl Soluzioni ai problemi proposti nel libro Capitolo 1 1.1 Il numero di massa è il numero dei protoni e dei neutroni. Il numero atomico è il numero dei protoni ed è identico per tutti gli isotopi. a. Numero

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

Il Legame Chimico e la Struttura Molecolare

Il Legame Chimico e la Struttura Molecolare A.A.2016 2017 CCS-Biologia CCS-Scienze Geologiche 1 Il Legame Chimico e la Struttura Molecolare Energia di interazione di due atomi di idrogeno Cap 8. 1-7, 9, 10(a/b), 17-20, 27-28, 31-33, 37-40, 52, 93-96

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

20/12/ tipi di amino acidi: parecchie combinazioni

20/12/ tipi di amino acidi: parecchie combinazioni 20 tipi di amino acidi: parecchie combinazioni Le proteine sono polimeri di amino acidi 1 SEMPLICI : costituite solo da amino acidi PROTEINE CONIUGATE Apoproteina = parte proteica Gruppo prostetico = parte

Dettagli

PROPRIETA DEI MATERIALI

PROPRIETA DEI MATERIALI PROPRIETA DEI MATERIALI Una proprietà è la risposta di un materiale ad una sollecitazione esterna. Per i materiali solidi le proprietà possono raggrupparsi in sei differenti categorie: 1. Meccaniche 2.

Dettagli

Spettroscopia infrarossa

Spettroscopia infrarossa Spettroscopia infrarossa Utilizzata per studiare i livelli vibrazionali nelle molecole Energie in gioco: 5000-200 cm -1 (corrispondono a 2000-50000 nm), Il coefficiente di estinzione è circa di un ordine

Dettagli

ACIDI NUCLEICI Il dogma centrale della biologia

ACIDI NUCLEICI Il dogma centrale della biologia ACIDI NUCLEICI Il dogma centrale della biologia DNA RNA PROTEINE DNA POLINUCLEOTIDI NUCLEOTIDI NUCLEOSIDI ZUCCHERI ACIDO FOSFORICO BASI AZOTATE Ribosio 2 deossiribosio PURINE PIRIMIDINE Adenina Guanina

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno

Dettagli

IL LEGAME COVALENTE SECONDO LA MECCANICA ONDULATORIA L

IL LEGAME COVALENTE SECONDO LA MECCANICA ONDULATORIA L IL LEGAME COVALENTE SECONDO LA MECCANICA ONDULATORIA L elettrone è dissolto in una nube di carica, ovvero il concetto di orbitale sostituisce il di Lewis LEGAME DI VALENZA (VB) Sviluppo quantomeccanico

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli