Alcune sequenze di DNA insolite. Palindromo. Sequenze con una simmetria doppia

Save this PDF as:

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Alcune sequenze di DNA insolite. Palindromo. Sequenze con una simmetria doppia"


1 Alcune sequenze di DNA insolite Palindromo Sequenze con una simmetria doppia

2 Possono formare: Struttura a croce dette anche anse cruciformi

3 DNA rilassato DNA parzialmente disavvolto DNA cruciforme

4 Struttura a forcina

5 Ripetuto speculare Una sequenza simmetrica su ogni catena

6 Ogni 10.4 paia di basi un filamento compie un giro attorno all'asse dell'elica e passa quindi sopra l altro filamento. Il giro compiuto da un filamento attorno al proprio asse prende il nome di torsione ed è indicato come T. Il numero di volte che un filamento passa sopra l altro filamento prende il nome di Numero di legame ed indicato come L. Per una molecola di DNA circolare composta da 260 paia di basi (come quella che abbiamo deciso di prendere come riferimento), la torsione T è data dal numero di paia di basi: 260, diviso 10.4 e cioè 25 volte.

7 Se il DNA viene parzialmente denaturato (cioè se i filamenti che compongono la doppia elica vengono parzialmente separati) prima che si formi la molecola circolare, il numero di legame diminuisce e si ha la formazione di un anello instabile.

8 Questo anello deve pertanto stabilità e lo fa ripiegandosi su tante volte quanti erano stati i legame perduti, infatti il numero deve sempre restare costante. riacquisire se stesso numeri di di legame

9 Plasmide rilassato superavvolto

10 Questi ripiegamenti su se stessa della molecola di DNA circolare prendono il nome di supereliche negative, e si realizzano proprio se la doppia elica del DNA è stata in precedenza, parzialmente disavvolta. Il numero di volte che l'elica si avvolge su se stessa, prende il nome di contorcimento, ed è indicato come W.

11 L=T+W L = numero di legame T = numero di giri di elica W = numero di supereliche Es: 5200 bp : 10,4 = 500; L = 500 Se il DNA contiene 25 supereliche L = 475 (500 25)

12 Tw (twist) = numero di volte che un filamento incrocia l altro (N di giri dell elica: N bp/ N di bp per passo dell elica). Ha segno + se elica è destrorsa. Wr (writhe) = N di volte in cui l asse della doppia elica incrocia sé stesso nello spazio (superavvolgimenti). Se sinistrorso -; se destrorso +. Lk= Tw+ Wr

13 L = T + W, cioè L = 25+(-2) 23 Questo in caso di supereliche negative Super eliche positive si possono formare a carico di una molecola di DNA circolare che non sia stata disavvolta in precedenza al solo scopo di ridurne le dimensioni. In tal caso, per calcolare effettivamente il numero di legame della nostra molecola di DNA di 260 paia di basi, dovremo pertanto effettuare il seguente calcolo: L = T + W, cioè L = 25+(2) 27

14 Superavvolgimento


16 Superavvolgimento negativo e positivo




20 Formazione della cromatina

21 I nucleosomi: Nucleo istonico del nucleosoma DNA di collegamento del nucleosoma

22 6 nucleosomi portano alla formazione di una struttura denominata: solenoide

23 Riassumendo:




27 Il superavvolgimento del DNA è controllato dalle: di tipo I Topoisomerasi di tipo II

28 Topoisomerasi: Tipo I Creano delle interruzioni transitorie su un solo filamento del DNA Tipo II Creano delle interruzioni transitorie su entrambi i filamenti del DNA

29 TIPO I: Tipo IA legame enzima al 5 fosfato Tipo IB legame enzima al 3 fosfato

30 DNA TOPOISOMERASI TIPO IA Monomeriche Legame 5 fosfodiestere con la tirosina del sito attivo dell enzima Mg(II) per l attività di rilassamento Rilassano superavvolgimenti negativi Il rilassamento non giunge al completamento Il rilassamento cambia il numero di legame di una unità Formazione di nodi, loro svolgimento come pure la catenazione e la decatenazione



33 Meccanismo d azione della topoisomerasi I

34 DNA TOPOISOMERASI TIPO IB Rilassano superavvolgimenti positivi e negativi Il rilassamento giunge al completamento Non è necessario che il DNA sia parzialmente a singolo filamento La tirosina del sito attivo attacca il fosfato 3 del filamento scisso Il rilassamento non richiede Mg(II)

35 Le topoisomerasi I

36 Topoisomerasi II

37 DNA TOPOISOMERASI TIPO II Lega il DNA e scinde i filamenti opposti con quattro basi sfalsate (o due basi sfalsate) Attacco covalente all estremità 5 del DNA attraverso un legame fosfotirosina Quando il superavvolgimento del DNA cambia, il numero di legame varia di 2 unità Le reazioni richiedono Mg(II) Idrolisi ATP ( o ADPNP non idrolizzabile) Residuo di arginina implicato nella catalisi DNA girasi introduce superavvolgimenti negativi (con spesa di ATP)



40 Meccanismo d azione della topoisomerasi II



43 Rilassa i superavvolgimenti sia negativi che positivi. Introduce superavvolgimenti negativi nel DNA rilassato Converte superavvolgimenti positivi in negativi.

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto

Il superavvolgimento è negativo quando consiste in una rotazione in senso opposto Topoisomerasi Il DNA di batteri, mitocondri, plastidi e alcuni virus è costituito da una doppia elica circolare. Consideriamo una molecola di DNA circolare a doppia elica rilassata e chiusa, formata da


Il superavvolgimento del DNA

Il superavvolgimento del DNA Il superavvolgimento del DNA Superavvolgimento del DNA genomico nei procarioti ed eucarioti Plasmide: DNA extracromosomico batterico (circolare) Figura 2.32 DNA circolare rilassato e superavvolto. Il superavvolgimento:


Dimensioni di Genomi

Dimensioni di Genomi Dimensioni di Genomi plasmids viruses bacteria fungi plants algae insects mollusks bony fish amphibians Il Genoma umano è costituito da circa 3 miliardi di bp e contiene un numero di geni pari a circa


Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA

Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA Involucro proteico del batteriofago T2 circondato dalla sua molecola di DNA Lunghezza del cromosoma di E.coli (1,7 mm) paragonata alla lunghezza di una tipica cellula di E. coli (2μm) DNA di una cellula


2. I nucleosomi 11/02/16

2. I nucleosomi 11/02/16 2. I nucleosomi contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale u Ordinato e dinamico u Formazione della struttura terziaria


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 20

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 20 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 20 Geni e cromosomi Concetti chiave: Il DNA superavvolto può essere descritto in termini di numero di legami, avvolgimenti


estremità 5' DNA O - P O H 2 C O H H H H G N H O H 2 C P O H H T N ponte fosfodiestere O 3 P O estremità 3' etc.

estremità 5' DNA O - P O H 2 C O H H H H G N H O H 2 C P O H H T N ponte fosfodiestere O 3 P O estremità 3' etc. estremità 5' 5 3 - P N 5 2 C 3 ponte fosfodiestere P A 1 2 C 5 P 3 G N 1 2 C 5 3 P T N 1 5 2 C 3 etc. DNA C N 1 estremità 3' zucchero N 1 C 3 4 3 timina N adenina N N 1 6 N N 9 N zucchero N zucchero citosina


Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina



CORSO BIOLOGIA MOLECOLARE I. Testi consigliati CORSO BIOLOGIA MOLECOLARE I Dott. Massimo Pancione e.mail Obiettivo del corso: Comprendere i meccanismi molecolari dei processi biologici fondamentali, descrivere le tecniche


lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2


Il DNA conserva l informazione genetica

Il DNA conserva l informazione genetica Il DNA conserva l informazione genetica Gli esperimenti di Frederick Griffith (1928) Gli esperimenti di Oswald Avery (1944) + Estratti dal ceppo IIIS ucciso al calore di Polisaccaridi Lipidi Proteine Acidi


La genetica molecolare

La genetica molecolare La genetica molecolare 1 Il materiale genetico Varia di quantità da specie a specie. Regola lo sviluppo della cellula. Ha la capacità di duplicarsi. Nome comune Numero di coppie di cromosomi zanzara 3


Caratteristiche strutturali dell RNA Le differenze con DNA sono date dal ribosio, dall uracile e dal fatto che normalmente non è presente nelle

Caratteristiche strutturali dell RNA Le differenze con DNA sono date dal ribosio, dall uracile e dal fatto che normalmente non è presente nelle RNA Caratteristiche strutturali dell RNA Le differenze con DNA sono date dal ribosio, dall uracile e dal fatto che normalmente non è presente nelle cellule come doppia elica. Solo in certi virus, dove


La Topologia. La topologia è quella branca della matematica che studia le proprietà. delle strutture che non si modificano quando sono sottoposte a

La Topologia. La topologia è quella branca della matematica che studia le proprietà. delle strutture che non si modificano quando sono sottoposte a La Topologia La topologia è quella branca della matematica che studia le proprietà delle strutture che non si modificano quando sono sottoposte a deformazione. Ι - SUPERAVVOLGIMENTO DEL DNA La struttura





Duplicazione del DNA. 6 Dicembre 2007

Duplicazione del DNA. 6 Dicembre 2007 Duplicazione del DNA 6 Dicembre 2007 Duplicazione - Trascrizione - Traduzione DNA Trascrizione DNA - La DUPLICAZIONE è il processo che porta alla formazione di copie delle molecole di DNA ed al trasferimento


Quanto DNA è contenuto in una cellula?...

Quanto DNA è contenuto in una cellula?... Quanto DNA è contenuto in una cellula?... bp = Base Pair (coppie di basi) lungh DNA/lungh struttura ospitante E. coli: 4,6x10 6 bp (1,7 mm) 850 (unica molecola circolare) Cellula umana: 3,2x10 9 bp (~2


CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina CROMATINA Complesso molecolare formato da DNA, istoni e proteine non istoniche ISTONI Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina Si conoscono


Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare


Contenuto di DNA aploide in alcune specie

Contenuto di DNA aploide in alcune specie Contenuto di DNA aploide in alcune specie 1-10 2 kb 10 3 kb 10 4 kb 10 5-10 8 kb Dimensioni del genoma Paradosso del valore C Non c è una correlazione tra la quantità di DNA e la complessità di un organismo


DNA e replicazione del DNA

DNA e replicazione del DNA DNA e replicazione del DNA 1928: EXP di Griffith Scoperto il fattore trasformante Struttura elicoidale del DNA Struttura del DNA Subunità nucleotidiche Struttura del DNA Subunità nucleotidiche La replicazione


Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche



MODALITA DI REPLICAZIONE MODALITA DI REPLICAZIONE In teoria è ipotizzabile che il DNA possa duplicarsi con modalità: 1) semi-conservativa se alla generazione successiva passano due doppie eliche entrambi costituite da un'elica


Author name Giuliano Bettini. Title The Single Thread

Author name Giuliano Bettini. Title The Single Thread Author name Giuliano Bettini Title The Single Thread Abstract This short paper explores intriguing analogies between helical structures of electron and elementary particles and circular supercoiled DNA.


D'Addario - Biologia Molecolare

D'Addario - Biologia Molecolare 2. Struttura del DNA contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale gli acidi nucleici, acido desossiribonucleico (DNA)


Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona

Scientists with lab coats: Corso di laboratorio Chimico-Biologico. Dott.ssa Valeria Berton Università di Verona Scientists with lab coats: Corso di laboratorio Chimico-Biologico Dott.ssa Valeria Berton Università di Verona Il DNA Il DNA contiene l informazione genetica di un organismo Scritta in un codice chimico


Strutture alternative e strutture superiori degli acidi nucleici

Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative e strutture superiori degli acidi nucleici Strutture alternative La struttura a doppia elica proposta da Crick e Watson, e che abbiamo sopra descritto, è quella ottenuta mediante


Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA...

Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE DEL DNA... ACIDI NUCLEICI...2 FUNZIONI DEL DNA...5 FUNZIONI DELL RNA...5 I NUCLEOTIDI...6 Struttura dei nucleotidi...6 Modello di Watson e Crick...10 Organizzazione strutturale superiore del DNA...13 DUPLICAZIONE


CORSO DI GENETICA. Roberto Piergentili. Università di Urbino Carlo Bo REPLICAZIONE E COMPOSIZIONE DEL DNA

CORSO DI GENETICA. Roberto Piergentili. Università di Urbino Carlo Bo REPLICAZIONE E COMPOSIZIONE DEL DNA CORSO DI GENETICA REPLICAZIONE E COMPOSIZIONE DEL DNA La struttura del DNA La replicazione del DNA Iduefilamenti della doppia elica parentale si srotolano generando ciascuno un filamento figlio secondo





Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare


DNA: il materiale genetico

DNA: il materiale genetico DNA: il materiale genetico Corso di Genetica per Scienze e Tecnologie per l Ambiente e la Natura Alberto Pallavicini La ricerca del materiale genetico Il materiale responsabile dei caratteri ereditari





Il DNA come molecola in grado di veicolare informazione ereditabile (genetica)

Il DNA come molecola in grado di veicolare informazione ereditabile (genetica) Il DNA come molecola in grado di veicolare informazione ereditabile (genetica) Essenz. Alberts: cap 6 La trasmissione dell informazione replicazione trascrizione traduzione DNA RNA Proteina da, dg, dc,



L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami


Enzimi di restrizione. di Vittorio Scornaienchi

Enzimi di restrizione. di Vittorio Scornaienchi Enzimi di restrizione di Vittorio Scornaienchi Generalità Nucleasi Le nucleasi sono enzimi che tagliano i legami sui filamenti degli acidi nucleici: 5. Le esonucleasi aggrediscono una delle estremità libere


MFN0366-A1 (I. Perroteau) - il nucleo. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) - il nucleo. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita 1 Cosa contiene il nucleo? Il nucleo non contiene solo DNA, che costituisce solo il 20% del materiale nucleare, ma anche una grande quantità di proteine chiamate nucleoproteine ed RNA. La maggior parte


Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,



CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p


Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA Nucleotidi e Acidi Nucleici Nucleosidi Nucleotidi Funzioni biologiche dei nucleotidi Struttura di DNA e RNA Concatenazione e appaiamento dei nucleotidi Lo scheletro degli acidi nucleici Componenti degli


DNA DNA DNA Legge di complementarietà delle basi Se in un filamento è presente una T nell altro filamento deve essere presente una A. Se è presente una C nell altro ci dovrà essere una G. E possibile


Author name Giuliano Bettini. Title The Single Thread

Author name Giuliano Bettini. Title The Single Thread Author name Giuliano Bettini Title The Single Thread Abstract This short paper explores intriguing analogies between helical structures of electron and elementary particles and circular supercoiled DNA.



CELLULA PROCARIOTICA PROCARIOTE CELLULA PROCARIOTICA O PROCARIOTE CELLULA EUCARIOTICA O EUCARIOTE Sany0196.jpg IL NUCLEO Provvisto di due membrane (interna ed esterna) che congiungendosi in alcuni punti formano i pori nucleari attraverso





Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine


La chimica della vita

La chimica della vita La chimica della vita Ogni organismo vivente è una macchina sofisticata, risultato di un complesso insieme di reazioni chimiche. La costruzione e il funzionamento di questa macchina si devono all'esistenza


Acidi Nucleici. Contenuto:

Acidi Nucleici. Contenuto: Acidi Nucleici Contenuto: Il DNA e' l'unica molecola depositaria dell'informazione genetica, ossia del progetto nel quale sono immagazzinate istruzioni precise per tutte le caratteristiche ereditarie autoduplicazione


Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro


Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson

Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Il DNA: istruzioni per la vita Bibliografia I colori della Biologia Gatti- Giusti- Anelli Ed. Pearson Una divisione equa Quando una cellula si divide, si formano due nuove cellule che contengono esattamente


Principi di Citologia e Istologia. Prof. Pucci, Il compartimento nucleare

Principi di Citologia e Istologia. Prof. Pucci, Il compartimento nucleare Principi di Citologia e Istologia. Prof. Pucci, 2003 Il compartimento nucleare Il Compartimento Nucleare Il compartimento nucleare è caratteristica propria degli eucarioti. Il compartimento consiste delle


Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse


Traduzione. Trascrizione



LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici


Riassunto struttura DNA

Riassunto struttura DNA Riassunto struttura DNA Il nucleotide (unita monomerica del DNA): composto da uno zucchero pentoso, una base azotata e un gruppo fosfato (1-3) Il DNA e l RNA sono polimeri costituiti da nucleotidi uniti


La struttura del DNA. Il favoloso viaggio alla scoperta del DNA

La struttura del DNA. Il favoloso viaggio alla scoperta del DNA La struttura del DNA Il favoloso viaggio alla scoperta del DNA Crick et Watson, 1953 Scoperta della struttura del DNA DNA= POLIMERO DI NUCLEOTIDI Ci sono 4 tipi di nucleotidi : A, T, C e G Come sono attaccati



ALCUNE DOMANDE DI RIEPILOGO PER LA 2 2 VERIFICA DEL CORSO DI GENETICA AGRARIA ALCUNE DOMANDE DI RIEPILOGO PER LA 2 2 VERIFICA DEL CORSO DI GENETICA AGRARIA Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene Domande di riepilogo alla lezione 1 Riproduzione


espressione genica processo attraverso cui l informazione di un gene viene decodificata

espressione genica processo attraverso cui l informazione di un gene viene decodificata espressione genica processo attraverso cui l informazione di un gene viene decodificata regolazione o controllo dell espressione genica meccanismi mediante i quali un gene viene selettivamente espresso



RUOLI BIOLOGICI DELLE PROTEINE. Biochimica RUOLI BIOLOGICI DELLE PROTEINE Biochimica Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi


Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari





SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza



CERCATE SU YOU TUBE I FILMATI DI BIOLOGIA CE NE SONO DI TUTTI I TIPI CERCATE SU YOU TUBE I FILMATI DI BIOLOGIA CE NE SONO DI TUTTI I TIPI IL MATERIALE GENETICO Fino agli anni 40 si credeva che le proteine fossero le molecole della informazione ereditaria. C erano comunque


Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni



BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)


L ORGANIZZAZIONE DEL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene

L ORGANIZZAZIONE DEL MATERIALE EREDITARIO. Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene L ORGANIZZAZIONE DEL MATERIALE EREDITARIO Dipartimento di Scienze Agronomiche e Genetica Vegetale Agraria Giovanna Attene TESSUTO DNA CELLULA NUCLEO CROMOSOMA GENOMA Il genoma è l insieme del materiale


Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 19 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 19 Acidi nucleici Concetti chiave: Le basi azotate dei nucleotidi comprendono due tipi di purine e tre tipi di pirimidine.



AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi


Dip. Matematica, U. Milano-Bicocca & Progetto Lagrange, ISI-CRT

Dip. Matematica, U. Milano-Bicocca & Progetto Lagrange, ISI-CRT San Pellegrino 3 Sett., 2007 RENZO L. RICCA Dip. Matematica, U. Milano-Bicocca & Progetto Lagrange, ISI-CRT Sommario Struttura e funzione del materiale genetico: analisi matematica di filamenti elastici





Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione


Polymerase chain reaction - PCR. Biotecnologie applicate all ispezione degli alimenti di origine animale

Polymerase chain reaction - PCR. Biotecnologie applicate all ispezione degli alimenti di origine animale Prof.ssa Tiziana Pepe Polymerase chain reaction - PCR Biotecnologie applicate all ispezione degli alimenti di origine animale Dip. di Medicina Veterinaria e Produzioni animali Metodologia



LA GENETICA MOLECOLARE LA GENETICA MOLECOLARE Obiettivi del corso Studio del genoma Genomica strutturale Genomica funzionale Genomica comparata Studio del trascrittoma Analisi dei profili di espressione Studio del proteoma Proteomica


Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti





Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre

Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre cellule (contatto cellula-cellula) o con strutture extracellulari


I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei


La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione nei procarioti Concetti base Nucleoside base purinica o pirimidinica legata alla posizione 1 dell anello pentoso Nucleotide base azotata-pentoso-fosfato Concetti base La trascrizione comporta


Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica


Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti


Biologia Molecolare. CDLM in CTF La trascrizione negli eucarioti

Biologia Molecolare. CDLM in CTF La trascrizione negli eucarioti Biologia Molecolare CDLM in CTF 2010-2011 La trascrizione negli eucarioti I meccanismi della trascrizione Organizzazione generale delle sequenze regolative Il macchinario generale della trascrizione Si








Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il


Sollecitazioni delle strutture

Sollecitazioni delle strutture Sollecitazioni delle strutture I pilastri e i muri portanti sono tipicamente sollecitati a compressione Le travi e i solai sono sollecitati a flessione L indeformabilità di questi elementi costruttivi


02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI

02/12/2014. Tutti gli esseri viventi sono composti da cellule LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI Tutti gli esseri viventi sono composti da cellule Eubatteri Procarioti unicellulari Archebatteri LA CELLULA E L UNITA STRUTTURALE E FUNZIONALE DEGLI ORGANISMI VIVENTI -Autoconservazione mantenimento della


Replicazione del DNA

Replicazione del DNA Replicazione del DNA La chimica della sintesi del DNA DNA polimerasi III La forca replicativa La fase di inizio della replicazione Selezione delle origini replicative La terminazione della replicazione


OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ Scaricato da Le proteine con peso molecolare superiore a 50.000 sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ 1 Scaricato da Le proteine oligomeriche


CAPITOLO 10. La biosintesi degli acidi nucleici: la replicazione. 10.1 Il flusso dell informazione genetica nella cellula

CAPITOLO 10. La biosintesi degli acidi nucleici: la replicazione. 10.1 Il flusso dell informazione genetica nella cellula La biosintesi degli acidi nucleici: la replicazione CAPITL 10 10.1 Il flusso dell informazione genetica nella cellula La sequenza di basi nel DNA codifica l informazione genetica. La duplicazione del DNA,


Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi


CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Corso di Laurea in Scienze Biologiche. Insegnamento di. Anno Accademico Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Prof. Antimo Di Maro Anno Accademico 2016-17 Lezione 11 fattore trasformante L'esperimento


David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita

David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis. Biologia La scienza della vita 1 David Sadava, H. Craig Heller, Gordon H. Orians, William K. Purves, David M. Hillis Biologia La scienza della vita 2 B - L ereditarietà e l evoluzione Il linguaggio della vita 3 Il materiale genetico


DNA. simile ad una scala a chiocciola. I pioli della scala corrispondono

DNA. simile ad una scala a chiocciola. I pioli della scala corrispondono DNA Il DNA o acido desossiribonucleico è una grossa molecola chimica contenuta nel nucleo della cellula. Il DNA può essere paragonato ad un importante libro delle istruzioni che contiene l informazione



IPOTESI UN GENE-UN ENZIMA IPOTESI UN GENE-UN ENZIMA DNA: contiene tutte le informazioni per definire lo sviluppo e la fisiologia della cellula: ma come svolge questa funzione? Beadle e Tatum (1941): studiando mutanti della comune


sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina


Nei batteri non è presente una membrana nucleare

Nei batteri non è presente una membrana nucleare La cellula procariota (Bacteria e Archaea) Morfologia generale Composizione chimica Le strutture cellulari e le loro funzioni parte 1 L involucro Appendici esterne: Le strutture cellulari e le loro funzioni


NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica.

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica. NUCLEOTIDI a) Forma di energia utilizzata nel metabolismo cellulare (ATP, GTP) b) Entrano a far parte della struttura di cofattori enzimatici (coenzimi) e intermedi metabolici c) Costituiscono gli ACIDI


DNA e CROMOSOMI. Come il DNA si replica, si ripara e ricombina

DNA e CROMOSOMI. Come il DNA si replica, si ripara e ricombina DNA e CROMOSOMI Come il DNA si replica, si ripara e ricombina Nel 1928 venne dimostrato che il DNA è il materiale genetico dei batteri (Griffith) Alcune proprietà dei batteri S morti possono trasformare


Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e


Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi


1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick

1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick 1950, Erwin Chargaff AT e GC circa costanti in tutte le specie: consistente con l ipotesi del modello di Watson-Crick Il genoma di E. coli ha 4.0 milioni di nucleotidi Le dimensioni del DNA in vivo Organismo
