La Spettrometria di Massa nello Studio di Proteine e Peptidi

Transcript

1 La Spettrometria di Massa nello Studio di Proteine e Peptidi Gianluca Giorgi Università degli Studi di Siena Dipartimento di Biotecnologie, Chimica e Farmacia via Aldo Moro Siena gianluca.giorgi@unisi.it Tel

2

3

4 La Spettrometria di Massa nello studio di Proteine e Peptidi 1. Studio di Proteine i) Estrazione ii) Separazione iii) Determinazione del PM i) MALDI-TOF: spettro, risoluzione ii) ESI: ioni multicarica, risoluzione iii) Quale massa? iv) Ricerca in banca dati iv) Determinazione della struttura (Sequenza AA): MS n i) Proteina in toto: ECD, ETD ii) Digestione enzimatica Peptidi i) MALDI: peptide mass fingerprinting ii) HPLC-ESI-MS e MS n iii) Ricerca in banca dati

5 1. Studio di Proteine i) Estrazione ii) Separazione iii) Determinazione del peso molecolare MALDI ESI

6 Proteine - Determinazione del PM MALDI-TOF: spettro, risoluzione MALDI-TOF linear mass spectrum of intact protein: Hg-Papain oligomerization

7 Proteine - Determinazione del PM MALDI-TOF: spettro, risoluzione MALDI TOF mass spectrum of a mixture of ubiquitin, cytochrome C and equine myoglobin using 2,5-dihydroxybenzoic acid (DHB) as the matrix.

8 Relative Abundance Relative Abundance citocromoc # 1-11 RT: AV: 11 SM: 9G NL: 7.40E5 F: p Full ms [ ] Proteine - Determinazione del PM ESI: ioni multicarica, risoluzione citocromoc # RT: AV: 7 SM: 9G NL: 1.61E4 m/z F: Z ms [ ] R= m/z

9 Relative Abundance Assegnamento delle cariche m/z

10 Relative Abundance Spettro deconvoluto in silico mass

11 ESI () of Ubiquitin 1,040,000 Resolution at m/z u 0.09u

12 Proteine & Peptidi- Determinazione del PM Spettrometria di massa.. Quale massa?

13 L accuratezza di massa diminuisce all aumentare della grandezza dello ione Poiché una proteina è una molecola grande, occorre elevatissima risoluzione e notevole accuratezza di massa (FT-ICR) per poter avere informazioni univoche sulla sua formula bruta

14 La Spettrometria di Massa nello studio di Proteine e Peptidi 1. Studio di Proteine i) Estrazione ii) Separazione iii) Determinazione del PM i) MALDI-TOF: spettro, risoluzione ii) ESI: ioni multicarica, risoluzione iii) Quale massa? iv) Ricerca in banca dati iv) Determinazione della struttura (Sequenza AA): MS n i) Proteina in toto: ECD, ETD ii) Digestione enzimatica Peptidi i) MALDI: peptide mass fingerprinting ii) HPLC-ESI-MS e MS n iii) Ricerca in banca dati

15 Determinazione della struttura: MS n i) Proteina in toto: CID non riesce a frammentare ioni prodotti da molecole grandi (PM > 3000 ca) La decomposizione di ioni prodotti da molecole grandi può avvenire solo attraverso l interazione con elettroni: ECD = electron capture dissociation (FT-ICR) ETD = electron transfer dissociation (2D e 3D IT)

16 Determinazione della struttura: MS n i) Proteina in toto: ECD = electron capture dissociation (FT-ICR) ETD = electron transfer dissociation (Linear IT) Approccio Top Down

17 Determinazione della struttura Proteina in toto ECD, EDT MS 2 Proteina [MnH] n Frammenti

18 Determinazione della struttura ii) Digestione enzimatica Peptidi Enzyme 1 Protein (in solution) Many Peptides (in solution)

19 Trypsin: Lys, Arg S S Approccio Bottom Up

20 Database search

21 Intensity Identification of a Protein via Peptide Mass Fingerprinting Direct analysis of the entire peptide mixture m/z Search Engine MQRVNMIMAESPSLITICLLGYLLSAECT VFLDHENANKILNRPKRYNSGKLEEFVQ GNLERECMEEKCSFEEAREVFENTEK TTEFWKQYVDGDQCESNPCLNGGSCK DDINSYECWCPFGFEGKNCELDVTCNI KNGRCEQFCKNSADNKVVCSCTEGYR LAENQKSCEPAVPFPCGRVSVSQTSK LTRAEAVFPDVDYVNPTEAETILDNITQ GTQSFNDFTRVVGGEDAKPGQFPWQ VVLNGKVDAFCGGSIVNEKWIVTAAHC VETGVKITVVAGEHNIEETEHTEQKRN VIRAIIPHHNYNAAINKYNHDIALLELDE PLVLNSYVTPICIADKEYTNIFLKFGSG YVSGWGRVFHKGRSALVLQYLRVPLV DRATCLRSTKFTIYNNMFCAGFHEGG RDSCQGDSGGPHVTEVEGTSFLTGII SWGEECAMKGKYGIYTKVSRYVNWIK EKTKLT

22 Relative Intensity Protein identification by peptide mapping 100 MALDI-TOF-MS # 16 Da ox Met Mass/Charge Database search ( Aldolase A 1 PYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTEN 51 TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSK 101 GGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCV 151 LKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKR 201 CQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAM 251 ATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFS 301 YGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGA 351 AASESLFVSNHAY

23 MS of a peptide mixture by MALDI-TOF

24 Peptide mass fingerprinting MALDI-TOF

25 Identification of a spot based on peptide mapping Protein identifications were made by peptide mass mapping (peptide mass fingerprinting) using an unspecified search program and an unspecified database.

26 Se il TOF ha alta risoluzione, è possibile determinare la massa accurata e la formula bruta di ciascun peptide Se proteine diverse, digerite con lo stesso enzima nelle stesse condizioni sperimentali, producono lo stesso peptide mass fingerprint, le due proteine sono uguali

27 Proteine: Determinazione della struttura Digestione enzimatica Peptidi HPLC-ESI-MS e MS n Database search peptide MW HPLC separation

28 HPLC-MS Enzyme Tempo di ritenzione di ciascun peptide MS

29 Relative Abundance R=500 R=2000 R= MS m/z

30 Relative Abundance R=500 R=2000 R= MS m/z

31 Se si dispone di un analizzatore con alta risoluzione e massa accurata settori, ToF, Orbitrap, FT-ICR è possibile misurare la massa accurata di ciascun peptide e quindi la formula bruta Poiché le tecniche di ionizzazione utilizzate sono soft non si ha frammentazione in sorgente e quindi non si hanno informazioni strutturali, ovvero non è possibile determinare la sequenza AA

32 Proteine: Determinazione della struttura Digestione enzimatica Peptidi HPLC-ESI-MS e MS n Database search CID-MS n peptide MW HPLC separation

33 CID-MS n di peptidi x 3 y 3 z 3 x 2 y 2 z 2 x 1 y 1 z 1 a 1 b 1 c 1 a 2 b 2 c 2 a 3 b 3 c 3 Ioni C-terminali: y, x, z Ioni N-terminali: b, a, c

34

35 Why b ions are very stable species? They don t have an acylium ion structure R-C O but they have a cyclic oxazolonic structure

36 Spectroscopic Evidence for an Oxazolone Structure of the b 2 Fragment Ion from Protonated Tri-Alanine Oomens J et al, J. Am. Soc. Mass. Spectrom. 20, 334 (2009)

37 Whenever you identify a b ion look for an a ion at -28u. This gives some assurance that your assignment is correct. Also look for ammonia and water losses, -17 and -18u respectively.

38

39 Relative Abundance Relative Abundance Attribuire la giusta sequenza al peptide Gly Phe Tyr Gly Leu/Ile C:\CIADS\...\peptide-ms7\peptide99 Residui AA: Gly 57 Phe 147 Tyr 163 Leu/Ile 113 peptide99 # RT: AV: 2 NL: 2.41E6 F: p Full ms [ ] m/z peptide99 # RT: AV: 19 NL: 6.73E5 F: p Full ms @24.00 [ ] MS 2 m/z b = m/z a 4

40 Relative Abundance Relative Abundance peptide99 # RT: AV: 24 NL: 1.54E5 F: p Full ms @ @19.00 [ ] 100 a Residui AA: Gly 57 Phe 147 Tyr 163 Leu/Ile MS 3 m/z 556 m/z 425 b m/z C:\CIADS\...\peptide-ms7\peptide99 21/02/ peptide99 # RT: AV: 10 NL: 6.20E3 F: p Full ms @ @ @25.00 [ ] MS 4 m/z 556 m/z 425 m/z 397 b a m/z

41 Relative Abundance Relative Abundance peptide99 # RT: AV: 6 NL: 1.11E4 F: p Full ms @ @ @ @22.00 [ ] MS 5 m/z 556 b 2 Residui AA: Gly 57 Phe 147 Tyr 163 Leu/Ile m/z b m/z =57 30 m/z m/z peptide99 # RT: AV: 21 NL: 6.61E3 F: p Full ms @ @ @ @ @21.00 [ ] MS 6 m/z 397 a 2 b a m/z 278 m/z

42 Relative Abundance peptide99 # RT: AV: 38 NL: 7.87E2 F: p Full ms @ @ @ @ @ @22.00 [ MS 7 m/z m/z 278 m/z 221 a m/z b m/z

43 Tyr-Gly-Gly-Phe-Leu H O a 1 a 2 O a 4 O H 2 N N H N H N H N H O H O O b 4 O b 1 b 2 b 3

44 Relative Abundance Relative Abundance Attribuire la sequenza al peptide C:\CIADS\...\peptide-ms7\peptide99 peptide99 # RT: AV: 2 NL: 2.41E6 F: p Full ms [ ] m/z peptide99 # RT: AV: 19 NL: 6.73E5 F: p Full ms @24.00 [ ] MS 2 m/z b y m/z a

45 Cyclic peptides: Naturally occurring in bacteria, fungi and plants Synthetic compounds They can have a lot of biological and pharmaceutical properties: enzyme inhibitors, antifungal and antibacterial agents, immunosuppressant, antibiotics and anticancer drugs Better bioavailability and higher resistance to proteolytic degradation than their linear analogues Highly selective metal ion chelators: carriers of metal ions inside the cells. Use in radiotherapy

46 Brodbelt et al. J Am Soc Mass Spectrom 2004, 15,

47 Characterization and sequencing of cyclic peptides represent an important challenge for mass spectrometry. No definite terminations, as it occurs in their linear analogues. The elimination of an aminoacidic residue must involve the fission of two bonds of the cycle. The ring-opening may occur at several backbone positions, meaning that all the fragment ions are not referenced to a single terminal position.

48 Relative Abundance peptidedk13_elisa_ # 161 RT: 1.05 AV: 1 NL: 1.06E9 F: FTMS p ESI Full ms [ ] R= [M 2H] [M H] R= [M 3H] R=

49 Resolving powers: Orbitrap: at constant detection time: resolving power inversely proportional to m/z Thus if R=100,000 at m/z 100, at m/z 1000 it will be R=100,000(100/1000) 1/2 =31,646

50 RDB=double bond/ring equivalents For ions with odd charge: Odd-electron ions = RDB integer Even-electron ions= RDB x.5 12 C C N O H 0 60

51 Relative Abundance peptidedk13_elisa_ # RT: AV: 60 NL: 1.09E9 F: FTMS p ESI Full ms [ ] [M 2H]

52

53 Relative Abundance peptidedk13_elisa_ # RT: AV: 60 NL: 1.09E9 F: FTMS p ESI Full ms [ ]

54 Relative Abundance peptidedk13_elisa_ # 161 RT: 1.05 AV: 1 NL: 8.24E7 F: FTMS p ESI Full ms [ ] R= [M 3H] R= R=

55

56 Relative Abundance peptidedk13_elisa_ # RT: AV: 54 NL: 3.03E7 F: FTMS p ESI Full ms @cid20.00 [ ] (0.49) (0.07) 95 Residui AA: H 2 O -Lys Lys 128 His 137 Ala/β-Ala (0.43) -His -Lys β-ala NH 3 -His -Lys -His H 2 O [MH (NH 3 CH 2 O)] NH [MH]

57 Relative Abundance Peptide-solo2 # 1-16 RT: AV: 16 NL: 2.10E5 F: p Full ms @cid @cid22.00 [ ] CID-MS 3 [MH-Lys] Residui AA: Lys 128 His 137 Ala/β-Ala His H 2 O [MH-Lys]

58 N NH O O NH HN NH NH O O NH 2 N NH c-(lys-d/l-his-β-ala-his)

59 N NH O NH H HN O O HN HN NH 2 N H 2 N H N H N N NH NH NH O O O O NH 2 O N b 3 K/H m/z 346 O NH HN - N H N H 2 N H N O O N NH m/z 209

60 b 3 K/H m/z 346

61 N NH O O NH NH H O HN NH HN - N H N H 2 N O N O H HN O NH 2 O O HN N NH 2 N NH y 3 K/H m/z H 2 N O NH H 2 N H N N NH O O m/z 209

62 CID-MS 2 [M2H] 2 LysH LysH [M H 2 O2H] LysH [M NH 3 H 2 O2H] 2 HisβAlaH HisβAlaH HisH [M2H] m/z

63 Intensità Relativa (%) CID-MS 2 [M-H] His Lys 60 - β-ala -His His H 2 O 30 - β-ala His - β-ala m/z

64 If you are working with a tryptic peptide, look for the arginine or lysine y 1 ion at the low end of the spectrum: [MH] = penultimate b ion [MH] = penultimate b ion Arg is the carboxy AA Lys is the carboxy AA This may give you a clue to the C-terminal residue of your tryptic peptide. In general: protonated peptide - AA residue mass - 18 = penultimate b ion or you could use the standard formula for calculating the corresponding b ion once the y ion is known. [MH] - y 1 1 = penultimate b ion If you are using an ion trap you may not be able to observe the low end of the spectrum, and in this case, you will need to do both of these calculations

65 [MH] - observed b ion 1 = corresponding y ion.

66 Digerito triptico [MH] = 1379 (14 AA) MS/MS m/z 1379 (ion trap)

67

68 Digerito triptico [MH] = 1182 (10 AA) MS/MS m/z 1182 (ion trap)

69 ETD, ECD High Collision CID Ions c, z

70

71

72

73 x 3 y 3 z 3 x 2 y 2 z 2 x 1 y 1 z 1 a 1 b 1 c 1 a 2 b 2 c 2 a 3 b 3 c 3

74 Loss of One Phosphorylation Loss of Two Phosphorylations 74

75 La piccola Oxford, dopo aver copiato male i giardini di Babilonia (1894 a.c.) persevera.. Gli strumenti purtroppo sono ancora spenti perchè è finito l'elio. L'Ateneo non ha ancora sottoscritto l'accordo quadro per la fornitura dei gas ce li potranno portare solo da lunedì. Ho riacceso le pompe, ma per l'elettronica aspettavo di avere l'elio. Comunque se vuoi utilizzare i pc e far vedere analisi acquisite puoi tranquillamente utilizzarli. Lunedì comunque spero che mantengano l'impegno e ci portino la bombola così da martedì, sempre che non sopraggiungano guasti, gli strumenti saranno utilizzabili al 100%.

76 Relative Abundance Single Scan Ion Trap CID with ICR Cell Detection 100 R P K P Q Q F F G L M B B 3 B 8 2 B 10 2 B [M2H] B B Ion Theoretical Measured ppm B B B B B [M2H] B B B Y* B Y B Fragments identified with a average error of 0.03 ppm B Y 9 B B m/z 76

77 Relative Abundance Single Scan IRMPD with ICR Cell Detection R P K P Q Q F F G L M B B B [M2H] B B 8 2 B 7 Ion Theoretical Measured ppm B B B B B [M-NH3] M B B B Y* Y Fragments identified with a average error of 0.58 ppm m/z B 8 Y 9 77

78 Relative Abundance Single Scan ECD with ICR Cell Detection R P K P Q Q F F G L M [M2H] C 5 C 4 C Ion Theoretical Measured ppm C C [M2H] C C C Z C C [M-NH3] [M2H] Fragments identified with a average error of 0.56 ppm [M2H] [M-NH 3] m/z C 7 C 8 Z C C 10 78

79 Top down vs approaches Bottom up for studying large molecules

80 Determinazione della struttura: MS n i) Proteina in toto: ECD = electron capture dissociation (FT-ICR) ETD = electron transfer dissociation (Linear IT) Approccio Top Down

81

82

83 x 3 y 3 z 3 x 2 y 2 z 2 x 1 y 1 z 1 a 1 b 1 c 1 a 2 b 2 c 2 a 3 b 3 c 3

84

85 Top down

86 ETD Electron Transfer Dissociation

87 Loss of One Phosphorylation Loss of Two Phosphorylations Courtesy by G. Vago Thermo

88 Basta comprare lo strumento. Poi è tutto automatico! È FALSO!!!

89 Lo strumentino che si autogestisce NON ESISTE!!!

90 Basta il kit! È FALSO!!!

91 L era del click e lo spettro è fatto NON VERRÀ MAI!!!

92 Identificare X / Determinare la quantità di Y CAMPIONE ESTRAZIONE PURIFICAZIONE ANALISI GC-, HPLC- MS, MS/MS Quale informazione voglio ottenere? Qual è l esperimento più appropriato (sensibilità, selettività, velocità, ecc )? scelta corretta del tipo di esperimento conoscenza teorica corretta esecuzione conoscenza teorico-pratica

93 Identificare X / Determinare la quantità di Y CAMPIONE ESTRAZIONE PURIFICAZIONE ANALISI RISULTATO IL COMPUTER HA DETTO.!!!! INTERPRETAZIONE Ipse dixit!

94 Identificare X / Determinare la quantità di Y CAMPIONE ESTRAZIONE PURIFICAZIONE ANALISI RISULTATO INTERPRETAZIONE Un risultato affidabile richiede: scelta corretta del tipo di esperimento corretta esecuzione corretta interpretazione dei dati