Modello Watson-Crick del DNA

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Modello Watson-Crick del DNA"

Transcript

1 Modello Watson-Crick del DNA Diffrazione raggi X (Wilkins & Franklin) Modello atomico a doppia elica (B-DNA, Watson & Crick) VMD 1

2 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica contenente due filamenti complementari orientati in maniera opposta. Avvolgimento genera due solchi (grooves) uno minore e uno più ampio, maggiore. Basi circa perpendicolari all asse dell elica. Diametro ~20 Å. Pitch ~34 Å. Distanza fra basi adiacenti ~3.4 Å. Base-pair twist ~36. 2

3 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica contenente due filamenti complementari orientati in maniera opposta. Avvolgimento genera due solchi (grooves) uno minore e uno più ampio, maggiore. Basi circa perpendicolari all asse dell elica. Diametro ~20 Å. Pitch ~34 Å. Distanza fra basi adiacenti ~3.4 Å. Base-pair twist ~36. 3

4 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica contenente due filamenti complementari orientati in maniera opposta. Avvolgimento genera due solchi (grooves) uno minore e uno più ampio, maggiore. Legami idrogeno tra basi opposte sui due filamenti. Solo coppie AT e CG (altri rari e instabili)!!! Basi circa perpendicolari all asse dell elica e quasi planari (H-bond non stringenti, ingombro sterico). 4

5 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Doppia elica contenente due filamenti complementari orientati in maniera opposta. Avvolgimento genera due solchi (grooves) uno minore e uno più ampio, maggiore. Legami idrogeno tra basi opposte sui due filamenti. Solo coppie AT e CG (altri rari e instabili)!!! Basi circa perpendicolari all asse dell elica e quasi planari (H-bonds non stringenti, ingombro sterico). 5

6 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Distanza fra basi adiacenti ~3.4 Å: ulteriore stabilizzazione tramite interazioni idrofobiche intrafilamento (π-π stacking). Diametro ~20 Å. Pitch ~34 Å. 6

7 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Avvolgimento doppio genera twist base-pair 36. Scheletro (zucchero polare e fosfato carico) esposti al solvente, nucleobasi idrofobiche all interno (effetto idrofobico). 36 7

8 Modello Watson-Crick del DNA B-DNA: doppia elica destrorsa Avvolgimento doppio genera twist base-pair 36. Scheletro (zucchero polare e fosfato carico) esposti al solvente, nucleobasi idrofobiche all interno (effetto idrofobico). 8

9 Accoppiamento specifico A:T/C:G Verificato sperimentalmente in diversi organismi, conferma la teoria di Watson & Crick 9

10 Perchè doppia elica? Effetto idrofobico due filamenti paralleli con interazioni tra basi buona soluzione, ma non ottimale causa spaziatura troppo grande (~2.7 Å) fra nucleobasi. 10

11 Perchè doppia elica? In 2D una soluzione è arrangiamento obliquo dei filamenti: ottimizza contatti fra basi adiacenti tenendo costanti le distanze fra fosfati. In 3D arrangiamento elicoidale destrogiro di filamenti orientati in direzioni opposte. 11

12 Perchè doppia elica? Doppia elica vs. scala obliqua Scala obliqua in 3D non compatibile con struttura atomica nucleotidi: sovrapposizioni fra atomi. Doppia elica consente migliore stacking delle nucleobasi. Doppia elica destrogira per ragioni steriche. Strutture levogire sono possibili (Z), ma in genere molto complesse. 12

13 DNA e read-out indiretto Informazione extragenetica accessibile sulla superficie del DNA (legami idrogeno, potenziale elettrostatico, idratazione, flessibilità). Solchi maggiore e minore: successione di donori (D) e accettori (A) di legami idrogeno, e di gruppi idrofobici (*), riflette sequenza DNA. 13

14 DNA e read-out indiretto Informazione extragenetica utilizzata da alcune proteine che scansionano DNA senza bisogno di svolgere la struttura a doppia elica. Utilizzata da molecole farmaceutiche e tossine per riconoscere specifiche sequenze. 14

15 Parametri strutturali del DNA DNA macromolecola estremamente flessibile (proprietà fondamentale nell interazione con partner) Importante descrivere accuratamente deformazione Parametri globali: correlati alla curvatura dell asse principale, alla larghezza e profondità dei solchi minore e maggiore. Parametri locali: categorizzati in quattro gruppi principali: Elicoidali Base/base Base-pair/base-pair Scheletro (zucchero e fosfato) 15

16 Parametri globali del DNA DNA bending Può essere più o meno accentuato, e indurre deformazioni importanti a livello di coppie di basi adiacenti (es.: kink). Diretto verso il solco maggiore o verso il minore (variazioni maggiori nei parametri locali in questo caso). 16

17 Parametri globali del DNA DNA bending Bending (e in generale flessibilità) dipende dalla sequenza: tratti ricchi in A hanno maggior bending intrinseco (facilita impacchetamento in nuclidi). Indotto da variazioni nella concentrazione ionica e nel ph, da proteine (es.: istoni) e da molecole organiche e non (es.: cisplatino). kink smooth bending 17

18 Parametri globali del DNA DNA bending Importante nel riconoscimento molecolare del DNA da parte dei complessi proteici di riparazione e replicazione (es.: DNA polimerase). Struttura del complesso TBP-TATA (TATA-Box Binding Protein) 18

19 Parametri globali del DNA DNA bending Essenziale per assemblaggio di complessi multi-proteici che necessitano di contatti con diversi tratti del DNA (es.: istoni). Essenziale per impacchettamento gerarchico DNA nei cromosomi. Struttura di un nucleosoma 19

20 Parametri globali del DNA DNA grooves Variazioni in larghezza e profondità ( esposizione) solchi indotte da variazioni nella concentrazione ionica e nel ph, e da interazioni con proteine (in genere solco maggiore) e da molecole (solco minore). 20

21 Parametri globali del DNA DNA grooves Connesse a variazioni in curvatura asse elicoidale, avvolgimento/ svolgimento della doppia elica, parametri locali. 21

22 Parametri locali del DNA Sistema di riferimento locale centrato su coppia di basi Major groove Asse z positivo direzione 3-5 identifica filamento I. Asse x positivo verso solco maggiore. Asse y positivo verso filamento I. 22

23 Parametri locali del DNA Elicoidali Descrivono traslazioni nel piano xy e rotazioni attorno agli assi x e y 23

24 Parametri locali del DNA Base/base Descrivono spostamenti relativi delle basi nel piano xy e lungo l asse z, e rotazioni relative delle stesse 24

25 Parametri locali del DNA Base-pair/base-pair Descrivono spostamenti tra coppie di basi nel piano xy e lungo l asse z, e rotazioni relative delle stesse 25

26 Parametri locali del DNA Scheletro (zucchero e fosfato) e legame glicosidico Tre gruppi di parametri che descrivono la flessibilità dello scheletro di un filamento di DNA (o RNA): Sugar Puckering (endo vs. exo). Conformazioni attorno a legame glicosidico (anti vs. syn). Conformazioni del backbone: - Conformazioni α/γ. - Conformazioni ζ/ε (BI vs. BII). 26

27 Parametri locali del DNA Sugar Puckering (deossi)ribosio non planare: conformazione specificata da 5 torsionali τ 0 -τ 4. In genere 2 atomi (1 in particolare) deviano da piano altri tre in direzioni opposte. Se deviazione maggiore dalla parte di legame C4 -C5, atomo coinvolto prende suffisso -endo. Strutture dominanti C2 -endo (deossiribosio, B-DNA), C3 -endo (ribosio, RNA, A-DNA). Interconversioni possibili, barriere associate 5 kcal/mol. Distanza P-P ~7.0 Å se C2 -endo pucker, più corta (~6 Å) in presenza di C3 -endo. C4 τ 4 O4 τ 0 C1 τ 3 C3 τ 2 C2 τ 1 C2 -endo C3 -endo 27

28 Parametri locali del DNA Conformazioni attorno a legame glicosidico Torsionale χ (O4 -C1 -N1/9-C2/4) assume solo alcuni valori (ingombro sterico). Due conformazioni principali: Anti: -180 < χ < -90 (H-bonds puntano lontano dallo zucchero). Syn: 0 < χ < 90 (H-bonds puntano sopra piano zucchero). Interconversioni possibili, dipendono da nucleobase, barriere associate kcal/mol. N9 C2 C1 C4 C4 N9 C2 C1 Anti Syn 28

29 Parametri locali del DNA Conformazioni dello scheletro Sei torsionali α, β, γ, δ, ε, ζ, i cui valori sono fortemente correlati tra loro, al puckering e a χ. In genere descritti come gauche +, gauche -, trans per valori attorno a 60, -60 e 180. α/ζ solo g - /g - è compatibile con arrangiamento in polinucleotidi a doppia elica. γ assume varie conformazioni, ma g + domina in doppie eliche levogire. P 5 α C5 O5 β γ C4 O4 3 δ ε ζ C3 O3 P C2 C1 χ N1/9 g - (~ -60 ) t (~ 180 ) Backbone conformational wheel g + (~60 ) 29

30 Parametri locali del DNA Conformazioni dello scheletro α/γ non-canoniche assunte in occasione di interazione con proteine. Rotazioni attorno a ζ/ε generano due conformeri, BI (ε-ζ>0) e BII (ε-ζ<0) che coesistono in rapporto 80%/20% in B-DNA. 30

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick

1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick 1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick Il genoma di E. coli ha 4.0 milioni di nucleotidi Le dimensioni del DNA in vivo Organismo

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica

Dettagli

ACIDI NUCLEICI Il dogma centrale della biologia

ACIDI NUCLEICI Il dogma centrale della biologia ACIDI NUCLEICI Il dogma centrale della biologia DNA RNA PROTEINE DNA POLINUCLEOTIDI NUCLEOTIDI NUCLEOSIDI ZUCCHERI ACIDO FOSFORICO BASI AZOTATE Ribosio 2 deossiribosio PURINE PIRIMIDINE Adenina Guanina

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

NUCLEOTIDI e ACIDI NUCLEICI

NUCLEOTIDI e ACIDI NUCLEICI NUCLEOTIDI e ACIDI NUCLEICI Struttura dei nucleotidi Il gruppo fosfato conferisce carica negativa e proprietà acide FUNZIONI DEI NUCLEOTIDI MOLECOLE DI RISERVA DI ENERGIA L idrolisi dei nucleosidi trifosfato

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

F. Fogolari Milano, Marzo

F. Fogolari Milano, Marzo Biomolecole - 1 Federico Fogolari Dipartimento Scientifico e Tecnologico Universita di Verona Ca Vignal 1, Strada Le Grazie 15 37134 Verona, Italy tel. ++39-045-8027906 fax. ++39-045-8027929 email: fogolari@sci.univr.it

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA...

Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA... ACIDI NUCLEICI...2 FUNZIONI DEL DNA...5 FUNZIONI DELL RNA...5 I NUCLEOTIDI...6 Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE

Dettagli

Gli Acidi Nucleici DNA RNA

Gli Acidi Nucleici DNA RNA Gli Acidi Nucleici DNA RNA Gli Acidi nucleici Gli acidi nucleici sono il: DNA (acido desossiribonucleico) RNA (acido ribonucleico) Essi sono formati dai polimeri (molecole molto grosse) i cui monomeri

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

La nuova biologia.blu

La nuova biologia.blu David Sadava, David M. Hillis, H. Craig Heller, May R. Berenbaum La nuova biologia.blu Genetica, DNA ed evoluzione PLUS 2 Capitolo B2 Il linguaggio della vita 3 Le basi molecolari dell ereditarietà Prima

Dettagli

ACIDI NUCLEICI ESPERIMENTI

ACIDI NUCLEICI ESPERIMENTI ACIDI NUCLEICI ESPERIMENTI 1869 FRIEDRICK MIESCHER Isolò per la prima volta una sostanza zuccherina leggermente acida contenente fosforo Questa sostanza venne chiamata: acido nucleico perché scoperta nel

Dettagli

Il DNA conserva l informazione genetica

Il DNA conserva l informazione genetica Il DNA conserva l informazione genetica Gli esperimenti di Frederick Griffith (1928) Gli esperimenti di Oswald Avery (1944) + Estratti dal ceppo IIIS ucciso al calore di Polisaccaridi Lipidi Proteine Acidi

Dettagli

STRUTTURE DEGLI ACIDI NUCLEICI, CODICE GENETICO E REPLICAZIONE DEL DNA

STRUTTURE DEGLI ACIDI NUCLEICI, CODICE GENETICO E REPLICAZIONE DEL DNA IL LABORATORIO DI BIOLOGIA MOLECOLARE: Introduzione alle tecniche e alle loro applicazioni STRUTTURE DEGLI ACIDI NUCLEICI, Il DNA nell arte: Susan Rankaitis 2002, DNA2 CODICE GENETICO E REPLICAZIONE DEL

Dettagli

Strutture alternative e strutture superiori degli acidi nucleici

Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative La struttura a doppia elica proposta da Crick e Watson, e che abbiamo sopra descritto, è quella ottenuta mediante

Dettagli

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica.

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica. NUCLEOTIDI a) Forma di energia utilizzata nel metabolismo cellulare (ATP, GTP) b) Entrano a far parte della struttura di cofattori enzimatici (coenzimi) e intermedi metabolici c) Costituiscono gli ACIDI

Dettagli

Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Stereochimica di alcani e cicloalcani

Stereochimica di alcani e cicloalcani di alcani e cicloalcani Conformazioni, conformeri Due conformazioni dell etano. Le conformazioni sono arrangiamenti diversi di atomi che interconvertono per rotazione attorno al legame C-C. Rappresentazione

Dettagli

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA Nucleotidi e Acidi Nucleici Nucleosidi Nucleotidi Funzioni biologiche dei nucleotidi Struttura di DNA e RNA Concatenazione e appaiamento dei nucleotidi Lo scheletro degli acidi nucleici Componenti degli

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Prof. Antimo Di Maro Anno Accademico 2016-17 Lezione 11 fattore trasformante L'esperimento

Dettagli

3 Acidi Nucleici : Il RNA può essere catalitico

3 Acidi Nucleici : Il RNA può essere catalitico Caratteristiche Distintive del DNA e del RNA ACIDI NUCLEICI http://www.genome.gov/dmd/img.cfm?node=photos/graphics&id=85209 3 DNA RNA Proteina Il DNA è una molecola informativa. L informazione è immagazzinata

Dettagli

CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE. Dott.ssa A. Fiarè

CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE. Dott.ssa A. Fiarè CORSO DI LAUREA IN SCIENZE DELLA FORMAZIONE PRIMARIA LEZIONE PRIMA PARTE Dott.ssa A. Fiarè IL DNA (ACIDO DESOSSIRIBONUCLEICO) E UN ACIDO NUCLEICO DEFINITO POLINUCLEOTIDE, IN QUANTO E UNA MOLECOLA FORMATA

Dettagli

Gerarchia della struttura delle proteine

Gerarchia della struttura delle proteine Si indica con CONFORMAZIONE la disposizione tridimensionale degli atomi di una molecola, cioè la loro organizzazione spaziale. Gerarchia della struttura delle proteine struttura primaria: sequenza degli

Dettagli

IL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene

IL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene IL MATERIALE EREDITARIO Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene Caratteristiche del materiale ereditario 1 Replicarsi accuratamente durante crescita e divisione

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Stereochimica di alcani e cicloalcani. Stereochimica. Conformazioni, conformeri

Stereochimica di alcani e cicloalcani. Stereochimica. Conformazioni, conformeri di alcani e cicloalcani Conformazioni, conformeri Due conformazioni dell etano. I differenti conformeri si interconvertono per rotazione attorno al legame C-C. 1 Rappresentazione a cavalletto e proiezione

Dettagli

David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita

David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita 1 David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis Biologia La scienza della vita 2 B - L ereditarietà e l evoluzione Il linguaggio della vita 3 Il materiale genetico

Dettagli

Modulo 8: I nucleotidi e gli acidi nucleici

Modulo 8: I nucleotidi e gli acidi nucleici Modulo 8: I nucleotidi e gli acidi nucleici Modulo 10: Acidi nucleici Filamento di DNA fuoriuscito da una cellula di Escherichia coli Struttura e funzioni dei nucleotidi Funzioni dei nucleotidi: Unità

Dettagli

DNA e replicazione del DNA

DNA e replicazione del DNA DNA e replicazione del DNA 1928: EXP di Griffith Scoperto il fattore trasformante Struttura elicoidale del DNA Struttura del DNA Subunità nucleotidiche Struttura del DNA Subunità nucleotidiche La replicazione

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 19 Acidi nucleici Concetti chiave: Le basi azotate dei nucleotidi comprendono due tipi di purine e tre tipi di pirimidine.

Dettagli

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno

Dettagli

Duplicazione del DNA. 6 Dicembre 2007

Duplicazione del DNA. 6 Dicembre 2007 Duplicazione del DNA 6 Dicembre 2007 Duplicazione - Trascrizione - Traduzione DNA Trascrizione DNA - La DUPLICAZIONE è il processo che porta alla formazione di copie delle molecole di DNA ed al trasferimento

Dettagli

Funzioni degli acidi nucleici sono conseguenza della loro struttura

Funzioni degli acidi nucleici sono conseguenza della loro struttura Funzioni degli acidi nucleici sono conseguenza della loro struttura 1.Informazione genetica. 2.Trasporto di energia. 3. Attività enzimatica (ribozimi). LE STRUTTURE La successione dei diversi tipi di monomeri

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson

Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Una divisione equa Quando una cellula si divide, si formano due nuove cellule che contengono esattamente

Dettagli

https://sites.google.com/site/colcito/

https://sites.google.com/site/colcito/ Acidi nucleici: il DNA e l RNA Il DNA, acido desossiribonucleico, è un polimero formato da una catena di monomeri, i nucleotidi Ogni nucleotide del DNA contiene uno zucchero, il desossiribosio, una base

Dettagli

02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI

02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI Tutti gli esseri viventi sono composti da cellule Eubatteri Procarioti unicellulari Archebatteri LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI -Autoconservazione mantenimento della

Dettagli

Organizzazione della materia

Organizzazione della materia Organizzazione della materia Elementi: sostanze che non possono essere scisse in altre più semplici mediante reazioni chimiche ordinarie. Atomo: è la porzione più piccola di un elemento, formato da 3 particelle

Dettagli

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi

COME È FATTO? Ogni filamento corrisponde ad una catena di nucleotidi Il DNA Il DNA è una sostanza che si trova in ogni cellula e contiene tutte le informazioni sulla forma e sulle funzioni di ogni essere vivente: eppure è una molecola incredibilmente semplice. COME È FATTO?

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

LA REPLICAZIONE DEL DNA

LA REPLICAZIONE DEL DNA www.fisiokinesiterapia.biz LA REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA Durante il processo di replicazione la doppia elica del DNA si srotola e ciascuno dei due filamenti funziona da stampo per un nuovo

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

DNA DNA DNA Legge di complementarietà delle basi Se in un filamento è presente una T nell altro filamento deve essere presente una A. Se è presente una C nell altro ci dovrà essere una G. E possibile

Dettagli

MODALITA DI REPLICAZIONE

MODALITA DI REPLICAZIONE MODALITA DI REPLICAZIONE In teoria è ipotizzabile che il DNA possa duplicarsi con modalità: 1) semi-conservativa se alla generazione successiva passano due doppie eliche entrambi costituite da un'elica

Dettagli

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto Topoisomerasi Il DNA di batteri, mitocondri, plastidi e alcuni virus è costituito da una doppia elica circolare. Consideriamo una molecola di DNA circolare a doppia elica rilassata e chiusa, formata da

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

Contenuto di DNA aploide in alcune specie

Contenuto di DNA aploide in alcune specie Contenuto di DNA aploide in alcune specie 1-10 2 kb 10 3 kb 10 4 kb 10 5-10 8 kb Dimensioni del genoma Paradosso del valore C Non c è una correlazione tra la quantità di DNA e la complessità di un organismo

Dettagli

D'Addario - Biologia Molecolare

D'Addario - Biologia Molecolare 2. Struttura del DNA contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale gli acidi nucleici, acido desossiribonucleico (DNA)

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Traduzione. Trascrizione

Traduzione. Trascrizione Duplicazione del DNA IL DNA è LA MOLECOLA DEPOSITARIA DELL INFORMAZIONE GENICA CHE DEVE ESSERE EREDITATA DI GENERAZIONE IN GENERAZIONE. PERTANTO LA STRUTTURA DEL DNA DEVE ESSERE TALE DA SODDISFARE AL MEGLIO

Dettagli

La genetica molecolare

La genetica molecolare La genetica molecolare 1 Il materiale genetico Varia di quantità da specie a specie. Regola lo sviluppo della cellula. Ha la capacità di duplicarsi. Nome comune Numero di coppie di cromosomi zanzara 3

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

CERCATE SU YOU TUBE I FILMATI DI BIOLOGIA CE NE SONO DI TUTTI I TIPI

CERCATE SU YOU TUBE I FILMATI DI BIOLOGIA CE NE SONO DI TUTTI I TIPI CERCATE SU YOU TUBE I FILMATI DI BIOLOGIA CE NE SONO DI TUTTI I TIPI IL MATERIALE GENETICO Fino agli anni 40 si credeva che le proteine fossero le molecole della informazione ereditaria. C erano comunque

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La Chimica della Vita

La Chimica della Vita La Chimica della Vita I componenti chimici delle cellule Nell atomo il numero di elettroni è uguale al numero di protoni del suo nucleo. Il nucleo dei diversi isotopi di uno stesso elemento contiene lo

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

I MOTORI DELL EVOLUZIONE PT2. POMERIGGIO DI AGGIORNAMENTO PROF. M.A. ZORDAN, Ph.D UNIVERSITÀ DEGLI STUDI DI PADOVA

I MOTORI DELL EVOLUZIONE PT2. POMERIGGIO DI AGGIORNAMENTO PROF. M.A. ZORDAN, Ph.D UNIVERSITÀ DEGLI STUDI DI PADOVA I MOTORI DELL EVOLUZIONE PT2 POMERIGGIO DI AGGIORNAMENTO 23.03.2011 PROF. M.A. ZORDAN, Ph.D UNIVERSITÀ DEGLI STUDI DI PADOVA 1 IL MATERIALE GENETICO 2 2 Per svolgere il proprio ruolo, il materiale genetico

Dettagli

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina CROMATINA Complesso molecolare formato da DNA, istoni e proteine non istoniche ISTONI Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina Si conoscono

Dettagli

Isomeria nelle molecole organiche

Isomeria nelle molecole organiche Isomeria nelle molecole organiche 3 Cis/Trans o Z/E 1 4 Regole di priorità negli alcheni: 1. Numero atomico maggiore=maggiore priorità; 2. Maggiore priorità all isotopo più pesante; 3. Se il primo atomo

Dettagli

Legami idrogeno tra le coppie di basi

Legami idrogeno tra le coppie di basi Legami idrogeno tra le coppie di basi 4 3 6 1 4 3 2 6 1 2 Interazioni elettrostatiche deboli che si stabiliscono tra un atomo elettronegativo (es.ossigeno o azoto) e un atomo di idrogeno legato ad un secondo

Dettagli

Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA

Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA Lunghezza del cromosoma di E.coli (1,7 mm) paragonata alla lunghezza di una tipica cellula di E. coli (2μm) DNA di una cellula

Dettagli

Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona

Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona Scientists with lab coats: Corso di laboratorio Chimico-Biologico Dott.ssa Valeria Berton Università di Verona Il DNA Il DNA contiene l informazione genetica di un organismo Scritta in un codice chimico

Dettagli

FORZE INTERMOLECOLARI o LEGAMI DEBOLI

FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E

Dettagli

Lezione 1: Atomi e molecole:

Lezione 1: Atomi e molecole: Lezione 1: Atomi e molecole: La materia è costituita da elementi chimici in forma pura o in combinazioni dette composti. La vita richiede circa 25 elementi chimici. La struttura atomica determina il comportamento

Dettagli

Acqua e macromolecole

Acqua e macromolecole Acqua e macromolecole La polarità della molecola dell acqua ha un enorme conseguenza, è responsabile della coesività della capacità di stabilizzare la temperatura delle proprietà di solvente dell

Dettagli

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica combustibili intermedi metabolici Impalcatura del DNA e RNA

Dettagli

IL LEGAME SIGMA σ E IL LEGAME PI- GRECO π

IL LEGAME SIGMA σ E IL LEGAME PI- GRECO π IL LEGAME SIGMA σ E IL LEGAME PI- GRECO π La teoria di Lewis considera gli elettroni di valenza degli atomi che formano legami,ma prescinde totalmente dal fatto che tali elettroni sono descritti da orbitali

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Biocristallografia: le proteine in 3D

Biocristallografia: le proteine in 3D Biocristallografia: le proteine in 3D Marco Nardini Dip. Scienze Biomolecolari e Biotecnologie Università degli studi di Milano Protein 3D structure www.protein.cusmibio 21-23 settembre 2011 Milano Biocristallografia

Dettagli

La trascrizione è simile alla replicazione ma esistono alcune importanti differenze

La trascrizione è simile alla replicazione ma esistono alcune importanti differenze LA TRASCRIZIONE processo nel quale il DNA stampo viene copiato in una molecola di RNA La molecola di RNA è identica in sequenza all elica codificante e complementare a quella stampo. La trascrizione è

Dettagli

Risposta: 2. Uracile. Risposta: 2. legami idrogeno. Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA.

Risposta: 2. Uracile. Risposta: 2. legami idrogeno. Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA. Risposta: 2. Uracile Adenina, Citosina e Guanina si trovano sia nell RNA che nel DNA. La Timina si trova soltanto nel DNA; l Uracile si sostituisce alla Timina nelle molecole dell RNA. Risposta: 2. legami

Dettagli

DNA: il materiale genetico

DNA: il materiale genetico DNA: il materiale genetico Corso di Genetica per Scienze e Tecnologie per l Ambiente e la Natura Alberto Pallavicini La ricerca del materiale genetico Il materiale responsabile dei caratteri ereditari

Dettagli

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente)

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente) OVERVIEW Atomo: più piccola porzione di un elemento che mantiene le proprietà chimiche dello stesso Teoria atomica e tavola periodica Legami e interazioni degli atomi Acqua e le sue proprietà Acidi e basi

Dettagli

Biologia Molecolare. CDLM in CTF La Replicazione del DNA

Biologia Molecolare. CDLM in CTF La Replicazione del DNA Biologia Molecolare CDLM in CTF 2010-2011 La Replicazione del DNA Prospettiva Storica La replicazione semidiscontinua Differenze tra procarioti ed eucarioti E fondamentale che ad ogni divisione cellulare

Dettagli

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi.

DNA - RNA. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. DNA - RNA Le unità fondamentali costituenti il DNA e l RNA sono i Nucleotidi. Nucleotide = Gruppo Fosforico + Zucchero Pentoso + Base Azotata. Esistono 4 basi azotate per il DNA e 4 per RNA Differenze

Dettagli

Dimensioni di Genomi

Dimensioni di Genomi Dimensioni di Genomi plasmids viruses bacteria fungi plants algae insects mollusks bony fish amphibians Il Genoma umano è costituito da circa 3 miliardi di bp e contiene un numero di geni pari a circa

Dettagli

Gerard Tortora, Brian Derrickson. Conosciamo

Gerard Tortora, Brian Derrickson. Conosciamo 1 Gerard Tortora, Brian Derrickson Conosciamo il corpo umano Capitolo 1 L organizzazione del corpo umano 1. Che cosa sono l anatomia e la fisiologia 2. I livelli di organizzazione e gli apparati del corpo

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli