Struttura secondaria

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Struttura secondaria"

Transcript

1 Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j = r sin (j2p h z /P + d 0 ) r :raggio dell'elica; h z : distanza, sull'asse z, tra due residui adiacenti P: distanza in z che l'elica deve percorrere per fare un giro intero z 0 e d 0 danno la posizione dello 0-esimo residuo x r cos d ; y r sin ( d0 )

2 Proiezione sul piano x-y x d y Due residui risultano sovrapposti dopo un giro completo dell elica: J P h z grado (passo) dell elica Struttura lineare un solo residuo per giro: r = 0 x j =y j =0 z j =jh z + z 0 P = h z x j = r cos d; y j = r sin d Catene laterali

3 a-elica Densità elettronica da diffrazione ai raggi X di Mioglobina acqua eme Istidina distale pdb

4 L a elica è stata prevista 6 anni prima della prima evidenza sperimentale (Pauling & Corey) come la struttura che massimizza i legami H, NH...OC 1.5Å 100 di rotazione 5Å movie

5 La prolina inserita nella catena polipetdica non ha l idrogeno sul gruppo aminico, quindi non può formare il legame H che stabilizza sia l α elica che il β sheet. La prolina si trova spesso alla fine di un tratto in α elica, in un turn o in un loop. Contrariamente agli altri aa che esistono quasi esclusivamente nella forma trans la prolina può trovarsi anche in cis. Energeticamente le due configurazioni trans, estesa, e cis, compatta, sono equivalenti (isomerizzazione cis-trans). movie

6 Collagene: proteina strutturale (tendini, cartilagini, ossa, pelle)

7 Figure Molecular Biology of the Cell ( Garland Science 2008) Elica sinistra con 3 aa per giro e una glicina ogni tre aa

8 CO1A1_HUMAN Collagen alpha-1(i) MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV PGPPGAVGPAGKDGEAGAQGPPGPAAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGP VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII DVAPLDVGAPDQEFGFDVGPVCFL G: glicina isolata GP: diade P: prolina isolata

9 Fibrille di collagene disposte a 90 una rispetto all altra Figure Molecular Biology of the Cell ( Garland Science 2008)

10 movie b-turn

11 antiparallelo parallelo

12

13 DG T = DG di trasferimento = DG etanolo-acqua etanolo acqua DG << 0 solvatazione dello zwitterione DG di trasferimento = DG T - DG T (glicina)

14 A ala 1,8 ali C cys 2,5 D asp -3,5 pol E glu -3,5 pol F phe 2,8 aro G gly -0,4 ali H his -3,2 pol I ile 4,5 ali K lys -3,9 pol L leu 3,8 ali M met 1,9 N asn -3,5 pol P pro -1,6 Q gln -3,5 pol R arg -4,5 pol S ser -0,8 ali+oh T thr -0,7 ali+oh V val 4,2 ali W trp -0,9 aro Y tyr -1,3 aro 1. ali: catene laterali alifatiche 2. aro: catene laterali aromatiche 3. ali + OH: catene laterali alifatiche + OH 4. pol: catene laterali polari a) D, E, R, H, K: catene laterali cariche b) A, I, L, V, + G: alifatici + Glicina c) N, C, Q, S, T, Y: polari non carichi d) M, P, F, W: non polari Kyte and Doolittle, J.Mol.Biol. (1982) 157:

15

16

17

18 Chou-Fasman propensities Amino Acid a-helix b-sheet Turn Ala Cys Leu Met Glu Gln His Lys Val Ile Phe Tyr Trp Thr Gly Ser Asp Asn Pro Arg Favors a-helix Favors b-sheet Favors Turns Unlike the more complex GOR method, it does not reflect the conditional probabilities of an amino acid to form a particular secondary structure given that its neighbors already possess that structure.

19 Looking for sequence physico-chemical properties The primary sequences translated in a string of characters A. Each monomer (aa) a symbol (e.g. a letter) B. Each class (chemical properties) a symbol (e.g. a letter, a number, ) C. each monomer (aa) a real number (e.g. hydropathy) D. A. One-letter-code Translation D Y L A T E E Q W G I H B. Example of classification a c b b c a a c d b b a C. Hydropathy index 1. ali: catene laterali alifatiche 2. aro: catene laterali aromatiche 3. ali + OH: catene laterali alifatiche + OH 4. pol: catene laterali polari a) D, E, R, H, K: catene laterali cariche b) A, I, L, V, + G: alifatici + Glicina c) N, C, Q, S, T, Y: polari non carichi d) M, P, F, W: non polari

20

21 Profilo di proprietà La «traduzione» definisce una funzione discreta g(n) dove n è la posizione lungo la sequenza n g(n) : peso M ( n) A(m) g( n) M( n) k m n 2 k m n 2 1 A( m) g( m) : smoothing = valore medio calcolato in una finestra di ampiezza k 1 k

22 movie

23

24

25

26

27

28 Spettro di potenza k 1 m n 2 G( n) g( m) e k 1 m n 2 1wm 2 ad w fissato La funzione G(n) avrà dei picchi in corrispondenza di quei valori di w che corrispondono ad un andamento periodico della g(n) apri pdb

29 miosina F( w) L m 1 g( m) e 2p i mw L a elica

30 vedi pdb Miosina

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali):

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali): AMINOAIDI. Proteine (gr. pròtos = primo) > 50% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida (o alcalina) α-aminoacidi Struttura generale degli α-aminoacidi primari (standard,

Dettagli

Visualizzazioni 3D. Informatica. Matrice di voxel. Tipi di dato. Dati vettoriali. Tecniche di rappresentazione

Visualizzazioni 3D. Informatica. Matrice di voxel. Tipi di dato. Dati vettoriali. Tecniche di rappresentazione Informatica Lezione VIII Visualizzazione 3D di proteine Visualizzazioni 3D Rappresentazione di strutture/oggetti tridimensionali Risultato di un esperimento modello teorico dati fisici astrazione 1 Lezione

Dettagli

Una proteina nella rete: Caccia al tesoro bioinformatica

Una proteina nella rete: Caccia al tesoro bioinformatica Una proteina nella rete: Caccia al tesoro bioinformatica Nel corso di questa attivita utilizzeremo alcune delle piu importanti banche dati disponibili in rete per cercare informazioni su una proteina.

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA Email: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Macromolecole Biologiche. I domini (III)

Macromolecole Biologiche. I domini (III) I domini (III) Domini α/β La cross over connection è l unità costitutiva su cui si basa la topologia di 3 tipi di domini α/β osservati nelle proteine: - α/β barrel - motivi ricchi di Leu (fold a ferro

Dettagli

Traduzione dell informazione genetica (1)

Traduzione dell informazione genetica (1) Traduzione dell informazione genetica (1) 1 Traduzione dell informazione genetica (2) Il processo negli eucarioti richiede: 70 diverse proteine ribosomiali >20 enzimi che attivano i precursori degli amminoacidi

Dettagli

3.3. UMAMI NEGLI ALIMENTI

3.3. UMAMI NEGLI ALIMENTI 3.3. UMAMI NEGLI ALIMENTI In questo capitolo saranno esaminati i vari cibi, ad esclusione di quelli ittici che verranno presi in considerazione successivamente, allo scopo di scoprire se in essi è presente,

Dettagli

PROTIDI: LE PROTEINE E GLI AMMINOACIDI

PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Elementi di Bioinformatica. Genomica. Introduzione

Elementi di Bioinformatica. Genomica. Introduzione Corso di Elementi di Bioinformatica Ingegneria Biomedica AA 2013-14 Elementi di Bioinformatica Genomica Introduzione Genomica Genomica (genomics) Riguarda lo studio del genoma degli organismi viventi e,

Dettagli

Le proteine. Le proteine sono macromolecole che presentano differenze funzionali e strutturali

Le proteine. Le proteine sono macromolecole che presentano differenze funzionali e strutturali Le proteine Le proteine sono macromolecole che presentano differenze funzionali e strutturali LE PROTEINE HANNO FUNZIONI BIOLOGICHE DIVERSE enzimi proteine di trasporto proteine strutturali proteine di

Dettagli

Macromolecole Biologiche. I domini (I)

Macromolecole Biologiche. I domini (I) I domini (I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una

Dettagli

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure 3.3.2. ALIMENTI DI ORIGINE VEGETALE 3.3.2.1. Verdure Nella Tabella 9 sono riportati i valori degli aminoacidi liberi presenti in alcune fra le più diffuse verdure in commercio. In un passato recente era

Dettagli

Rappresentazione dei Dati Biologici

Rappresentazione dei Dati Biologici Rappresentazione dei Dati Biologici CORSO DI BIOINFORMATICA C.d.L. Ingegneria Informatica e Biomedica Outline Proteine ed Amminoacidi Rappresentazione di Amminoacidi Rappresentazione delle strutture Proteiche

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

delegate a conservare e trasmettere l'informazione genetica. Oggi é noto che sono gli acidi

delegate a conservare e trasmettere l'informazione genetica. Oggi é noto che sono gli acidi 8. Le proteine Il termine "proteina" (dal greco προτειος: di primaria importanza) fu coniato nel 1838 dal chimico svedese J. Berzelius 1 quando ancora si riteneva che le proteine fossero le molecole delegate

Dettagli

Aminoacidi e proteine

Aminoacidi e proteine Prof. Giorgio Sartor Aminoacidi e proteine Copyright 2001-2012 by Giorgio Sartor. Versione 1.7.1 mar 2012 All rights reserved. Le cellule V.1.7.1 gsartor 2001-2012 Aminoacidi e proteine -2- Aminoacidi

Dettagli

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario

Il DNA e la duplicazione cellulare. Acidi nucleici: DNA, materiale ereditario Il DN e la duplicazione cellulare Il DN, materiale ereditario Struttura del DN Replicazione del DN Dal DN alla proteina Il odice genetico iclo cellulare Mitosi Meiosi Da Figura 8-11 ampbell & Reece cidi

Dettagli

Domini nelle Proteine

Domini nelle Proteine Struttura secondaria, Motivi e Domini nelle Proteine Proprietà generali Le forme ioniche degli aminoacidi, senza considerare alcuna ionizzazione delle catene laterali. Proprietà generali Tutti gli aminoacidi

Dettagli

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE Nell ultima fase della sintesi proteica la catena polipeptidica neosintetizzata assume spontaneamente la sua conformazione nativa (massimo numero di legami

Dettagli

Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

FORMAGGIO - DETERMINAZIONE DEL CONTENUTO DI AMMINOACIDI LIBERI

FORMAGGIO - DETERMINAZIONE DEL CONTENUTO DI AMMINOACIDI LIBERI Decreto n. 6890 ALLEGATO : METODO DI ANALISI FORMAGGIO - DETERMINAZIONE DEL CONTENUTO DI AMMINOACIDI LIBERI 1. SCOPO E CAMPO DI APPLICAZIONE Questo standard descrive la determinazione del contenuto di

Dettagli

INTRODUZIONE ALLA PROTEINE BCP 1-2

INTRODUZIONE ALLA PROTEINE BCP 1-2 INTRODUZIONE ALLA BIOCHIMICA DELLE PROTEINE BCP 1-2 Pietre miliari Lehninger 1973 Biochemistry Proteine ricombinanti Protein engineering Cristallografia, NMR, EM, MS, spettroscopie... Computing Bioinformaticai

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA E-mail: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini.

I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita da uno o più domini. I domini sono definiti come una catena polipeptidica

Dettagli

La diagnosi genetica della talassemia. Dott.ssa L.Pagano. Unità Operativa Microcitemia Dipartimento di Onco-Ematologia A.O.R.N. A.

La diagnosi genetica della talassemia. Dott.ssa L.Pagano. Unità Operativa Microcitemia Dipartimento di Onco-Ematologia A.O.R.N. A. Diapositiva 1 La diagnosi genetica della talassemia Dott.ssa L.Pagano Unità Operativa Microcitemia Dipartimento di Onco-Ematologia A.O.R.N. A. Cardarelli Napoli 2 Dicembre 2005 Castel dell Ovo Sala Virgilio

Dettagli

mediante proteasi industriali

mediante proteasi industriali Valorizzazione delle farine disoleate mediante proteasi industriali Alessandra Stefan Unità operativa: CSGI (Consorzio per lo Sviluppo dei Sistemi a Grande Interfase, Firenze) Dipartimento di Farmacia

Dettagli

La sintesi delle proteine

La sintesi delle proteine La sintesi delle proteine Struttura del trna In che modo l informazione contenuta sotto forma di sequenze nucleotidiche nel DNA e nell RNA si traduce nella sequenza amminoacidica delle proteine? Esperimenti

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

BIOMOLECOLE STRUTTURA E FUNZIONE

BIOMOLECOLE STRUTTURA E FUNZIONE BIOMOLECOLE STRUTTURA E FUNZIONE Lo studio delle relazioni tra struttura e funzione nelle biomolecole è uno degli aspetti più importanti per la comprensione del funzionamento dei processi biologici La

Dettagli

proteasi (distrugge le proteine) batteri virulenti del ceppo S e del ceppo R

proteasi (distrugge le proteine) batteri virulenti del ceppo S e del ceppo R unità 1. La funzione del DN negli organismi La funzione del DN L acido desossiribonucleico o DN (dall inglese deoxyribonucleic acid) è la molecola informazionale delle cellule. Essa contiene e trasmette

Dettagli

Amminoacidi e Proteine

Amminoacidi e Proteine Amminoacidi e Proteine Struttura generale di un α-amminoacido R = catena laterale AMMINOACIDI (AA) CELLULARI Gli amminoacidi presenti nella cellula possono essere il prodotto di idrolisi delle proteine

Dettagli

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE

Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE Dipartimento Di Scienze Della Vita STRUTTURA DELLE PROTEINE LE PROTEINE possono assumere 4 LIVELLI DI ORGANIZZAZIONE STRUTTURA PRIMARIA SEQUENZA degli amminoacidi STRUTTURA SECONDARIA Ripiegamento locale

Dettagli

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini.

formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. Idomini(I) I domini I motivi generalmente si combinano a formare strutture globulari compatte, chiamate domini. Una proteina può essere costituita i da unoo più domini. I domini sono definiti come parte

Dettagli

4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,

Dettagli

Macromolecole Biologiche. I domini (II)

Macromolecole Biologiche. I domini (II) I domini (II) Domini β Nonostante l elevato numero di possibili disposizioni di filamenti β (a costituire foglietti β antiparalleli) connessi da tratti di loop, i domini β più frequentemente osservati

Dettagli

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi Proteine Biopolimeri degli α-amino acidi. Amino acidi sono uniti attraverso il legame peptidico. Alcune funzioni: Struttura (collagene, cheratina ecc.) Enzimi (maltasi, deidrogenasi ecc) Trasporto (albumine,

Dettagli

Insulina e cancro. Luca Monge SSD Diabetologia AO CTO/Maria Adelaide - Torino

Insulina e cancro. Luca Monge SSD Diabetologia AO CTO/Maria Adelaide - Torino Insulina e cancro Luca Monge SSD Diabetologia AO CTO/Maria Adelaide - Torino Insulino-resistenza Iperinsulinismo Lo stato iperglicemico/iperinsulinemico dell insulino-resistenza è proinfiammatorio ed è

Dettagli

Metalli in Biologia. Metalli e leganti bio

Metalli in Biologia. Metalli e leganti bio Metalli in Biologia Metalli e leganti bio La struttura della mioglobina La struttura della emoglobina John Cowdery Kendrew MRC, Cambridge, UK Nobel Prize in 1962 Max Ferdinand Perutz MRC, Cambridge, UK

Dettagli

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA.

Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica. Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. Mutagenesi: introduzione di alterazioni in una sequenza nucleotidica Mutagenesi random: le mutazioni avvengono a caso su un tratto di DNA. In genere si ottengono trattando il DNA con agenti chimici (es.

Dettagli

LE PROTEINE. Le proteine sono i biopolimeri piu' abbondanti negli organismi viventi e svolgono funzioni biologiche di fondamentale importanza:

LE PROTEINE. Le proteine sono i biopolimeri piu' abbondanti negli organismi viventi e svolgono funzioni biologiche di fondamentale importanza: LE PRTEINE Le proteine sono i biopolimeri piu' abbondanti negli organismi viventi e svolgono funzioni biologiche di fondamentale importanza: PRTEINE CATALITICHE PRTEINE REGLATRICI PRTEINE DIFESA PRTEINE

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE

MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE MODIFICAZIONI POST-TRADUZIONALI DELLE PROTEINE Nell ultima fase della sintesi proteica la catena polipeptidica neosintetizzata assume spontaneamente la sua conformazione nativa (massimo numero di legami

Dettagli

La funzione delle proteine dipende dalla loro struttura tridimensionale

La funzione delle proteine dipende dalla loro struttura tridimensionale La funzione delle proteine dipende dalla loro struttura tridimensionale La struttura dipende dal ripiegamento di particolari sequenze aminoacidiche La sequenza aminoacidica della catena polipeptidica è

Dettagli

dieta vengono convertiti in composti dei corpi chetonici.

dieta vengono convertiti in composti dei corpi chetonici. Metabolismo degli aminoacidi Metabolismo degli aminoacidi Gli aminoacidi introdotti in eccesso con la dieta vengono convertiti in composti precursori del glucosio, degli acidi grassi e dei corpi chetonici.

Dettagli

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA Svolgono la loro funzione legando reversibilmente l OSSIGENO. Aumentano la solubilità dell ossigeno nel plasma, da 3ml/L a 220 ml/l. La mioglobina

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine Nelle proteine vi sono quattro livelli di organizzazione strutturale Struttura Primaria: sequenza di aminoacidi legati tra loro da legami peptidici Tutte le proteine esistenti

Dettagli

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno

Dettagli

corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata lunga catena di ammino acidi struttura spaziale organizzata

corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata lunga catena di ammino acidi struttura spaziale organizzata STRUTTURA DELLE PROTEINE Peptide: corta catena (meno di 20 ammino acidi) mancanza di una struttura spaziale organizzata Polipeptide (proteina): lunga catena di ammino acidi struttura spaziale organizzata

Dettagli

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,

Dettagli

DEAMINAZIONE AA - 7. ADP + Pi ATP. glutamina sintetasi. glutaminasi COO CH 2 NH + 4. + _ COO L-glutamato (Glu) COO. L-glutamina (Gln) COO 2 H2O

DEAMINAZIONE AA - 7. ADP + Pi ATP. glutamina sintetasi. glutaminasi COO CH 2 NH + 4. + _ COO L-glutamato (Glu) COO. L-glutamina (Gln) COO 2 H2O C DEAMIAZIE AA - 7 ATP ADP Pi C C C C 3 4 glutamina sintetasi C C 3 L-glutamato (Glu) L-glutamina (Gln) C C 4 C C C 3 L-glutamina (Gln) glutaminasi C C 3 L-glutamato (Glu) DEAMIAZIE AA - 8 tessuti extraepatici,

Dettagli

Capitolo 17. Risposte alle domande interne al capitolo. 17.1 (p. 501) a. glicina. b. prolina. c. treonina. d. aspartato

Capitolo 17. Risposte alle domande interne al capitolo. 17.1 (p. 501) a. glicina. b. prolina. c. treonina. d. aspartato apitolo 17 Risposte alle domande interne al capitolo 17.1 (p. 501) a. glicina b. prolina c. treonina d. aspartato e. 17.2 (p. 501) a. La glicina è un aminoacido idrofobico. b. La prolina è un aminoacido

Dettagli

Trasduzione del Segnale da Recettori di Superfice

Trasduzione del Segnale da Recettori di Superfice Trasduzione del Segnale da Recettori di Superfice MEMBRANA 1. Legame recettore-ligando 2. oligomerizzazione 3. Attivazione TYR-K -Dominio citosolico dei RTK -Reclutamento TYR-K (src, jak, fak, abl) 4.

Dettagli

REGOLAZIONE DELL ESPRESSIONE GENICA

REGOLAZIONE DELL ESPRESSIONE GENICA REGOLAZIONE DELL ESPRESSIONE GENICA Solo una piccola parte dei 4000 geni che costituiscono il genoma batterico o dei circa 30000 geni del genoma umano viene espressa in maniera costante (GENI COSTITUTIVI)

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui

la struttura tridimensionale può essere ottenuta solo per Un intero dominio in genere da 50 a 300 residui Durante la traduzione l informazione di ripiegamento codificata nella sequenza aminoacidica diventa disponibile in maniera vettoriale la struttura tridimensionale può essere ottenuta solo per Un intero

Dettagli

D ora in poi ci occuperemo, per semplicità, soltanto della RNA polimerasi II.

D ora in poi ci occuperemo, per semplicità, soltanto della RNA polimerasi II. RNA Polimerasi di eucarioti (vedi Alberts III ed. pag.483) Il processo di sintesi di RNA su di uno stampo di DNA presenta, negli eucarioti, una complessità assai elevata. A tutt oggi mancano ancora alcune

Dettagli

Struttura elettronica e tavola periodica

Struttura elettronica e tavola periodica Struttura elettronica e tavola periodica La tavola è suddivisa nei blocchi s, p, d e f Eccezioni: 1) Elio (He) il quale pur appartenendo al blocco s, compare in quello p. Possiede uno strato di valenza

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Gerarchia della struttura delle proteine

Gerarchia della struttura delle proteine Si indica con CONFORMAZIONE la disposizione tridimensionale degli atomi di una molecola, cioè la loro organizzazione spaziale. Gerarchia della struttura delle proteine struttura primaria: sequenza degli

Dettagli

STUDIO E SPERIMENTAZIONE DI METODOLOGIE

STUDIO E SPERIMENTAZIONE DI METODOLOGIE UNIVERSITÀ DEGLI STUDI DI CAGLIARI DOTTORATO DI RICERCA IN INGEGNERIA ELETTRONICA ED INFORMATICA XVII CICLO STUDIO E SPERIMENTAZIONE DI METODOLOGIE INNOVATIVE PER L ANALISI DI SEQUENZE BIOLOGICHE Relatore:

Dettagli

PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle

Dettagli

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti

Gli attivatori trascrizionali sono delle proteine modulari. domini funzionali sovrapposti Gli attivatori trascrizionali sono delle proteine modulari domini funzionali sovrapposti DIMOSTRAZIONE SPERIMENTALE DI DOMINI FUNZIONALI SEPARATI NEL TF DI LIEVITO GAL 4! Esperimenti di Ptshane. Cellule

Dettagli

TRADUZIONE LA TRADUZIONE E QUEL PROCESSO ATTRAVERSO CUI SI PASSA DAL LINGUAGGIO RIBONUCLEOTIDICO DELL RNA A QUELLO AMINOACIDICO DELLE PROTEINE. IL CODICE GENETICO E L INSIEME DI CODONI (TRIPLETTE NUCLEOTIDICHE)

Dettagli

7. Introduzione a PyMol

7. Introduzione a PyMol 7. Introduzione a PyMol PyMol (versione utilizzata: 1.1r1) PyMol è un programma di grafica e modellistica molecolare open source ed estendibile attraverso l implementazione di script in linguaggio Python

Dettagli

Sintesi e maturazione del collageno

Sintesi e maturazione del collageno Sintesi e maturazione del collageno Modifiche intracellulari - idrossilazione (RE) - glicosilazione (RE) - formazione dei ponti S-S (Golgi) - formazione della tripla elica (Golgi) GLICOSILAZIONE I due

Dettagli

INTERAZIONE DI PROTEINE CON SFINGOLIPIDI

INTERAZIONE DI PROTEINE CON SFINGOLIPIDI Seminario Rafts INTERAZIONE DI PROTEINE CON SFINGOLIPIDI Motivi strutturali coinvolti nell interazione di proteine con sfingolipidi e colesterolo (1) Uno dei primi passi per l identificazione di tale motive

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N

Dettagli

Laurea Magistrale in Biologia

Laurea Magistrale in Biologia Laurea Magistrale in Biologia Laboratorio del corso di Chimica Fisica Biologica Anno accademico 2009/10 SCOPO Determinazione dei parametri termodinamici associati alla denaturazione termica di una piccola

Dettagli

LA TRADUZIONE E IL CODICE GENETICO

LA TRADUZIONE E IL CODICE GENETICO LA TRADUZIONE E IL CODICE GENETICO La traduzione La traduzione è il processo di sintesi di una catena polipeptidica, un polimero costituito da amminoacidi legati insieme da legami peptidici Le molecole

Dettagli

Marinella Bosetto Irene Lozzi. Elementi di biochimica agraria

Marinella Bosetto Irene Lozzi. Elementi di biochimica agraria A07 25 Marinella Bosetto Irene Lozzi Elementi di biochimica agraria Copyright MMVI ARACNE editrice S.r.l. www.aracneeditrice.it info@aracneeditrice.it via Raffaele Garofalo, 133 A/B 00173 Roma (06) 93781065

Dettagli

LIPIDI. I lipidi sono suddivisi in due gruppi principali.

LIPIDI. I lipidi sono suddivisi in due gruppi principali. LIPIDI I lipidi sono una classe eterogenea di composti organici, raggruppati sulla base della loro solubilità. Sono insolubili in acqua, ma solubili nei solventi organici non polari, quali l etere dietilico,

Dettagli

Mutazioni. Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione

Mutazioni. Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione Mutazioni Un cambiamento nel materiale genetico che non venga riparato dai meccanismi di riparo costituisce una mutazione Le mutazioni possono essere spontanee oppure causate da agenti fisici, chimici

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 10

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 10 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 10 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

BIOLOGIA GENERALE. Alessandro Massolo Dip. Biologia Animale e Genetica c/o Prof. F. Dessì-Fulgheri (Via Romana 17) massolo@unifi.

BIOLOGIA GENERALE. Alessandro Massolo Dip. Biologia Animale e Genetica c/o Prof. F. Dessì-Fulgheri (Via Romana 17) massolo@unifi. Biologia generale Massolo Alessandro massolo@unifi.it; Tel. 347-9403330 BIOLOGIA GENERALE Facoltà di Scienze della Formazione Scienze della Formazione Primaria Alessandro Massolo Dip. Biologia Animale

Dettagli

Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle

Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle Il flusso dell informazione genica Le proteine natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi Il

Dettagli

MEMBRANE. struttura: fosfolipidi e proteine

MEMBRANE. struttura: fosfolipidi e proteine MEMBRANE struttura: fosfolipidi e proteine I lipidi sono sostanze di origine biologica insolubili in acqua. Vi fanno parte: trigliceridi, fosfolipidi, colesterolo, sfingolipidi, alcoli alifatici, cere,

Dettagli

L UNIONE COME PARADIGMA UNIVERSALE DI CREAZIONE CONTINUA: L ORIGINE DELLA VITA

L UNIONE COME PARADIGMA UNIVERSALE DI CREAZIONE CONTINUA: L ORIGINE DELLA VITA L UNIONE COME PARADIGMA UNIVERSALE DI CREAZIONE CONTINUA: L ORIGINE DELLA VITA Leonardo Angeloni, Università di Firenze Sintesi: L unione, come effetto delle interazioni correlative di entità diverse,

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

Predizione della struttura terziaria

Predizione della struttura terziaria Predizione della struttura terziaria Metodi di predizione La predizione della struttura tridimensionale è di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi

Dettagli

Relazione struttura-funzione

Relazione struttura-funzione Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Relazione struttura-funzione Marco Nardini Dipartimento di Scienze

Dettagli

Analisi della sequenza nucleotidica AP001519 (gene BH3701) Davide Cittaro Valerio Reguzzi Marco Stefani

Analisi della sequenza nucleotidica AP001519 (gene BH3701) Davide Cittaro Valerio Reguzzi Marco Stefani Analisi della sequenza nucleotidica AP001519 (gene BH3701) Davide Cittaro Valerio Reguzzi Marco Stefani Informazioni di base Sequenza estratta dal batterio Bacillus halodurans Codice di accesso sequenza

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Sperimenta il BioLab

Sperimenta il BioLab Sperimenta il BioLab Attività di Bioinformatica Le proteine in 3D Università degli Studi di Milano Settore Didattico, via Celoria 20, Milano Laboratorio 105 LE PROTEINE IN 3D Obiettivo dell'attività è

Dettagli

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione

Prof. Giorgio Sartor. Sintesi proteica. Trasmissione dell informazione rof. Giorgio Sartor Sintesi proteica Copyright 2001-2013 by Giorgio Sartor. All rights reserved. B15 -Versione 1.0 nov2013 Trasmissione dell informazione L informazione è contenuta nel DA ed è trasferita

Dettagli

La biologia è lo studio scientifico della vita e delle diverse forme viventi

La biologia è lo studio scientifico della vita e delle diverse forme viventi La biologia è lo studio scientifico della vita e delle diverse forme viventi Negli ultimi decenni enorme sviluppo di questa disciplina Importanti ricadute su settori come medicina, agricoltura, rapporti

Dettagli

Dai raggi-x alla progettazione di farmaci: le radici matematiche e fisiche della biologia del XXI secolo

Dai raggi-x alla progettazione di farmaci: le radici matematiche e fisiche della biologia del XXI secolo Dai raggi-x alla progettazione di farmaci: le radici matematiche e fisiche della biologia del XXI secolo Martino Bolognesi Dipartimento di BioScienze Università di Milano http://users.unimi.it/biolstru/home.html

Dettagli

dominio strutturale dominio modulo

dominio strutturale dominio modulo Riepilogo 2^lezione DOMINI Si definisce dominio strutturale (o dominio o modulo) di una proteina: un'unità globulare o fibrosa formata da catene polipeptidiche ripiegate in più regioni compatte le quali

Dettagli