Biologia Molecolare. CDLM in CTF La riparazione del DNA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Biologia Molecolare. CDLM in CTF La riparazione del DNA"

Transcript

1 Biologia Molecolare CDLM in CTF La riparazione del DNA

2 I tipi di mutazione e le conseguenze Le classi di danno al DNA Meccanismi di riparazione

3 La necessità di codificare l informazione L informazione genica passa del DNA all RNA. L informazione contenuta in queste molecole è simile, ed il meccanismo di trasmissione dell informazione (la complementarietà delle basi) permette di copiare l informazione del DNA sull RNA utilizzando lo stesso alfabeto (con l eccezione dell utilizzo dell U al posto della T) AATGTATTC TTACATAAG AAUGUAUUC TTACATAAG Nel passaggio da RNA a proteina il tipo di informazione cambia notevolmente. Si deve passare da un alfabeto chimico basato su 4 diversi nucleotidi ad un alfabeto chimico basato su 20 diverse aminoacidi. L impossibilità di mantenere una corrispondeza univoca tra nucleotide ed aminoacido impone l utilizzo di una codifica

4 La necessità di codificare l informazione Se ci fosse una corrispondenza 1 a 1 tra nucleotide ed aminoacido si potrebbero utilizzare soltanto 4 aminoacidi per costruire una proteina. Se la corrispondenza fosse 2 ad 1 si potrebbero specificare 16 (4*4) aminoacidi. Sfortunatamente gli aminoacidi sono 20: sono quindi necessari 3 nucleotidi per identificare tutti gli aminoacidi esistenti. Le possibili combinazioni di 3 nucleotidi sono 64 (4*4*4). Poichè gli aminoacidi sono solo 20 esiste una surplus informativo di 44 triplette. La tabella n*m che mette in relazione le 64 possibili triplette di nucleotidi e i 20 aminoacidi è chiamata codice genetico. Il codice genetico è universale: una tripletta codifica lo stesso aminoacido in (quasi) tutti gli organismi viventi. Le triplette di nucleotidi sull mrna vengono chiamate CODONI

5 Il fenomeno per il quale esistono diverse triplette che codificano per lo stesso aminoacido è definito come degenerazione del codice La maggior parte degli aminoacidi è codificata da 2 o più triplette. La metionina è codificata solo dal codone AUG che rappresenta anche il codone di inizio della sintesi proteica. I codoni UGG UAA e UAG sono chiamati codoni di STOP. Ad essi con corrisponde nessun aminoacido ma rappresentano i segnali di terminazione per la sintesi proteica. F I R S T B A S E U C A G CUU CUC CUA CUG GUU GUC GUA GUG U UUU Phe UUC UUA UUG Leu S E C O N D B A S E Leu AUU AUC AUA AUG Met/ Ile Val start C UCU UCC UCA UCG CCU CCC CCA CCG ACU ACC ACA ACG GCU GCC GCA GCG Ser Pro Thr Ala UAU UAC UAA UAG CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG A Tyr Stop His Gln Asn Lys Asp Glu CGU CGC CGA CGG G UGU UGC UGA UGG AGU Ser AGC AGA AGG Arg GGU GGC GGA GGG Cys Stop Trp Arg Gly* U C A G U C A G U C A G U C A G T H I R D B A S E

6 Le conseguenze della degenerazione del codice E sempre possibile passare dall informazione contenuta nei nucleotidi alla corrispondente sequenza proteica: ad ogni tripletta può essere associato uno ed un solo aminoacido. Non è mai possibile ottenere, in modo univoco, una sequenza nucleotidica a partire dalla sequenza proteica da essa generata Sequenza proteica MEFGLKEFLLNPSTPEGKLTPQRQTNPVWYACAWA AUG GAG GAA UUU UUC GGA GGC GGG La retrotraduzione non è risolvibile in maniera esatta e non può essere dai sistemi biologici. GGU

7 Le mutazioni sono importanti come fonte di variabilità genetica Le mutazioni possono avere conseguenze deleterie o vantaggiose Gli organismi mutanti sono strumenti per la biologia molecolare e per le biotecnologie

8

9 Transizioni (mutazioni puntiformi) TC o CT pirimidina-pirimidina AG o GA putina-purina Trasvezione TA, TG, CA,CG pirimidina-purina AT, AC,GT,GC purina-pirimidina Rapporto transizioni/trasvezioni 2:1

10

11 I tipi di mutazione e le conseguenze Le classi di danno al DNA Meccanismi di riparazione

12 Si appaia con Timina A al posto della G Si appaia con Adenina T al posto della G (cancro)

13

14 Siti abasici Rotture del DNA a doppio filamento Generate da intermedi instabili e reattivi Indotte da radiazioni ionizzanti e da un ampia gamma di sostanze chimiche

15 I tipi di mutazione e le conseguenze Le classi di danno al DNA Meccanismi di riparazione

16 Polimerasi ad alta fedeltà e polimerasi inclini all errore

17

18

19

20

21

LE AUGURO BUON LAVORO!

LE AUGURO BUON LAVORO! Nome:. Cognome:...... Pt./137 Nota ESAME DI SCIENZE SPERIMENTALI: BIOLOGIA Indicazioni: 1. Risponda sempre negli spazi indicati; non separi né scriva sul retro dei fogli. 2. Scriva, o, laddove richiesto,

Dettagli

La sintesi delle proteine

La sintesi delle proteine La sintesi delle proteine Struttura del trna In che modo l informazione contenuta sotto forma di sequenze nucleotidiche nel DNA e nell RNA si traduce nella sequenza amminoacidica delle proteine? Esperimenti

Dettagli

Produzione di proteine eterologhe. Cosa occorre per l espressione l livello di una proteina nella cellula? Trascrizione/traduzione/stabilità

Produzione di proteine eterologhe. Cosa occorre per l espressione l livello di una proteina nella cellula? Trascrizione/traduzione/stabilità Cosa occorre per l espressione l ad alto livello di una proteina nella cellula? Trascrizione/traduzione/stabilità Promotore forte (trascrizione) Presenza di segnali per il riconoscimento dell mrna da parte

Dettagli

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione rof. Giorgio Sartor Sintesi proteica Copyright 2001-2013 by Giorgio Sartor. All rights reserved. B15 -Versione 1.0 nov2013 Trasmissione dell informazione L informazione è contenuta nel DA ed è trasferita

Dettagli

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi Sommario Introduzione Cenni di biologia Modello di Adleman Modello

Dettagli

Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle

Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi Il

Dettagli

Alcune domande di carattere evolutivo

Alcune domande di carattere evolutivo Alcune domande di carattere evolutivo 1. Perché tutti gli organismi viventi (a parte le solite, rare, eccezioni usano lo stesso insieme di 20 aminoacidi? Interrelazioni tra organismi 2. Perché gli amino

Dettagli

esperto prof. Ciro Formica

esperto prof. Ciro Formica esperto prof. Ciro Formica Immagini e testi tratti dai website di: genome.wellcome.ac.uk, dnaftb.org, unipv.it, unimi.it, wikipedia.it, unibs.it, unisi.it, unina.it, uniroma2.it, nih.gov, zanichelli.it,

Dettagli

L mrna ED IL CODICE GENETICO

L mrna ED IL CODICE GENETICO L mrna ED IL CODICE GENETICO LA SEQ. NUCLEOTIDICA DI UN GENE, PER MEZZO DELL mrna, E TRADOTTA NELLA SEQ. AMINOACIDICA DI UN PEPTIDE SEGUENDO REGOLE NOTE COME CODICE GENETICO. LA SUCCESSIONE CONSECUTIVA

Dettagli

TRADUZIONE. 2. Transfer (legato agli aminoacidi) 3. Ribosomale (associato a proteine nei ribosomi)

TRADUZIONE. 2. Transfer (legato agli aminoacidi) 3. Ribosomale (associato a proteine nei ribosomi) enhancer promotore regione trascritta TATA trascrizione 5 3 splicing mrna 5 3 traduzione Proteina NH2 COOH Funzione biologica TRADUZIONE I tre ruoli svolti dall RNA: 1. Messaggero 2. Transfer (legato agli

Dettagli

Il Codice Gene,co. Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del DNA

Il Codice Gene,co. Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del DNA Corso di Laurea in Chimica e Tecnologie Farmaceu,che a.a. 2014-2015 Università di Catania Il Codice Gene,co Il dogma centrale, il flusso dell informazione genica e la decifrazione della informazione del

Dettagli

Trascrizione e maturazione degli RNA

Trascrizione e maturazione degli RNA Trascrizione e maturazione degli RNA L RNA è sisntetizzato a partire dal DNA nel processo della trascrizione L RNA veicola l informazione genica contenuta nel DNA (nucleo) in modo che possa esprimersi

Dettagli

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE?

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE? DNA E PROTEINE NUMEROSI DATI SUGGERISCONO CHE IL DNA SVOLGA IL SUO RUOLO GENETICO CONTROLLANDO LA SINTESI DELLE PROTEINE, IN PARTICOLARE DETERMINANDONE LA SEQUENZA IN AMINOACIDI E NECESSARIO RISPONDERE

Dettagli

Sintesi e degradazione delle proteine

Sintesi e degradazione delle proteine Prof. Giorgio Sartor Sintesi e degradazione delle proteine Copyright 2001- by Giorgio Sartor. All rights reserved. B15 - Versione 1.4.1 may Trasmissione dell informazione L informazione è contenuta nel

Dettagli

Lezione 1. Le molecole di base che costituiscono la vita

Lezione 1. Le molecole di base che costituiscono la vita Lezione 1 Le molecole di base che costituiscono la vita Le molecole dell ereditarietà 5 3 L informazione ereditaria di tutti gli organismi viventi, con l eccezione di alcuni virus, è a carico della molecola

Dettagli

Dal gene alla proteina

Dal gene alla proteina Dal gene alla proteina Il collegamento tra geni e proteine La trascrizione e la traduzione sono i due principali processi che legano il gene alla proteina: uno sguardo panoramico Le informazioni genetiche

Dettagli

Trascrizione e maturazione degli RNA

Trascrizione e maturazione degli RNA Trascrizione e maturazione degli RNA Trascrizione e traduzione: espressione dell informazione genica L RNA veicola l informazione genica contenuta nel DNA (nucleo) in modo che possa esprimersi per dare

Dettagli

L mrna ED IL CODICE GENETICO

L mrna ED IL CODICE GENETICO L mrna ED IL CODICE GENETICO LA SEQ. NUCLEOTIDICA DI UN GENE, PER MEZZO DELL mrna, E TRADOTTA NELLA SEQ. AMINOACIDICA DI UN PEPTIDE SEGUENDO REGOLE NOTE COME CODICE GENETICO. LA SUCCESSIONE CONSECUTIVA

Dettagli

Sintesi e degradazione delle proteine

Sintesi e degradazione delle proteine Prof. Giorgio Sartor Sintesi e degradazione delle proteine Copyright 2001-2012 by Giorgio Sartor. All rights reserved. B15 - Versione 1.4.2 may 2012 Trasmissione dell informazione L informazione è contenuta

Dettagli

Il Codice Genetico. La decodifica della sequenza nucleotidica in. sequenza aminoacidica

Il Codice Genetico. La decodifica della sequenza nucleotidica in. sequenza aminoacidica Il Codice Genetico La decodifica della sequenza nucleotidica in sequenza aminoacidica La sequenza del mrna viene letta a gruppi di 3 nucleotidi, senza interruzioni e senza sovrapposizioni; 4 3 = 64 ---------64

Dettagli

C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP.

C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP. Soluzioni ai problemi del Capitolo 13 Domande concettuali C1. Il codone di inizio parte dal quinto nucleotide. La sequenza aminoacidica sarà Met Gly Asn Lys Pro Gly Gln STOP. C2. Quando si dice che il

Dettagli

Corso di. Proteomica e bioinformatica. modulo: Biochimica delle proteine

Corso di. Proteomica e bioinformatica. modulo: Biochimica delle proteine Corso di Proteomica e bioinformatica modulo: Biochimica delle proteine Dott. Stefano Toppo Dipartimento di Chimica Biologica (Vallisneri piano terra stanza 85) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276958

Dettagli

all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA

all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA Il Codice Genetico The genetic code consists of 64 triplet codons (A, G, C, U) 4 3 = 64 all codons are used in protein synthesis 20 amino acids 3 termination (stop) codons: UAA, UAG, UGA AUG (methionine)

Dettagli

I SEGRETI DEGLI ALBERI. Harmonia plantarum

I SEGRETI DEGLI ALBERI. Harmonia plantarum Dott.ssa Monica Francesca Veronese biologa I SEGRETI DEGLI ALBERI Harmonia plantarum Mirano 24.05.2013 Omero Pitture vascolari Anfore Attiche Ovidio Lucrezio Hans Kayser

Dettagli

Allineamento dei 2 RNA

Allineamento dei 2 RNA La traduzione 2 codone Allineamento dei 2 RNA anticodone Studi Molecolari hanno dimostrato che: 3 residui nucleotidici del mrna sono necessari per codificare ciascun amminoacido Il linguaggio contenuto

Dettagli

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine)

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine) TRADUZIONE I RIBOSOMI I Ribosomi hanno un diametro di circa 15-30 nm, sono costituiti da proteine ed rrna e sia nei Procarioti che negli Eucarioti, sono costituiti da una subunità maggiore e da una subunità

Dettagli

INTERAZIONE TRA mrna, trna e RIBOSOMI

INTERAZIONE TRA mrna, trna e RIBOSOMI INTERAZIONE TRA mrna, trna e RIBOSOMI mrna: porta l'informazione della sequenza degli aminoacidi di una determinata proteina. trna: ogni trna è specifico per il trasporto di un determinato aminoacido Ribosoma:

Dettagli

Codice Genetico (segue)

Codice Genetico (segue) CODICE GENETICO Nucleotidi, acidi nucleici CODICE GENETICO Codice mediante il quale la sequenza nucleotidica di una molecola di DNA o di RNA specifica la sequenza amminoacidica di un polipeptide. Consiste

Dettagli

IPOTESI UN GENE-UN ENZIMA

IPOTESI UN GENE-UN ENZIMA IPOTESI UN GENE-UN ENZIMA DNA: contiene tutte le informazioni per definire lo sviluppo e la fisiologia della cellula: ma come svolge questa funzione? Beadle e Tatum (1941): studiando mutanti della comune

Dettagli

LA SINTESI PROTEICA LE MOLECOLE CHE INTERVENGONO IN TALE PROCESSO SONO:

LA SINTESI PROTEICA LE MOLECOLE CHE INTERVENGONO IN TALE PROCESSO SONO: LA SINTESI PROTEICA La sintesi proteica è il processo che porta alla formazione delle proteine utilizzando le informazioni contenute nel DNA. Nelle sue linee fondamentali questo processo è identico in

Dettagli

IL FLUSSO DELL INFORMAZIONE GENETICA. DNA à RNA. RNA à PROTEINA. DNA à RNA à PROTEINA. Dogma centrale della biologia molecolare di Francis Crick, 1957

IL FLUSSO DELL INFORMAZIONE GENETICA. DNA à RNA. RNA à PROTEINA. DNA à RNA à PROTEINA. Dogma centrale della biologia molecolare di Francis Crick, 1957 IL FLUSSO DELL INFORMAZIONE GENETICA DNA à RNA à PROTEINA Dogma centrale della biologia molecolare di Francis Crick, 1957 DNA/RNA (seq polinucleotidica) DNA à RNA mrna trna rrna RNA à PROTEINA Proteina

Dettagli

La traduzione avviene nella cellula in strutture chiamate ribosomi

La traduzione avviene nella cellula in strutture chiamate ribosomi La traduzione avviene nella cellula in strutture chiamate ribosomi L informazione genetica viene scritta sotto forma di codoni e tradotta in sequenze di amminoacidi Le «parole» del linguaggio chimico del

Dettagli

07/01/2015. Come si ferma una macchina in corsa? Il terminatore. Terminazione intrinseca (rho-indipendente)

07/01/2015. Come si ferma una macchina in corsa? Il terminatore. Terminazione intrinseca (rho-indipendente) Come si ferma una macchina in corsa? Il terminatore Terminazione intrinseca (rho-indipendente) Terminazione dipendente dal fattore Rho (r) 1 Operoni: gruppi di geni parte di una unica unità trascrizionale

Dettagli

Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina

Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina sintesi proteica La sintesi proteica è il processo che porta alla formazione delle proteine da sequenze del DN definite geni. Si tratta di un processo a più fasi Nelle sue linee fondamentali questo processo

Dettagli

Codoni di STOP: UAA UAG UGA

Codoni di STOP: UAA UAG UGA PARTECIPANO ALLA TRADUZIONE: trna e aminoacidi Aminoacil-tRNA sintetasi Ribosomi mrna, che contiene una Open Reading Frame (ORF) CODONE DI INIZIO CODONE DI STOP 5 Cap NNNNNN AUG AAA GCA AUU----(n codoni)----uga

Dettagli

1) Un gene-un enzima 2) Un gene- una catena polipeptidica

1) Un gene-un enzima 2) Un gene- una catena polipeptidica 1) Un gene-un enzima 2) Un gene- una catena polipeptidica 3) Un gene è una unità funzionale di DNA che codifica per la sequenza amminoacidica di uno o più polipeptidi o alternativamente per uno o più tipi

Dettagli

Struttura ed espressione del Gene

Struttura ed espressione del Gene Struttura ed espressione del Gene PowerPoint Lectures for Essential Biology, Third Edition Neil Campbell, Jane Reece, and Eric Simon Essential Biology with Physiology, Second Edition Neil Campbell, Jane

Dettagli

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi Il DNA Il DNA è una sostanza che si trova in ogni cellula e contiene tutte le informazioni sulla forma e sulle funzioni di ogni essere vivente: eppure è una molecola incredibilmente semplice. COME È FATTO?

Dettagli

La mutazione. Cambiamento ereditario, raro, casuale ed improvviso che provoca una alterazione qualitativa e/o quantitativa dell informazione genetica

La mutazione. Cambiamento ereditario, raro, casuale ed improvviso che provoca una alterazione qualitativa e/o quantitativa dell informazione genetica La mutazione Cambiamento ereditario, raro, casuale ed improvviso che provoca una alterazione qualitativa e/o quantitativa dell informazione genetica La mutazione 1. Crea variabilità sulla quale agisce

Dettagli

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto

Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto Bioinformatica: Allineamento di Sequenze di Aminoacidi di Bandiera Roberto La Bioinformatica è una disciplina che si occupa dell applicazione dell informatica nell ambito biologico per consentire lo studio

Dettagli

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA.

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. In genere si ottengono trattando il DNA con agenti chimici (es.

Dettagli

Il dogma centrale della Biologia. Il codice genetico

Il dogma centrale della Biologia. Il codice genetico Il dogma centrale della Biologia DNA trascrizione inversa 5 traduzione trascrizione 3 RNA N-terminus C-terminus proteina Il codice genetico 4 1 = 4 possibilità 4 2 =16 possibilità 4 3 =64 possibilità 20

Dettagli

Scheda 1 1. SCHEDA 1 (2 ore) - MITOSI E MEIOSI - INCROCI CON UN GENE

Scheda 1 1. SCHEDA 1 (2 ore) - MITOSI E MEIOSI - INCROCI CON UN GENE Scheda 1 1 SCHEDA 1 (2 ore) - MITOSI E MEIOSI - INCROCI CON UN GENE 1. Disegna in modo schematico i cromosomi nei diversi stadi di mitosi di una cellula diploide con n = 1. L individuo è eterozigote per

Dettagli

LA TRADUZIONE E IL CODICE GENETICO

LA TRADUZIONE E IL CODICE GENETICO LA TRADUZIONE E IL CODICE GENETICO La traduzione La traduzione è il processo di sintesi di una catena polipeptidica, un polimero costituito da amminoacidi legati insieme da legami peptidici Le molecole

Dettagli

Codice Genetico (segue) 04/11/2015. «Wobble base pairs» (appaiamento tentennante di basi) CODICE GENETICO

Codice Genetico (segue) 04/11/2015. «Wobble base pairs» (appaiamento tentennante di basi) CODICE GENETICO «Wobble base pairs» (appaiamento tentennante di basi) CODICE GENETICO http://www.atdbio.com/img/articles/rna wobble base pairs large.png CODICE GENETICO Codice mediante il quale la sequenza nucleotidica

Dettagli

Nel codice genetico, una tripletta di nucleotidi codifica per un aminoacido

Nel codice genetico, una tripletta di nucleotidi codifica per un aminoacido Il codice genetico: Come triplette dei quattro nucleotidi specificano 20 aminoacidi, rendendo possibile la traduzione dell informazione da catena nucleotidica a sequenza di aminoacidi. Come le mutazioni

Dettagli

RNA. Uracile al posto della Timina RNA MESSAGGERO. Sempre a SINGOLO FILAMENTO

RNA. Uracile al posto della Timina RNA MESSAGGERO. Sempre a SINGOLO FILAMENTO DNA 1 RNA Uracile al posto della Timina Sempre a SINGOLO FILAMENTO RNA MESSAGGERO Filamento lineare di sequenze nucleotidiche: copia l informazione presente sul DNA e porta il messaggio a livello dei ribosomi

Dettagli

COME CALCOLARE IL PUNTEGGIO DI UN ALLINEAMENTO? Il problema del calcolo del punteggio di un allineamento può essere considerato in due modi diversi

COME CALCOLARE IL PUNTEGGIO DI UN ALLINEAMENTO? Il problema del calcolo del punteggio di un allineamento può essere considerato in due modi diversi COME CALCOLARE IL PUNTEGGIO DI UN ALLINEAMENTO? Il problema del calcolo del punteggio di un allineamento può essere considerato in due modi diversi che, però, sono le due facce di una stessa medaglia al

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Državni izpitni center BIOLOGIA. Prova d'esame 2. Giovedì, 28 agosto 2008 / 120 minuti

Državni izpitni center BIOLOGIA. Prova d'esame 2. Giovedì, 28 agosto 2008 / 120 minuti Codice del candidato: Državni izpitni center *M08242112I* SESSIONE AUTUNNALE BIOLOGIA Prova d'esame 2 Giovedì, 28 agosto 2008 / 120 minuti Al candidato sono consentiti l'uso della penna stilografica o

Dettagli

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine MFN0366-A1 (I. Perroteau) -traduzione delle proteine trna Traduzione: mrna -------> proteine mrna MFN0366-A1 (I. Perroteau) -traduzione

Dettagli

FORMAZIONE DEL LEGAME PEPTIDICO

FORMAZIONE DEL LEGAME PEPTIDICO AMINOACIDI FORMAZIONE DEL LEGAME PEPTIDICO SEQUENZA AMINOACIDICA DELL INSULINA STRUTTURA SECONDARIA DELLE PROTEINE STRUTTURA TERZIARIA DELLE PROTEINE STRUTTURA QUATERNARIA DELLE PROTEINE Definizione Processi

Dettagli

DOGMA CENTRALE DELLA BIOLOGIA

DOGMA CENTRALE DELLA BIOLOGIA DOGMA CENTRALE DELLA BIOLOGIA REPLICAZIONE DEL DNA (SINTESI o DUPLICAZIONE) MODELLO SEMICONSERVATIVO Meselson e Stahl (1958) DNA POLIMERASI CROMOSOMA NON DUPLICATO CROMOSOMA DUPLICATO (CROMATIDI FRATELLI)

Dettagli

E. Giordano 16/09/2010

E. Giordano 16/09/2010 GRUPPO NAZIONALE DI BIOINGEGNERIA XXIX Scuola Annuale BIOLOGIA SINTETICA Bressanone 13-17 settembre 2010 1/41 COSTITUENTI MOLECOLARI DELLO CHASSIS CELLULARE Emanuele GIORDANO II Facoltà di Ingegneria Dipartimento

Dettagli

LE BASI AZOTATE PIRIMIDINE PURINE

LE BASI AZOTATE PIRIMIDINE PURINE LE BASI AZTATE PURIE PIRIMIDIE Le basi azotate sono composti eterociclici aromatici con azoti portanti doppietti basici. Possono avere un solo anello (pirimidine) o due (purine). Le basi adenina, guanina

Dettagli

Capitolo 19. Risposte a domande interne al capitolo (p. 595) 19.2 (p. 596) a. O H 3 C N CH 2 H OH

Capitolo 19. Risposte a domande interne al capitolo (p. 595) 19.2 (p. 596) a. O H 3 C N CH 2 H OH Capitolo 19 Risposte a domande interne al capitolo 19.1 (p. 595) 19.2 (p. 596) a. 3 C P C 2 196 b. 2 P P P C 2 c. P C 2 19.3 (p. 610) L RA polimerasi riconosce il sito promotore per un gene, separa i filamenti

Dettagli

TRADUZIONE LA TRADUZIONE E QUEL PROCESSO ATTRAVERSO CUI SI PASSA DAL LINGUAGGIO RIBONUCLEOTIDICO DELL RNA A QUELLO AMINOACIDICO DELLE PROTEINE. IL CODICE GENETICO E L INSIEME DI CODONI (TRIPLETTE NUCLEOTIDICHE)

Dettagli

Metodo della matrice a punti

Metodo della matrice a punti Metodo della matrice a punti proposto da Gibbs and McIntyre (1970) consente di evidenziare ripetizioni dirette o inverse nelle sequenze prevedere regioni complementari nell RNA che possano potenzialmente

Dettagli

V. TRASCRIZIONE E TRADUZIONE DEL DNA

V. TRASCRIZIONE E TRADUZIONE DEL DNA V. TRASCRIZIONE E TRADUZIONE DEL DNA 0) CONCETTI BASE La trasformazione delle informazioni genetiche in proteine richiede due passaggi: la trascrizione del DNA in mrna e la traduzione dell mrna in una

Dettagli

Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione

Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione Espressione ed utilizzo della informazione genetica II Trascrizione e Traduzione CdL Tecnici di Lab Biomedico AA. 2011-12 - Prof.ssa Frabetti Come si esprime l informazione? Per i geni classici vedremo:

Dettagli

Nucleotide / aminoacido? 4 aa. 2 Nucleotide / aminoacido? 4 2 = 16 aa. 3 Nucleotide / aminoacido? 4 3 = 64 aa. UNIVERSALE e DEGENERATO

Nucleotide / aminoacido? 4 aa. 2 Nucleotide / aminoacido? 4 2 = 16 aa. 3 Nucleotide / aminoacido? 4 3 = 64 aa. UNIVERSALE e DEGENERATO La#scoperta#della#stru.ura#a#doppia#elica# nel#1953#ha#fa.o#immediatamente# sorgere#una#domanda:## come#l informazione#gene;ca#può#essere# codificata#dal#dna?# Nucleotide / aminoacido? 4 aa 2 Nucleotide

Dettagli

Definizione Composti quaternari: C H O N S P Fe Mg I

Definizione Composti quaternari: C H O N S P Fe Mg I PROTIDI Definizione Composti quaternari: C H O N S P Fe Mg I ORIGINE cellulare ogni cellula sintetizza le sue prote CARATTERISTICHE insolubili in acqua sensibili a variazioni di ph coagulano in presenza

Dettagli

Classificazione. I complessi. Le pietre miliari della tassonomia. Tassonomia del genere Mycobacterium. Pietre miliari nella tassonomia dei micobatteri

Classificazione. I complessi. Le pietre miliari della tassonomia. Tassonomia del genere Mycobacterium. Pietre miliari nella tassonomia dei micobatteri Le pietre miliari della tassonomia Tassonomia del genere Mycobacterium Enrico Tortoli Centro Regionale di Riferimento per i Micobatteri Firenze Adamo è autorizzato da Dio a dare un nome a tutti gli esseri

Dettagli

LA TRASCRIZIONE. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene

LA TRASCRIZIONE. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene LA TRASCRIZIONE Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene GLI ACIDI RIBONUCLEICI Nelle cellule nucleate la sintesi proteica avviene nel citoplasma, mentre il DNA si

Dettagli

Corso di Genetica -Lezione 12- Cenci

Corso di Genetica -Lezione 12- Cenci Corso di Genetica -Lezione 12- Cenci Il codice genetico: Come triplette dei quattro nucleotidi specificano 20 aminoacidi, rendendo possibile la traduzione dell informazione da catena nucleotidica a sequenza

Dettagli

Il dogma centrale della biologia. molecolare

Il dogma centrale della biologia. molecolare Il dogma centrale della biologia Cell molecolare Transcription Translation Ribosome DNA mrna Polypeptide (protein) L informazione per la sintesi delle proteine è contenuta nel DNA. La trascrizione e la

Dettagli

ESPRESSIONE GENICA DOGMA CENTRALE DELLA BIOLOGIA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA)

ESPRESSIONE GENICA DOGMA CENTRALE DELLA BIOLOGIA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA) ESPRESSIONE GENICA GENE (UNITÀ FUNZIONALE DEL DNA) (NUCLEO - NUCLEOIDE) mrna (CITOPLASMA) DOGMA CENTRALE DELLA BIOLOGIA ORGANIZZAZIONE GENE EUCARIOTICO PER UN mrna PROMOTORE TRASCRIZIONE 1) RNA POLIMERASI

Dettagli

Elementi di Bioinformatica. Genomica. Introduzione

Elementi di Bioinformatica. Genomica. Introduzione Corso di Elementi di Bioinformatica Ingegneria Biomedica AA 2013-14 Elementi di Bioinformatica Genomica Introduzione Genomica Genomica (genomics) Riguarda lo studio del genoma degli organismi viventi e,

Dettagli

Codice Genetico (segue) 29/10/2014 CODICE GENETICO

Codice Genetico (segue) 29/10/2014 CODICE GENETICO CODICE GENETICO Codice mediante il quale la sequenza nucleotidica di una molecola di DNA o di RNA specifica la sequenza amminoacidica di un polipeptide. CODICE GENETICO Consiste di codoni a tre nucleotidi

Dettagli

www.fisiokinesiterapia.biz TRASCRIZIONE

www.fisiokinesiterapia.biz TRASCRIZIONE www.fisiokinesiterapia.biz TRASCRIZIONE TRASCRIZIONE Processo mediante il quale una sequenza di DNA (un gene) viene copiata in una sequenza di RNA Dalla trascrizione derivano gli mrna, che verranno tradotti

Dettagli

mrna + 20 aminoacidi In vitro nulla

mrna + 20 aminoacidi In vitro nulla La sintesi proteica mrna + 20 aminoacidi In vitro nulla Il codice genetico I geni controllano la struttura delle proteine: in che modo? 4 nucleotidi A, T, C, G 20 aminoacidi Esiste un codice che converte

Dettagli

Lezione 6. Lo string matching

Lezione 6. Lo string matching Lezione 6 Lo string matching String matching Date due stringhe (sequenze di caratteri) vogliamo stabilire se sono uguali Nel caso dello string matching, due stringhe sono uguali se... sono uguali ( DNA

Dettagli

BIOLOGIA MOLECOLARE DEGLI EUCARIOTI

BIOLOGIA MOLECOLARE DEGLI EUCARIOTI UNITÀ BIOTEC. DIDATTICA DI ELEMENTI DI BIOLOGIA MOLECOLARE BIOLOGIA MOLECOLARE DEGLI EUCARIOTI Roberto Giacominelli Stuffler 1. I geni ed il DNA degli eucarioti 2. La replicazione, la trascrizione e la

Dettagli

Codice genetico CODICE GENETICO [1]

Codice genetico CODICE GENETICO [1] Codice genetico CODICE GENETICO [1] Codice mediante il quale la sequenza nucleotidica di una molecola di DNA, tramite un mrna, specifica la sequenza amminoacidica di un polipeptide. Consiste di codoni

Dettagli

06_citologia_SER_golgi 1

06_citologia_SER_golgi 1 1 La sintesi proteica inizia sempre nello stesso modo: aggancio della piccola subunità ribosomale al estremità 5 dell mrna. si aggancio la grande subunità ribosomale In corrispondenza del codone di inizio

Dettagli

Mutazioni. Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione

Mutazioni. Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione Mutazioni Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione Le mutazioni possono essere spontanee oppure causate da agenti fisici, chimici

Dettagli

Il DNA funziona da stampo per la sintesi di molecole di RNA. In questo modo l informazione genetica diventa direttamente utilizzabile per la cellula

Il DNA funziona da stampo per la sintesi di molecole di RNA. In questo modo l informazione genetica diventa direttamente utilizzabile per la cellula TRASCRIZIONE Il DNA funziona da stampo per la sintesi di molecole di RNA. In questo modo l informazione genetica diventa direttamente utilizzabile per la cellula Capacità di esprimersi dell informazione

Dettagli

TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA

TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA TRASCRIZIONE DEL DNA, TRADUZIONE DELL RNA TRADUZIONE La traduzione e il processo con cui viene sintetizzata un data proteina, attraverso reazioni chimiche di polimerizzazione di amminoacidi, in una

Dettagli

IL CODICE GENETICO E I CARATTERI EREDITARI

IL CODICE GENETICO E I CARATTERI EREDITARI IL CODICE GENETICO E I CARATTERI EREDITARI Il DNA porta le informazioni genetiche scritte nella sequenza di basi. Qualunque sequenza è possibile. Il DNA virus più semplici: 5000 basi appaiate; 46 cromosomi

Dettagli

Le proprietà elettive della cellula: Espressione della informazione genetica e differenziamento II Trascrizione- Codice genetico- Traduzione

Le proprietà elettive della cellula: Espressione della informazione genetica e differenziamento II Trascrizione- Codice genetico- Traduzione Le proprietà elettive della cellula: Espressione della informazione genetica e differenziamento II Trascrizione- odice genetico- Traduzione dl Infermieristica aa. 2011/12 Prof.ssa Frabetti ESPRESSIONE

Dettagli

Mutazioni genetiche 2

Mutazioni genetiche 2 Mutazioni genetiche 2 Cosa sono le mutazioni? Le proteine sono in grado di svolgere la loro funzione solo se la loro sequenza amminoacidica è quella corretta. In caso contrario si possono generare delle

Dettagli

Definizione TRADUZIONE

Definizione TRADUZIONE Sintesi proteica Definizione La sintesi proteica è costituita da una sequenza di eventi che portano alla formazione di un polimero di amminoacidi (proteina o polipeptide) ad opera dei ribosomi a partire

Dettagli

SAGGIO DI LEGAME AI RIBOSOMI: SE L AMMINOACIL-tRNA RICONOSCE LA TRIPLETTA, VI SI LEGA E NON RIESCE A PASSARE IL FILTRO CHE, COSì, DIVIENE RADIOATTIVO.

SAGGIO DI LEGAME AI RIBOSOMI: SE L AMMINOACIL-tRNA RICONOSCE LA TRIPLETTA, VI SI LEGA E NON RIESCE A PASSARE IL FILTRO CHE, COSì, DIVIENE RADIOATTIVO. TRADUZIONE LA TRADUZIONE E QUEL PROCESSO ATTRAVERSO CUI SI PASSA DAL LINGUAGGIO RIBONUCLEOTIDICO DELL RNA A QUELLO AMINOACIDICO DELLE PROTEINE. IL CODICE GENETICO E L INSIEME DI CODONI (TRIPLETTE NUCLEOTIDICHE)

Dettagli

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure 3.3.2. ALIMENTI DI ORIGINE VEGETALE 3.3.2.1. Verdure Nella Tabella 9 sono riportati i valori degli aminoacidi liberi presenti in alcune fra le più diffuse verdure in commercio. In un passato recente era

Dettagli

Genetica dei microrganismi

Genetica dei microrganismi Genetica dei microrganismi Dott.ssa Silvia Preziuso Dipartimento di Scienze Veterinarie Università di Camerino Sezione di Patologia Animale, Profilassi e Igiene degli Alimenti Argomenti trattati Gli acidi

Dettagli

SINTESI E MATURAZIONE DEGLI RNA CELLULARI

SINTESI E MATURAZIONE DEGLI RNA CELLULARI SINTESI E MATURAZIONE DEGLI RNA CELLULARI PER TRASCRIZIONE SI INTENDE LA SINTESI DI UNA MOLECOLA DI RNA COMPLEMENTARE AD UNO STAMPO DI DNA. GLI RNA CELLULARI SONO DISTINTI IN TRE PRINCIPALI CATEGORIE:

Dettagli

SINTESI E MATURAZIONE DEGLI RNA CELLULARI

SINTESI E MATURAZIONE DEGLI RNA CELLULARI SINTESI E MATURAZIONE DEGLI RNA CELLULARI PER TRASCRIZIONE SI INTENDE LA SINTESI DI UNA MOLECOLA DI RNA COMPLEMENTARE AD UNO STAMPO DI DNA. GLI RNA CELLULARI SONO DISTINTI IN TRE PRINCIPALI CATEGORIE:

Dettagli

CELLULA PROCARIOTICA PROCARIOTE

CELLULA PROCARIOTICA PROCARIOTE CELLULA PROCARIOTICA O PROCARIOTE CELLULA EUCARIOTICA O EUCARIOTE Sany0196.jpg IL NUCLEO Provvisto di due membrane (interna ed esterna) che congiungendosi in alcuni punti formano i pori nucleari attraverso

Dettagli

PROBLEMI CONNESSI ALL USO DI PESTICIDI IN AGRICOLTURA

PROBLEMI CONNESSI ALL USO DI PESTICIDI IN AGRICOLTURA PROBLEMI CONNESSI ALL USO DI PESTICIDI IN AGRICOLTURA COSTI DI PRODUZIONE SVILUPPO DI POPOLAZIONI DI INSETTI RESISTENTI NON SPECIFICITÀ DEGRADO AMBIENTALE DANNI ALLA SALUTE DELL UOMO PROTEASI Enzimi che

Dettagli

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it

Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016. Docente: Silvia Fuselli fss@unife.it Introduzione al corso di bioinformatica e analisi dei genomi AA 2015-2016 Docente: Silvia Fuselli fss@unife.it Possibili testi di riferimento Introduction to Genomics, A.M. Lesk, Oxford Capitoli 1, 3,

Dettagli

GENOMICA STRUTTURALE: GENOMICA FUNZIONALE:

GENOMICA STRUTTURALE: GENOMICA FUNZIONALE: GENOMICA STRUTTURALE: GENOMICA FUNZIONALE: 1. Anatomia dei genomi 8. Funzionamento dei genomi Il genoma dei procarioti Modificazioni della cromatina e l espressione del Il genoma degli eucarioti genoma

Dettagli

LE MUTAZIONI E L EVOLUZIONE

LE MUTAZIONI E L EVOLUZIONE UNITÀ BIOTEC. DIDATTICA DI ELEMENTI DI BIOLOGIA MOLECOLARE LE MUTAZIONI E L EVOLUZIONE Roberto Giacominelli Stuffler LE MUTAZIONI 2 LE MUTAZIONI LE SOSTITUZIONI LE DELEZIONI LE INSERZIONI 3 LE MUTAZIONI

Dettagli

SDD Seconde Gli acidi nucleici. Gli acidi nucleici

SDD Seconde Gli acidi nucleici. Gli acidi nucleici 1 Capire come le informazioni genetiche sono immagazzinate nelle cellule e come avviene la trasformazione di queste informazioni nei meccanismi metabolici delle cellule. Quattro mattoncini La cellula ha

Dettagli

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario Il DN e la duplicazione cellulare Il DN, materiale ereditario Struttura del DN Replicazione del DN Dal DN alla proteina Il odice genetico iclo cellulare Mitosi Meiosi Da Figura 8-11 ampbell & Reece cidi

Dettagli

Le L z e io i ne n 6 Co C n o f n ro r n o t n i i fra r a se s q e u q e u n e z n e z : e di d s i t s a t nz n e z, e allineamenti

Le L z e io i ne n 6 Co C n o f n ro r n o t n i i fra r a se s q e u q e u n e z n e z : e di d s i t s a t nz n e z, e allineamenti Lezione 6 Confronti fra sequenze: distanze, Confronti fra sequenze: distanze, allineamenti Distanze fra sequenze Per N siti ed n differenze: grado di divergenza = n/n AATGAAAGAA 10 siti; 3 differenze ACTGGAGGAA

Dettagli

Traduzione dell informazione genetica (1)

Traduzione dell informazione genetica (1) Traduzione dell informazione genetica (1) 1 Traduzione dell informazione genetica (2) Il processo negli eucarioti richiede: 70 diverse proteine ribosomiali >20 enzimi che attivano i precursori degli amminoacidi

Dettagli

Il DNA, acido desossiribonucleico, è la molecola che

Il DNA, acido desossiribonucleico, è la molecola che Il DNA, acido desossiribonucleico, è la molecola che contiene le informazioni necessarie per il funzionamento di ogni essere vivente: le informazioni genetiche, che ciascuno di noi eredita dai propri genitori.

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli