Amminoacidi/peptidi/proteine. Chimica Organica II

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Amminoacidi/peptidi/proteine. Chimica Organica II"

Transcript

1 Amminoacidi/peptidi/proteine Chimica Organica II

2 Amminoacidi Chimica Organica II

3 Amminoacidi Chimica Organica II

4 Amminoacidi Chimica Organica II

5 Amminoacidi Chimica Organica II

6 II Amminoacidi: chiralità R S

7 II Amminoacidi: carica Un amminoacido non esiste mai in una formula priva di cariche

8 II Amminoacidi: carica Punto isolettrico: valore di ph in cui la carica netta è nulla

9 II Peptidi Le proteine sono macromolecole formate da amminoacidi legati in sequenza attraverso la formazione di gruppi ammidici.

10 II Peptidi Peptide (corta sequenza di aa) Proteina (lunga sequenza di aa)

11 Struttura primaria La struttura primaria è la sequenza con cui si succedono gli amminoacidi Chimica Organica

12 Struttura secondaria: -elica Tra gli amminoacidi che formano la sequenza proteica di formano dei legami a idrogeno che determinano la stabilizzazione di strutture secondarie. Esempio di struttura secondaria: -elica Legame a idrogeno i i + 4 Passo 5.4 A, 3.6 aa per giro

13 Struttura secondaria: foglietto- Tra gli amminoacidi che formano la sequenza proteica di formano dei legami a idrogeno che determinano la stabilizzazione di strutture secondarie.

14 Struttura secondaria: foglietto- Tra gli amminoacidi che formano la sequenza proteica di formano dei legami a idrogeno che determinano la stabilizzazione di strutture secondarie.

15 Proteine:struttura terziaria A loro volta le strutture secondarie si organizzano per dare alla proteina una precisa forma tridimensionale (struttura terziaria) Esempio di struttura terziaria: mioglobina, proteina globulare WebLab ViewerPro Molecule

16 Proteine A loro volta le strutture secondarie si organizzano per dare alla proteina una precisa forma tridimensionale (struttura terziaria) mioglobina, proteina globulare Un altra proteina globulare

17 Proteine A loro volta le strutture secondarie si organizzano per dare alla proteina una precisa forma tridimensionale (struttura terziaria) triose phosphate isomerase Acidic residues red, basic residues blue, polar residues green, nonpolar residues white

18 Proteine A loro volta le strutture secondarie si organizzano per dare alla proteina una precisa forma tridimensionale (struttura terziaria)

19 Proteine Diveri tipi di interazione stabilizzano la struttura terziaria

20 Proteine: sintesi Sintesi in soluzione: a) sintesi lineare Gly + Lys = GlyLys (50%) GlyLys + Lys = GlyLysLys (50%) GlyLysLys + Pro = GlyLysLysPro (50%) RESA FINALE 12.5% Sintesi in soluzione: a) sintesi convergente (condensazione di frammenti) Gly + Lys = GlyLys (50%) Lys + Pro = LysPro (50%) GlyLys + LysPro = GlyLysLysPro (50%) RESA FINALE 25% Ogni step può richiedere una purificazione, una deprotezione e un altra purificazione. Non è pratico per sequenze più lunghe di residui

21 Proteine: sintesi Sintesi in fase solida: H H NH 2 N Gly OH N Gly Lys OH H 2 N Gly Lys Asp OH H N Gly Lys Asp OH La purificazione del prodotto avviene tramite semplice filtrazione E possibile (e necessario) usare larghi eccessi di reagenti La sintesi è automatizzabile Si possono preparare sequenze di 100 aa, sopra è necessario usare la condensazione di frammenti (ma questo è molto costoso per la necessità di usare eccessi di reagenti) Problemi di purificazione dalle sequenze contenenti errori

22 Ruoli delle proteine: strutturali Capsule virali: Capsula interna ed esterna del Dwarf Rice Virus Collagene: Tripla elica sinistrogira (300 x 1.5 nm), ripetizione di sequenze Gly-Pro-X o Hyp-Y-Gly

23 Ruoli delle proteine: trasporto Emoglobina (trsporto dell ossigeno): emoglobina eme

24 Ruoli delle proteine: trasporto Emoglobina (trsporto dell ossigeno): N N N N O 2 N N O O N N N N NH NH Allosteria: l interazione con il primo substrato influenza la forza dell interazione con i successivi. Quando la pressione parziale di ossigeno è alta, l emoglobina lo lega fortemente, se è bassa, lo lega debolmente

25 Ruoli delle proteine: trasporto Canali ionici (trasporto di ioni): K + Siti enzimatici

26 Ruoli delle proteine: catalisi (enzimi) Gli enzimi sono proteine dotate di attività catalitica. Un catalizzatore è una specie chimica in grado di accelerare una reazione. G G Coordinata di reazione Reazione non catalizzata Coordinata di reazione Reazione catalizzata Operano in condizioni dolci (35 C, ph 7) Estremamente efficienti (accelerazioni fino a volte) Altamente specifici e selettivi

27 Enzimi: selettività Un enzima è in grado di provocare selettivamente la reazione in un unica posizione del substrato e di ottenere solo lo stereoisomero desiderato H 3 C H CH 3 Enzima H 3 C HO H CH 3 HO HO Reagente chimico OH CH 3 CH 3 CH 3 H 3 C H H 3 C H H 3 C H OH HO HO OH HO

28 Enzimi: selettività Un enzima è in grado di catalizzare diverse reazioni in diversi siti attivi (copia/correzione) copy correction Reverse transcriptase DNA polymerase

29 Enzimi: selettività Mappa delle biotrasformazioni che avvengono in una cellula: cisacun punto rappresenta un composto, ciascuna linea una reazione catalizzata da un enzima

30 Enzimi: meccanismo v o v max [ S 0 ] K [ S ] M o L enzima forma un complesso con il substrato che reagisce attraverso uno stato di transizione a energia più bassa La formazione del complesso è testimoniata dall osservazione di profili cinetici di Michaelis- Menten (K M, costante di dissociazione) Induced fit

31 Meccanismo: un esempio Stabilizzazione del Gruppo uscente Stabilizzazione dello Stato di transizione Base O M B 2 + O 3' O - O O 5' P O O O M A 2 + Base O H - O O - 3' H O Asp 355 Asp 501 H O - O O Generazione del nucleofilo Glu 357 Tyr 497 Orientazione del substrato Meccanismo di azione del sito endonucleasico dell enzima DNA polimerasi II

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Enzimi: catalizzatori biologici

Enzimi: catalizzatori biologici Enzimi: catalizzatori biologici praticamente tutte le reazioni biochimiche della chimica della vita sono catalizzate da enzimi gli enzimi sono proteine la velocità di reazioni enzimatiche è aumentata di

Dettagli

Lezione n. 11. Reazioni enzimatiche Michaelis-Menten Dipendenza di k da T. Antonino Polimeno 1

Lezione n. 11. Reazioni enzimatiche Michaelis-Menten Dipendenza di k da T. Antonino Polimeno 1 Chimica Fisica Biotecnologie sanitarie Lezione n. 11 Reazioni enzimatiche Michaelis-Menten Dipendenza di k da T Antonino Polimeno 1 senza catalizzatore... con catalizzatore... Antonino Polimeno 2 Catalisi

Dettagli

Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi.

Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. ENZIMI Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. Svolgono il loro ruolo con modalità differenti

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

ENZIMI. Un enzima è un catalizzatore (acceleratore) di reazioni biologiche.

ENZIMI. Un enzima è un catalizzatore (acceleratore) di reazioni biologiche. ENZIMI ENZIMI Un enzima è un catalizzatore (acceleratore) di reazioni biologiche. Catalizzatore = sostanza in grado di accelerare lo svolgimento di una reazione chimica e quindi di aumentarne la sua velocità,

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi)

Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi) ENZIMI Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi) Sono in grado di aumentare la velocità dei processi catalizzati fino a

Dettagli

Termodinamica ENTALPIA...6

Termodinamica ENTALPIA...6 Termodinamica ORGANISMI PRIMO VIVENTI ED ENERGIA...2 PRINCIPIO DELLA TERMODINAMICA...5 ENTALPIA...6 SECONDO PRINCIPIO DELLA TERMODINAMICA... 7 energia libera di Gibbs (G)...9 Variazione di energia libera

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari, e lavorano in condizioni blande di temperatura e ph (sono in grado di aumentare la velocità delle

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Reazione di Briggs Rauscher

Reazione di Briggs Rauscher Cinetica chimica 1 Reazione di Briggs Rauscher a) Come varia nel tempo la composizione chimica di un sistema? b) Qual è il meccanismo secondo cui avviene una reazione chimica? c) Come è possibile modificare

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

GLI ENZIMI: proteine con attività CATALITICA

GLI ENZIMI: proteine con attività CATALITICA Cap. 6 GLI ENZIMI: proteine con attività CATALITICA Catalizzatori biologici: permettono alle reazioni biochimiche di avvenire a temperature e pressioni fisiologiche e a velocità misurabile. Aumentano la

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

SINTESI PEPTIDICA LEZIONE 4

SINTESI PEPTIDICA LEZIONE 4 SINTESI PEPTIDICA LEZIONE 4 PEPTIDI I legami peptidici sono legami ammidici che uniscono i residui amminoacidici. gruppo ammino libero a sx gruppo carbossilico libero a dx configurazione trans più stabile

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

CLASSIFICAZIONE O.T.I.L.Is. Lig

CLASSIFICAZIONE O.T.I.L.Is. Lig GLI ENZIMI CHE COSA SONO? Sono delle proteine altamente specializzate con attività catalitica, accelerano le reazioni chimiche rimanendo inalterati al termine della reazione stessa. CLASSIFICAZIONE O.T.I.L.Is.

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

BIOLOGIA GENERALE 19 dicembre 2006

BIOLOGIA GENERALE 19 dicembre 2006 Biologia generale Massolo Alessandro massolo@unifi.it; Tel. 347-9403330 BIOLOGIA GENERALE 19 dicembre 2006 Facoltà di Psicologia Corso di Laurea in Scienze e Tecniche di Psicologia Generale e Sperimentale

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Chimica Fisica Biologica

Chimica Fisica Biologica Chimica Fisica Biologica Università degli Studi di Padova Variazione della concentrazione [1] La variazione nel tempo della composizione di un sistema oggetto della cinetica chimica Le concentrazione delle

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA Enzimi semplici Enzimi coniugati - utilizzano esclusivamente le reattività chimiche di alcuni residui AA - richiedono la reattività chimica aggiuntiva di COFATTORI o COENZIMI gruppi prostetici COENZIMI

Dettagli

Capitolo 5 L energia e il trasporto

Capitolo 5 L energia e il trasporto Capitolo 5 L energia e il trasporto La cellula e l energia 5.1 L energia è la capacità di produrre lavoro Tutti gli organismi hanno bisogno di energia per vivere. L energia è definita come la capacità

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Gli enzimi e la catalisi

Gli enzimi e la catalisi Gli enzimi e la catalisi Distribuzione di energia in una popolazione di molecole Normalmente, le molecole stabili sono per lo più presenti ad un livello di energia relativamente basso Solo una piccola

Dettagli

Per la stessa reazione possono essere utilizzati catalizzatori diversi. es. HCOOH H 2 + CO 2 viene catalizzata da Ni, Cd, Pt, Cu.

Per la stessa reazione possono essere utilizzati catalizzatori diversi. es. HCOOH H 2 + CO 2 viene catalizzata da Ni, Cd, Pt, Cu. CATALISI L'uso di un catalizzatore, sostanza capace di accelerare una reazione senza intervenire sulla T, è di enorme importanza in alcuni tipi di reazione. Ad esempio le proteine reagiscono velocemente

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30)

TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30) TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30) A + B-C A-B + C (A B C) Complesso attivato Stato di transizione Coordinata di reazione H A H B + H C H A + H B H C A+ K B X k' P + Q [ P] d dt =

Dettagli

Composti carbonilici Acidi carbossilici

Composti carbonilici Acidi carbossilici Composti carbonilici Acidi carbossilici Acidi carbossilici: nomenclatura alcano -> acido alcanoico Acidi carbossilici: proprietà Il gruppo carbossilico ha caratteristiche comuni ai chetoni (C=O) e agli

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Gli enzimi e l inibizione enzimatica.

Gli enzimi e l inibizione enzimatica. Gli enzimi e l inibizione enzimatica. Catalisi enzimatica La velocità di una reazione è descritta dall equazione di Arrhenius: k = Ae -Ea/RT in cui A è il fattore pre-esponenziale R è la costante dei gas

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Traduzione dell informazione genetica (1)

Traduzione dell informazione genetica (1) Traduzione dell informazione genetica (1) 1 Traduzione dell informazione genetica (2) Il processo negli eucarioti richiede: 70 diverse proteine ribosomiali >20 enzimi che attivano i precursori degli amminoacidi

Dettagli

Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008. Eloise Mastrangelo

Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008. Eloise Mastrangelo Biochimica delle proteine Prof. M. Bolognesi a.a. 2007/2008 Eloise Mastrangelo Perché è importante determinare la struttura primaria delle proteine? 1. La conoscenza della sequenza amminoacidica delle

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

Regolazione enzimatica Isoenzimi

Regolazione enzimatica Isoenzimi Regolazione enzimatica Isoenzimi Gli enzimi regolatori nel metabolismo gruppi di enzimi lavorano insieme per produrre una via metabolica in cui il prodotto del primo enzima diventa il substrato del secondo

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Alogenuri alchilici. Alogenuri alchilici: funzioni. Varietà di funzione dei composti alogenati. Figura

Alogenuri alchilici. Alogenuri alchilici: funzioni. Varietà di funzione dei composti alogenati. Figura Figura Alogenuri alchilici Alogenuri alchilici: funzioni Varietà di funzione dei composti alogenati Alogenuri alchilici: nomenclatura Alogenuri alchilici o aloalcani Bromo Alogenuri alchilici: struttura

Dettagli

Applicazioni biotecnologiche degli enzimi: le proteasi

Applicazioni biotecnologiche degli enzimi: le proteasi Applicazioni biotecnologiche degli enzimi: le proteasi Le proteasi catalizzano l idrolisi di legami peptidici Esopeptidasi ed endopeptidasi Specificità di riconoscimento più o meno elevata 4 classi sulla

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI Seconda Università degli Studi di Napoli DiSTABiF Anno Accademico 2016-17 Corso di Laurea Magistrale in SCIENZE DEGLI ALIMENTI E DELLA NUTRIZIONE UMANA Insegnamento di BIOCHIMICA e BIOTECNOLOGIE degli

Dettagli

Catalisi. Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A Modulo di Biologia Strutturale

Catalisi. Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A Modulo di Biologia Strutturale Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Catalisi Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Enzimi come catalizzatori biologici

Enzimi come catalizzatori biologici Enzimi come catalizzatori biologici Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. La catalisi procede

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Macromolecole biologiche

Macromolecole biologiche MACROMOLECOLE BIOLOGICHE & COSTITUENTI DI BASE Macromolecole biologiche 1. Introduzione ZUCCHERI POLISACCARIDI ACIDI GRASSI GRASSI, LIPIDI, MEMBRANE AMMINOACIDI PROTEINE NUCLEOTIDI ACIDI NUCLEICI Molecole

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

Argomenti di tesi disponibili presso il Gruppo di Chimica Bioinorganica e Bioelettrochimica

Argomenti di tesi disponibili presso il Gruppo di Chimica Bioinorganica e Bioelettrochimica Argomenti di tesi disponibili presso il Gruppo di Chimica Bioinorganica e Bioelettrochimica Gruppo di Chimica Bioinorganica e Bioelettrochimica G. Battistuzzi M. Borsari L. Paltrinieri A. Ranieri C. A.

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Cinetica chimica E lo studio della velocità delle reazioni chimiche, delle leggi di velocità e dei meccanismi di reazione.

Cinetica chimica E lo studio della velocità delle reazioni chimiche, delle leggi di velocità e dei meccanismi di reazione. Cinetica chimica E lo studio della velocità delle reazioni chimiche, delle leggi di velocità e dei meccanismi di reazione. Es. 2H 2(g) + O 2(g) d 2H 2 O (l) K eq (25 C)=10 83 (ricavato da lnk=-δg /RT)

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Rappresentazione dei Dati Biologici

Rappresentazione dei Dati Biologici Rappresentazione dei Dati Biologici CORSO DI BIOINFORMATICA C.d.L. Ingegneria Informatica e Biomedica Outline Proteine ed Amminoacidi Rappresentazione di Amminoacidi Rappresentazione delle strutture Proteiche

Dettagli

LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello.

LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello. LE MEMBRANE Le membrane sono composte da lipidi e proteine in composizioni che variano in base alla specie,al tipo cellulare e all organello.il modello a mosaico fluido descrive la struttura comune a tutte

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Esempi di funzioni svolte dalle proteine

Esempi di funzioni svolte dalle proteine Esempi di funzioni svolte dalle proteine Trasporto di sostanze Esempi di funzioni svolte dalle proteine Trasporto di sostanze Funzioni strutturali Esempi di funzioni svolte dalle proteine Trasporto di

Dettagli

di piccoli gruppi di molecole di RNA catalitico tutti gli enzimi sono proteine Molti enzimi per poter funzionare richiedono la presenza di cofattori.

di piccoli gruppi di molecole di RNA catalitico tutti gli enzimi sono proteine Molti enzimi per poter funzionare richiedono la presenza di cofattori. Enzimi Con l eccezione l di piccoli gruppi di molecole di RNA catalitico tutti gli enzimi sono proteine Molti enzimi per poter funzionare richiedono la presenza di cofattori. apoenzima + cofattore = oloenzima

Dettagli

Velocita di reazione Reazioni di I e II ordine Molecolarita di una reazione t 1/2 Velocita e costanti di equilibrio

Velocita di reazione Reazioni di I e II ordine Molecolarita di una reazione t 1/2 Velocita e costanti di equilibrio Cinetica enzimatica Cenni alla cinetica delle reazioni Velocita di reazione Reazioni di I e II ordine Molecolarita di una reazione t 1/2 Velocita e costanti di equilibrio OVVERO: CINETICA ENZIMATICA LO

Dettagli

Applicazioni biotecnologiche degli enzimi: le proteasi

Applicazioni biotecnologiche degli enzimi: le proteasi Applicazioni biotecnologiche degli enzimi: le proteasi Campi di applicazione delle proteasi Le proteasi catalizzano l idrolisi di legami peptidici Esopeptidasi ed endopeptidasi Specificità di riconoscimento

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

La battaglia contro l influenza

La battaglia contro l influenza La battaglia contro l influenza Il contributo della biologia strutturale allo sviluppo di inibitori della sialidasi Prof. Elena Luraschi Virus dell influenza I virus dell influenza sono virus a RNA, con

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Depuratore Biologico anaerobica con produzione di metano (CH4) da decomposizione organica

Depuratore Biologico anaerobica con produzione di metano (CH4) da decomposizione organica Brevetti Depuratore Biologico anaerobica con produzione di metano (CH4) da decomposizione organica Depuratore Biologico anaerobica con produzione di metano (CH4) da decomposizione organica Committente:

Dettagli