Dimensione: px
Iniziare la visualizzazioe della pagina:




2 Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano a causa delle fluttuazioni nella distribuzione della carica elettronica di atomi adiacenti non legati tra loro. L intenisita della forza attrattiva dipende dalla relativa grandezza degli atomi e dalla loro distanza Energia di stabilizzazione: kj/mol Molte di queste interazioni intervengono in una proteina e rappresentano un significativo contributo alla sua stabilita

3 Forze deboli che influenzano la struttura delle proteine: legami idrogeno Si formano tra un atomo di idrogeno legato covalentemente ad un atomo elettronegativo e un secondo atomo elettronegativo che serve da accettore Gli atomi componenti lo scheletro peptidico formano legami idrogeno tra loro. Le catene laterali degli aminoacidi capaci di formare legami H sono di solito localizzati sulla superficie della proteina e formano questo tipo di legami con l H 2 O Energia di stabilizzazione kj/mol: dipende dalla distanza tra gli atomi elettronegativi! Sono piu forti delle forze di van der Waals

4 Forze deboli che influenzano la struttura delle proteine: interazioni elettrostatiche Possono riguardare ioni (specie che posseggono una carica discreta), dipoli permanenti (che hanno una separazione permanente tra cariche positive e negative) e dipoli indotti (che hanno una separazione temporanea tra cariche positive e negative) Possono essere attrattive (tra cariche di segno opposto) o repulsive (tra cariche dello stesso segno). Le catene laterali degli aminoacidi possono avere residui carichi positivamente o negativamente. Inoltre i residui N e C- terminali di una proteina sono ionizzati e portano una carica positiva e negativa rispettivamente Energia di stabilizzazione: 20 kj/mol La forza dell interazione elettrostatica dipende dalla natura delle specie interagenti e dalla distanza tra loro.

5 Forze deboli che influenzano la struttura delle proteine: effetto idrofobico Le variazioni di energia (calore) e di entropia sono di grande importanza nel determinare la direzione dei processi termodinamicamente favoriti ΔG=ΔH-TΔS Si formano perche la catena laterale non polare di aminoacidi preferisce ambienti non polari piuttosto che solventi polari come l H 2 O. L olio e una sostanza che non forma legami H con l H 2 O. Le molecole di H 2 O devono riarrangiare i loro legami H a formare una struttura ordinata che circonda l olio come una gabbia Questo introduce ordine nel sistema. Se la superficie all interfaccia olio-h 2 O e piccola meno ordine e introdotto nel sistema Il raggruppamento delle molecole idrofobiche in un unica goccia restituisce all ambiente delle molecole di H 2 O che diventa disordinata e contribuisce ad aumentare l entropia del sistema ( il termine ΔS diventa +) L effetto idrofobico, che minimizza le interazioni dei residui non polari con l H 2 O e quindi guidato dall aumento dell entropia dell H 2 O Le catene laterali degli aminoacidi all interno della struttura proteica sono quasi esclusivamente idrofobiche. Energia di stabilizzazione <40 kj/mol

6 Tipi di legame


8 Angoli torsionali o diedri angolo compreso tra due semipiani

9 PREMESSA Configurazione e conformazione NON sono sinonimi: le alternative configurazionali possono essere ottenute solo rompendo (e ristabilendo) i legami. Le alternative conformazionali derivano dalla libera rotazione attorno a un legame singolo

10 Definizione degli Angoli torsionali Φ, Ψ, ω e χ Angolo φi: C i-1 Ni αci C i Angolo ψi Ni αci C i Ni+1 Angolo χ1i Ni αci βci Xi Angolo ωi αci-1 C i-1 Ni αci


12 L angolo OMEGA tende ad essere planare (0 o 180 ) a causa dell effetto di risonanza del legame peptidico Trans è favorito rispetto al cis: Solo 116 (0.36%) di angoli in 154 strutture X-ray sono state trovate in conformazione cis (Stewart et al. 1990). Alcuni legami, comunque, sono tipicamente cis: Tyr-Pro (25%), Ser-Pro (11%), X-Pro (6.5%)



15 Le 20 catene laterali


17 Il legame peptidico notare la consueta conformazione trans dell ossigeno carbonilico e dell azoto aminico. Le dimensioni degli angoli sono quelle osservate tramite cristallografia a raggi x

18 Conseguenze della natura planare del legame amidico Nella catena peptidica ci sono due gradi di liberta per residuo L energia di stabilizzazione di risonanza della struttura planare e di 88 kj/mol. Una rotazione del legame C-N richiederebbe una sostanziale quantita di energia e non puo avvenire Le rotazioni possono invece avvenire sui legami che legano i C α degli aminoacidi che partecipano al legame carboamidico agli atomi dello scheletro peptidico L angolo che riguarda il legame C(alpha)- N viene chiamato Φ L angolo che riguarda il legame C(alpha)- C viene chiamato Ψ La definizione di tutti gli angoli Φ e Ψ in una catena proteica comporta la conoscenza di tutti i tipi di ripiegamento dello scheletro proteico

19 Restrizioni steriche degli angoli Φ & Ψ Le catene polipeptidiche sono flessibili ma presentano restrizioni conformazionali: la sovrapposizione sfavorevole di orbitali non permette alcune combinazioni di Φ e Ψ Alcuni valori di Φ e Ψ sono piu probabili di altri. phi = 0, psi = 180 non e favorevole phi = 180, psi = 0 non e favorevole phi = 0, psi = 0 non e favorevole



La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono


La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono


Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse


Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti


Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro


Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni


gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-


Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il


Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle


Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame.

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Non necessariamente i due elettroni che concorrono alla formazione del legame devono provenire da entrambi gli atomi


Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari


Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole


Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche


La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena



FORZE INTERMOLECOLARI FORZE INTERMOLECOLARI Le forze intermolecolari sono forze di attrazione che si stabiliscono tra le molecole che costituiscono una sostanza Determinano la tendenza delle molecole ad avvicinarsi. Per ogni



FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E


Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole Introduzione alla chimica organica 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole La chimica organica tratta di pochissimi atomi che si possono combinare in moltissimi modi Grande importanza





MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole


1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1 1. La forma delle molecole Molte proprietà delle sostanze dipendono dalla forma



FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E


Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,


Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle


scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti


ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara ATOMI E MOLECOLE Psicobiologia Lezione nr. 1 Prof. Lasaponara La struttura dell atomo I legami chimici e le molecole I componenti elementari della materia vivente 20 miliardi di anni fa Caratteristiche


1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto Unità n 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno


Capitolo 12 Le forze intermolecolari e gli stati condensati della materia

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia Capitolo 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno


Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame



30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio


Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole


IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI


scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico


Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione


L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno


I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni I LEGAMI CIMICI In natura sono pochi gli elementi che presentano atomi allo stato libero. Gli unici elementi che sono costituiti da atomi isolati si chiamano gas nobili o inerti, formano il gruppo VIII




Interazioni non-covalenti

Interazioni non-covalenti BCP 3-4 Interazioni non-covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi


Esercizi sulle Forze Intermolecolari

Esercizi sulle Forze Intermolecolari Insegnamento di Chimica Generale 083424 - CCS CHI e MAT A.A. 2015/2016 (I Semestre) Esercizi sulle Forze Intermolecolari Prof. Dipartimento CMIC Giulio Natta http://iscamap.chem.polimi.it/citterio Esercizio


Legame chimico e proprietà delle sostanze

Legame chimico e proprietà delle sostanze I solidi hanno volume e forma propria. Stati di aggregazione della materia stato solido stato liquido stato gassoso Il loro volume dipende da temperatura e pressione e in generale aumenta leggermente all


Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 15 Le forze intermolecolari e gli stati condensati della materia 3 Sommario 1. Le forze intermolecolari 2. Molecole polari e


Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame


METALLI: bassa energia di ionizzazione bassa affinità elettronica. NON METALLI: elevata energia di ionizzazione elevata affinità elettronica

METALLI: bassa energia di ionizzazione bassa affinità elettronica. NON METALLI: elevata energia di ionizzazione elevata affinità elettronica METALLI: bassa energia di ionizzazione bassa affinità elettronica NON METALLI: elevata energia di ionizzazione elevata affinità elettronica LEGAME CHIMICO La formazione di legami tra atomi per formare


Forze intermolecolari

Forze intermolecolari Forze intermolecolari Le forze intermolecolari sono forze attrattive tra molecole, tra ioni o tra ioni e molecole. In assenza di tali forze tutte le molecole sarebbero gas le molecole possono stabilire


Legame Chimico. Legame Chimico

Legame Chimico. Legame Chimico Legame Chimico Fra due atomi o gruppi di atomi esiste un legame chimico se le forze agenti tra essi danno luogo alla formazione di un aggregato di atomi sufficientemente stabile da consentire di svelarne


LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici



PROPRIETA DEI MATERIALI PROPRIETA DEI MATERIALI Una proprietà è la risposta di un materiale ad una sollecitazione esterna. Per i materiali solidi le proprietà possono raggrupparsi in sei differenti categorie: 1. Meccaniche 2.


Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica


Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi

Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi Gli organismi sono fatti da MATERIA*. (*qualsiasi cosa che occupa uno spazio e ha una massa) Gli antichi filosofi greci dicevano che la materia deriva da 4 ingredienti di base o ELEMENTI (ARIA, ACQUA,


Tensione di vapore evaporazione

Tensione di vapore evaporazione Transizioni di fase Una sostanza può esistere in tre stati fisici: solido liquido gassoso Il processo in cui una sostanza passa da uno stato fisico ad un altro è noto come transizione di fase o cambiamento


Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti:

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti: Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto ad esempio a 83 kcal/mol


20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di atomi. La formazione del legame covalente si basa


sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina


Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine


Legame covalente. H 1s un protone e un elettrone

Legame covalente. H 1s un protone e un elettrone Legame covalente H 1s un protone e un elettrone Il legame covalente è formato da una coppia di elettroni condivisa fra due atomi. L energia richiesta per separare gli atomi legati è detta energia di legame.


Per esempio, possiamo osservare il legame ionico nella molecola di cloruro di sodio. Il cloro e il sodio hanno le seguenti strutture di Lewis:

Per esempio, possiamo osservare il legame ionico nella molecola di cloruro di sodio. Il cloro e il sodio hanno le seguenti strutture di Lewis: IL LEGAME IONICO In natura solo i gas nobili presentano atomi allo stato libero. Tutte le altre sostanze consistono di molecole che sono aggregazioni di atomi. Le forze che tengono uniti gli atomi in una



CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p



IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di


Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 8 La chimica dell acqua 3 Sommario 1. Come si formano i legami chimici 2. I legami covalenti ionici 3. La molecola dell acqua





Il Legame Chimico e la Struttura Molecolare

Il Legame Chimico e la Struttura Molecolare A.A.2016 2017 CCS-Biologia CCS-Scienze Geologiche 1 Il Legame Chimico e la Struttura Molecolare Energia di interazione di due atomi di idrogeno Cap 8. 1-7, 9, 10(a/b), 17-20, 27-28, 31-33, 37-40, 52, 93-96


Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi


Elettronegatività Elettronegatività

Elettronegatività Elettronegatività Elettronegatività Nel legame covalente tra atomi uguali, la nuvola elettronica è simmetrica rispetto ai due nuclei (es. H 2, Cl 2, F 2 ) legame covalente apolare. Nel legame covalente tra atomi con Z eff


Gli elettroni della molecola sono quindi descritti da

Gli elettroni della molecola sono quindi descritti da IL LEGAME COVALENTE: TEORIA DELL ORBITALE MOLECOLARE La molecola è considerata come un insieme di nuclei ed elettroni e, attraverso la valutazione delle reciproche interazioni, la teoria dell orbitale


Chimica. Lezione 2 Parte II Composti ionici e molecolari

Chimica. Lezione 2 Parte II Composti ionici e molecolari Chimica Lezione 2 Parte II Composti ionici e molecolari Composti molecolari Gli ELEMENTI chimici (ad eccezione dei gas nobili) vivono in aggregati più o meno complessi Sono aggregati discreti (hanno un



Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Corso di BIOCHIMICA Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Materiale didattico e esercizi su: http://moodle2.units.it/ Password: BioFarma


Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione


Il legame chimico. Lezioni 17-20

Il legame chimico. Lezioni 17-20 Il legame chimico Lezioni 17-20 1 Il legame chimico Le forze attrattive di natura elettrica che tengono uniti gli atomi in molecole o in composti ionici sono dette legami chimici. Legami atomici: covalente


Modello Watson-Crick del DNA

Modello Watson-Crick del DNA Modello Watson-Crick del DNA Diffrazione raggi X (Wilkins & Franklin) Modello atomico a doppia elica (B-DNA, Watson & Crick) VMD 1 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica


Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche


Stereochimica di alcani e cicloalcani

Stereochimica di alcani e cicloalcani di alcani e cicloalcani Conformazioni, conformeri Due conformazioni dell etano. Le conformazioni sono arrangiamenti diversi di atomi che interconvertono per rotazione attorno al legame C-C. Rappresentazione


lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2


Il legame chimico ATOMI MOLECOLE

Il legame chimico ATOMI MOLECOLE Il legame chimico Gli atomi tendono a combinarsi con altri atomi per dare un sistema finale più stabile di quello iniziale (a minor contenuto di energia). ATOMI MOLECOLE 1 Stati repulsivi di non legame


Chimica Fisica Biologica

Chimica Fisica Biologica Molecola di Idrogeno [1] Rappresentazione semplificata di Lewis (doppietto di legame) H H H H Chimica Fisica Biologica Rappresentazione realistica: due elettroni attorno ai due protoni (nuclei) a distanza


LE MOLECOLE. 5.1 I legami molecolari 5.2 Le forze di Van der Walls 5.3 Il legame idrogeno 5.4 La teoria VSEPR

LE MOLECOLE. 5.1 I legami molecolari 5.2 Le forze di Van der Walls 5.3 Il legame idrogeno 5.4 La teoria VSEPR LE MOLECOLE 5.1 I legami molecolari 5.2 Le forze di Van der Walls 5.3 Il legame idrogeno 5.4 La teoria VSEPR 5.1 I legami molecolari Si ha un legame chimico quando una forza di natura elettrostatica tiene


Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale


Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico

Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico I LEGAMI CHIMICI Legami atomici o forti Legami molecolari o deboli Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico Legame dipolo-dipolo Legame idrogeno Legame


LA STRUTTURA DELLE MOLECOLE. Orbitali molecolari e legame chimico

LA STRUTTURA DELLE MOLECOLE. Orbitali molecolari e legame chimico LA STRUTTURA DELLE MOLECOLE Orbitali molecolari e legame chimico GLI ORBITALI MOLECOLARI Quando degli atomi collidono tra di loro i loro nuclei ed elettroni vengono a trovarsi in prossimità influenzandosi


Il legame peptidico è polare



Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame

Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame IL LEGAME CHIMICO Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame 1 IL LEGAME CHIMICO Il legame chimico



CAPITOLO 4 STRUTTURE MOLECOLARI APITL 4 STRUTTURE MLELARI 4.1 (a) Di seguito è mostrata la struttura di Lewis di P 3. Nella teoria VSEPR il numero di coppie di elettroni attorno all atomo centrale è fondamentale per determinare la struttura.



COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA



LEGAME COVALENTE: TEORIA DEGLI ORBITALI MOLECOLARI LEGAME COVALENTE: TEORIA DEGLI ORBITALI MOLECOLARI Il legame covalente e la geometria delle molecole possono essere descritti dalla teoria del legame di valenza: i legami risultano dalla condivisione di





I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo

I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo La polarità I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo L elettronegatività è il parametro di riferimento utilizzato per valutare il trasferimento di carica


Stereochimica di alcani e cicloalcani. Stereochimica. Conformazioni, conformeri

Stereochimica di alcani e cicloalcani. Stereochimica. Conformazioni, conformeri di alcani e cicloalcani Conformazioni, conformeri Due conformazioni dell etano. I differenti conformeri si interconvertono per rotazione attorno al legame C-C. 1 Rappresentazione a cavalletto e proiezione


Forze Intermolecolari. Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display.

Forze Intermolecolari. Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Forze Intermolecolari Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. 1 Forze Intermolecolari Le Forze Intermolecolari sono forze attrattive fra molecole. Le


1. L energia di legame. 2. I gas nobili e a regola dell ottetto. 3. Il legame covalente. 4. Il legame covalente dativo. 5. Il legame covalente polare

1. L energia di legame. 2. I gas nobili e a regola dell ottetto. 3. Il legame covalente. 4. Il legame covalente dativo. 5. Il legame covalente polare Capitolo 10 I legami chimici 1. L energia di legame 2. I gas nobili e a regola dell ottetto 3. Il legame covalente 4. Il legame covalente dativo 5. Il legame covalente polare 6. Il legame ionico 7. I composti


Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH


Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine


I LEGAMI CHIMICI. A cura della prof. C. Viscardi

I LEGAMI CHIMICI. A cura della prof. C. Viscardi I LEGAMI CIMICI A cura della prof. C. Viscardi 1 ATOMI E MOLECOLE È estremamente difficile trovare in natura una sostanza formata solamente da atomi semplici Solo i gas inerti dell ottavo gruppo sono presenti


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale


Lezione n. 22. Molecole poliatomiche Metodo VSEPR Orbitali ibridi Coniugazione π. 02/03/2008 Antonino Polimeno 1

Lezione n. 22. Molecole poliatomiche Metodo VSEPR Orbitali ibridi Coniugazione π. 02/03/2008 Antonino Polimeno 1 Chimica Fisica - Chimica e Tecnologia Farmaceutiche Lezione n. 22 Molecole poliatomiche Metodo VSEPR Orbitali ibridi Coniugazione π 02/03/2008 Antonino Polimeno 1 Molecole poliatomiche (1) - Siamo ora


Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.


12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1)

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise da coppie di atomi. Legami covalenti Importanza dei legami non covalenti in Biologia


Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:



LEGAMI INTERMOLECOLARI LEGAMI INTERMOLECOLARI I legami (o forze) intermolecolari sono le forze attrattive tra particelle: molecola - molecola, molecola - ione, ione - ione In assenza di queste interazioni tutti i composti sarebbero gassosi NB: attenzione


IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina


Atomi e molecole. Gli atomi degli elementi si trovano in natura generalmente combinati tra loro in molecole o composti ionici

Atomi e molecole. Gli atomi degli elementi si trovano in natura generalmente combinati tra loro in molecole o composti ionici IL LEGAME CHIMICO Atomi e molecole È estremamente difficile trovare in natura una sostanza formata da singoli atomi isolati Solo i gas nobili sono presenti in natura come gas monoatomici Gli atomi degli


un legame covalente due legami covalenti? tre legami covalenti due legami covalenti un legame covalente

un legame covalente due legami covalenti? tre legami covalenti due legami covalenti un legame covalente e C N un legame covalente due legami covalenti? tre legami covalenti O F Ne 1s 2s 2p due legami covalenti un legame covalente C 1s 2s 2p ibridazione quattro legami covalenti Cariche Formali Usando le strutture
