RUOLI BIOLOGICI DELLE PROTEINE. Biochimica

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "RUOLI BIOLOGICI DELLE PROTEINE. Biochimica"

Transcript

1 RUOLI BIOLOGICI DELLE PROTEINE Biochimica

2 Il collagene una proteina strutturale Il collagene è un componente principale di tessuti quali la pelle, i capelli, i tendini, le ossa, il cartilagine, i vasi sanguigni, i denti ecc. Forma fibre insolubili di tipo diverso composte da tre catene polipeptidiche, che si assemblano in tre stadi: Prodotto genico PROCOLLAGENE TROPOCOLLAGENE COLLAGENE STRUTTURA 1 a : Le singole catene di procollagene sono caratterizzate da un elevato contenuto di glicina e prolina disposti in sequenze ripetitive: ---Gly-Pro-Xaa-Gly-Xaa-Pro-Gly-Pro-Xaa-Gly-Xaa-Yaa-Gly-Lys-Yaa-Gly-Xaa-Pro-Gly--- * * * G P X G X P diversi residui di prolina sono modificati (*) dalla 4-prolil-idrossilasi (e lisina da un altra idrossilasi 4-prolil idrossilasi + O CO 2 + O prolina COO- α-chetoglutarato 4-idrossiprolina (Hyp) O succinato

3 idrossilazione di residui Pro e Lys nel collagene Una reazione analoga catalizzata dalla e 5-lisil-idrossilasi converte alcuni residui di lisina in 5-idrossilisina (Hyl). L ossidrile in Hyl è un punto d innesto di molecole di zucchero, inserite con reazioni catalizzate da specifiche glicosil trasferasi. - Prodotto genico idrossilazione assemblaggio folding glicosidazione Hyl PROCOLLAGENE L ascorbato (vitamina C) mantiene lo ione ferro nel sito catalitico della idrossilasi in forma Fe ++. In sua assenza le catene di collagene non sono sufficientemente idrossilate, con conseguenze molto gravi sulla resistenza di alcuni tessuti (es. i vasi sanguigni deboli dello scorbuto)

4 Struttura del collagene Struttura 2 a : Le catene di procollagene assumono una conformazione elicoidale definita poliprolina di tipo II (estesa, non stabilizzata da legami-h). Struttura 3 a & 4 a : Tre catene si avvolgono attorno ad un asse comune per formare una TRIPLA ELICA Questa struttura è stabilizzata da Legami-H (Xaa-COO.HN-Gly) intermolecolari Ci sono almeno 9 diversi tipi di collagene: Tipo I (2 catene α + 1 catena β) nelle ossa, tendini, pelle; Tipi II e III (3 catene identiche) rispettivamente nella cartilagine e nei vasi sanguigni

5 Biogenesi del collagene Nel procollagene, il segmento centrale ricco in Gly e Pro (ca 1000 residui), è affiancato da domini N- e C-terminali con altre composizioni (propeptidi). Quello N-terminale è ricco in Cys e qui si formano ponti S-S intercatenache fissano le tre catene e permettono la formazione della tripla elica (effetto cerniera). N Pro/Gly-rich C s s s s tripla elica propeptidi Il tropocollagene viene secreto ed i domini fiancheggianti rimossi da un enzima (peptidasi) extracellulare Il filamenti di tropocollagene si assemblano in una fibbradi collagene maturo procollagene procollagene peptidasi tropocollagene collagene maturo Legami interfibra Legami intrafibra

6 Prodotto genico PROCOLLAGENE TROPOCOLLAGENE COLLAGENE Folding PTM (hydroxylation) PTM (glycosilation) PTM stop secretion processing assembly

7 Biochimica

8 Biogenesi: formazione di legami covalenti del collagene La struttura 3 a /4 a del collagene è stabilizzata da legami covalenti inter- e intracatena: deaminazione Lys allisina NB: Lys > Hyl allisina Hyl/Hyl/Hyl o Hyl/Hyl/Lys idrossipiridinio Legami interfibra Biochimica Legami intraibra

9 Biogenesi: fibrillogenesi e remodeling del gollagene Fibrillogenesi : Il procollagene si forma in cellule specializzate, mentre il suo processing e l assemblaggio della fibra di collagene avviene all esterno della cellula. fibroblasti / condroblasti / osteoblasti tess.conn. cartilagine ossa sintesi idrossilazione glicosidazione formazione tripla elica procollagene tess.conn. cartilagine ossa fibra matura crosslinks fibra di collagene mineraliz_ zazione osteoclasti riassorbimento remodelling secrezione procollagene idrolisi dei terminali Biochimica tropocollagene assemblaggio

10 Biochimica W.J.Landis, Bone (1995), 5,

11 - - O O - O - P - O - P - O - O O PIROFOSFATO O R O - O - P -C - P - O - - O - - O H O O O O BISFOSFONATO O - P - O - P - O - P - O - RIBOSIO - ADENINA O O O Biochimica Farmaci contro l osteoporosi ATP

12 ALTRE PROTEINE STRUTTURALI α-cheratine: proteine presenti in capelli, pelle, unghie, corna, ecc. STRUTTURA 1a capping domain rod domain capping domain variabile -(a-b-c-d-e-f-g) n - variabile STRUTTURA 2 a STRUTTURA 3 a /4 a Spirale superavvolta di due α-eliche filamento (quattro protofibrille attorcigliate a spirale) protofilamento (coppia di spirali superavvolte) Biochimica

13 FIBROINE e ß-CHERATINE: proteine presenti in fibre come la seta e ragnatele STRUTTURA 1a: regione ripetitive -(Gly-Ala-Gly-Ala-Gly-Ser-)nintercalate a regioni non organizzate. ALTRE PROTEINE STRUTTURALI STRUTTURA 2a: β - foglietti antiparalleli (6 - filamenti adiacenti) che corrispondo alle sequenze ripetute circondati da sequenze non ordinate ed a α-elica. Biochimica

14 ELASTINA PROTEINA STRUTTURALE Associata al collagene nel tessuto connettivo, predominante in fibre di natura elastica (es. vasi sanguigni, legamenti), poca in tessuti quali la pelle, tendini ecc. Struttura 1 a : unità ripetute di -(Pro-Gly-Val-Gly-Val)- con tratti tipo -Lys-(Ala) 2,3 -Lys- Struttura 2 a : elica non canonica (probabilmente formata da ß-ripiegamenti ripetuti) Struttura 3 a : fibre formate da catene di elastina connesse da legami trasversali lisil ossidasi Lys Lys-CHO + Lys --Cα-(CH 3 ) 4 -N-(CH 2 ) 4 -C α-- Cu + piridossalfosfato Cα Cα (CH ) 2 3 lisilnorleucina CH 2 CH 2 + N (CH ) 2 3 Biochimica Cα (CH ) 2 2 Cα desmosina

LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA.

LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA. UNITÀ BIOTEC. DIDATTICA DI BIOCHIMICA GENERALE LE PROTEINE DEL CONNETTIVO: IL COLLAGENO, L ELASTINA. Roberto Giacominelli Stuffler IL COLLAGENO 2 IL COLLAGENO E una famiglia di proteine fibrose con ruolo

Dettagli

Polimorfismo genetico del collageno

Polimorfismo genetico del collageno COLLAGENO È la proteina più abbondante del nostro corpo costituendo il 25% delle proteine totali. È la proteina principale dei tessuti connettivi, la cui matrice extracellulare contiene anche: -proteoglicani

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

COMPOSIZIONE: - Semplici - Coniugate: Apolipoproteine Glicoproteine Nucleoproteine Metalloproteine Cromoproteine STRUTTURA: - Fibrose forma molecolare allungata struttura II - Globulari: forma molecolare

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 9 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 9 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare

La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare generalità La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare La sostanza intercellulare a sua volta è costituita da fibre e sostanza

Dettagli

Il Collageno tessuto connettivo

Il Collageno tessuto connettivo Il Collageno Costituente del tessuto connettivo, insieme a elastina, fibrillina e proteoglicani, tutti prodotti da fibroblasti, condroblasti, osteoblasti La proteina + abbondante nei mammiferi (25% del

Dettagli

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a:

I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: I ribosomi liberi nel citoplasma sintetizzano le proteine destinate alla via citoplasmatica, cioè quelle destinate a: filmato Rimanere nel citoplasma Essere trasportate dal citoplasma al nucleo Essere

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto. La catena polipeptidica delle proteine globulari oltre ad organizzarsi in STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine globulari oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore RIPIEGAMENTO sino

Dettagli

Sintesi e maturazione del collageno

Sintesi e maturazione del collageno Sintesi e maturazione del collageno Modifiche intracellulari - idrossilazione (RE) - glicosilazione (RE) - formazione dei ponti S-S (Golgi) - formazione della tripla elica (Golgi) GLICOSILAZIONE I due

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ Scaricato da Le proteine con peso molecolare superiore a 50.000 sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ SunHope.it 1 Scaricato da Le proteine oligomeriche

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

L organizzazione sfalsata dà origine alla tipica striatura di una fibrilla vista al ME in colorazione negativa.

L organizzazione sfalsata dà origine alla tipica striatura di una fibrilla vista al ME in colorazione negativa. Le unità di tropocollageno si dispongono testa-coda su file parallele, sfalsandosi di circa 1/4 della loro lunghezza (60-70 nm). In ciascuna fila le unità sono separate da spazi di 35-40 nm, che nell osso

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Sinistrorsa. destrorso

Sinistrorsa. destrorso Sinistrorsa destrorso P. Champe, R. Harvey, D. R. Ferrier, LE BASI DELLA BIOCHIMICA, Zanichelli Editore S.p.A. Copyright 2006 Collageno Glicoproteina insolubile del tessuto connettivo, tendini, denti,

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare

La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare generalità La caratteristica fondamentale del tessuto connettivo è quella di essere costituito da cellule e sostanza intercellulare La sostanza intercellulare a sua volta è costituita da fibre e sostanza

Dettagli

I TESSUTI CONNETTIVI

I TESSUTI CONNETTIVI I TESSUTI CONNETTIVI 1) Tessuti connettivi propriamente detti; 2) Tessuto adiposo; 3) Sangue; 4) Tessuto cartilagineo; 5) Tessuto osseo A cura di Tiziano Baroni TESSUTO CONNETTIVO Gruppo di tessuti con

Dettagli

Riepilogo di Emoglobina, collagene, elastina e antitripsina

Riepilogo di Emoglobina, collagene, elastina e antitripsina Riepilogo di Emoglobina, collagene, elastina e antitripsina Vi sono altri fattori che possono influire sulla capacità dell emoglobina di legarsi all ossigeno, uno di questi è la concentrazione di

Dettagli

TESSUTI CONNETTIVI. Gruppo di tessuti con caratteristiche comuni: Origine embrionale (mesoderma mesenchima)

TESSUTI CONNETTIVI. Gruppo di tessuti con caratteristiche comuni: Origine embrionale (mesoderma mesenchima) TESSUTI CONNETTIVI Gruppo di tessuti con caratteristiche comuni: Origine embrionale (mesoderma mesenchima) Organizzazione strutturale Funzioni: connessione di altri tessuti, fz. meccanica (sostegno), fz.

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Principi di Citologia e Istologia. Prof. Pucci, La Matrice Extracellulare

Principi di Citologia e Istologia. Prof. Pucci, La Matrice Extracellulare Principi di Citologia e Istologia. Prof. Pucci, 2003 La Matrice Extracellulare La matrice extracellulare è composta da quattro classi di macromolecole Collageni Proteoglicani Elastina Glicoproteine Essa

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

TESSUTO MUSCOLARE TESSUTO NERVOSO TESSUTO CONNETTIVO TESSUTO EPITELIALE

TESSUTO MUSCOLARE TESSUTO NERVOSO TESSUTO CONNETTIVO TESSUTO EPITELIALE TESSUTO MUSCOLARE TESSUTO NERVOSO TESSUTO CONNETTIVO TESSUTO EPITELIALE TESSUTO EPITELIALE poca matrice extracellulare (lamina basale) TESSUTO CONNETTIVO abbondante matrice extracellulare ADESIONE: fenomeno

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

TESSUTI ANIMALI, MATRICE EXTRACELLULARE E GIUNZIONI CELLULARI MATRICE EXTRACELLULARE MATRICE EXTRACELLULARE COLLAGENI ED ELASTINA

TESSUTI ANIMALI, MATRICE EXTRACELLULARE E GIUNZIONI CELLULARI MATRICE EXTRACELLULARE MATRICE EXTRACELLULARE COLLAGENI ED ELASTINA TESSUTI ANIMALI, MATRICE EXTRACELLULARE E GIUNZIONI CELLULARI CELLULE E TESSUTI Negli organismi pluricellulari, le cellule sono organizzate in tessuti. Nei vertebrati abbiamo 4 principali tessuti: epiteliale,

Dettagli

a differenza degli epiteli

a differenza degli epiteli cellule molto più rade a differenza degli epiteli abbondante materiale extracellulare (matrice) presenza di vasi sanguigni I tessuti connettivi Gruppo di tessuti con caratteristiche comuni: Organizzazione

Dettagli

LE FIBRE ELASTICHE ISTOLOGIA ISTOLOGIA. Azan Mallory. Fibre collagene (fasci) Colorazione di Weigert- Van Gieson

LE FIBRE ELASTICHE ISTOLOGIA ISTOLOGIA. Azan Mallory. Fibre collagene (fasci) Colorazione di Weigert- Van Gieson LE FIBRE ELASTICHE Azan Mallory Fibre collagene (fasci) Colorazione di Weigert- Van Gieson ARTERIA ELASTICA: AORTA ARTERIA DI TIPO MUSCOLARE TONACA AVVENTIZIA TONACA MEDIA Le fibre elastiche Microfibrille

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Contengono idrossiaminoacidi. Sono glicosilate Quasi tutte le catene non contengono Cys

Contengono idrossiaminoacidi. Sono glicosilate Quasi tutte le catene non contengono Cys Scaricato da Type I osso, tendini, fibrocartilagine derma, cornea 2 α 1 (I) + 1 α 2 (I) Type II 3α 1 (II) Type III 3α 1 (III) Type IV 3α 1 (IV) Type V 2α 1 (V)+ α 2 (V) Type VI α 1 (VI)+ α 2 (VI)+ α 3

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

La nuova biologia.blu

La nuova biologia.blu David Sadava, David M. Hillis, H. Craig Heller, May R. Berenbaum La nuova biologia.blu Il corpo umano PLUS 2 Capitolo C1 L architettura del corpo umano 3 L organizzazione del corpo umano è gerarchica Tutto

Dettagli

Elastina [1] 21/04/2015. Alveoli polmonari http://en.wikipedia.org/wiki/pulmonary_alveolus

Elastina [1] 21/04/2015. Alveoli polmonari http://en.wikipedia.org/wiki/pulmonary_alveolus ELASTINA http://www.ncbi.nlm.nih.gov/books/nbk26810/figure/a3570/?report=objectonly http://www.pathology.washington.edu/research/centers/services/pictures/ 1 Alveoli polmonari http://en.wikipedia.org/wiki/pulmonary_alveolus

Dettagli

Il principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati

Il principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati Il principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati L ossidazione dei carboidrati è la più importante via di produzione dell energia nelle cellule non fotosintetiche Carboidrati:

Dettagli

Carboidrati. Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati

Carboidrati. Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati Carboidrati Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati Carboidrati: funzioni Fornire energia chimica Sostegno (parete cellulare vegetale) Protezione (parete batterica)

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C carbonio

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Le strutture extracellulari consistono principalmente di macromolecole secrete dalla cellula stessa. La natura chimica di queste molecole differisce

Le strutture extracellulari consistono principalmente di macromolecole secrete dalla cellula stessa. La natura chimica di queste molecole differisce Le strutture extracellulari consistono principalmente di macromolecole secrete dalla cellula stessa. La natura chimica di queste molecole differisce tra i vari organismi, ma le strutture extracellulari

Dettagli

LIVELLI DI STRUTTURA DELLE PROTEINE

LIVELLI DI STRUTTURA DELLE PROTEINE FUNZIONI E STRUTTURA DELLE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 LIVELLI

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

DI CHE COSA PARLEREMO?

DI CHE COSA PARLEREMO? PERCHÉ COLWAY? BENVENUTI DI CHE COSA PARLEREMO? 1. Presenteremo il Collagene Colway! 2. Presenteremo l azienda! 3. Presenteremo l offerta completa dei prodotti COLWAY! 4. Presenteremo l opportunità di

Dettagli

ACIDI NUCLEICI ESPERIMENTI

ACIDI NUCLEICI ESPERIMENTI ACIDI NUCLEICI ESPERIMENTI 1869 FRIEDRICK MIESCHER Isolò per la prima volta una sostanza zuccherina leggermente acida contenente fosforo Questa sostanza venne chiamata: acido nucleico perché scoperta nel

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

I TESSUTI CONNETTIVI. Tessuti connettivi propriamente detti; Tessuto adiposo; Sangue; Tessuto cartilagineo; Tessuto osseo. A cura di Tiziano Baroni

I TESSUTI CONNETTIVI. Tessuti connettivi propriamente detti; Tessuto adiposo; Sangue; Tessuto cartilagineo; Tessuto osseo. A cura di Tiziano Baroni I TESSUTI CONNETTIVI 1) 2) 3) 4) 5) Tessuti connettivi propriamente detti; Tessuto adiposo; Sangue; Tessuto cartilagineo; Tessuto osseo A cura di Tiziano Baroni TESSUTI CONNETTIVI Gruppo di tessuti con

Dettagli

I TESSUTI CONNETTIVI connettono altri tessuti tra di loro nella formazione degli organi, danno sostegno alle parti molli, intervengono negli scambi

I TESSUTI CONNETTIVI connettono altri tessuti tra di loro nella formazione degli organi, danno sostegno alle parti molli, intervengono negli scambi I TESSUTI CONNETTIVI connettono altri tessuti tra di loro nella formazione degli organi, danno sostegno alle parti molli, intervengono negli scambi nutritizi e presentano elementi specializzati nella difesa

Dettagli

Alterazioni di proteine struturali

Alterazioni di proteine struturali Alterazioni di proteine struturali Patologia del Collageno Collageno: 25% (come massa) di tutte le proteine del corpo. Alta resistenza alla trazione. Resistenza alle proteasi comuni (proteasi a serina

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) POLIMERI Le cellule sintetizzano un enorme numero di grosse molecole a partire da una ristretta serie di

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Corso di Biomeccanica

Corso di Biomeccanica Corso di Laurea in Ingegneria Biomedica Corso di Biomeccanica Parte 7: legami costitutivi F. Auricchio auricchio@unipv.it http://www.unipv.it/dms/auricchio Università degli Studi di Pavia Dipartimento

Dettagli

ELASTINA 04/04/2014. Elastina

ELASTINA 04/04/2014. Elastina ELASTINA http://www.ncbi.nlm.nih.gov/books/nbk26810/figure/a3570/?report=objectonly http://www.pathology.washington.edu/research/centers/services/pictures/ Alveoli polmonari http://en.wikipedia.org/wiki/pulmonary_alveolus

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

La chimica della vita

La chimica della vita La chimica della vita La materia presente nell universo è formata da 92 elementi Gli elementi si legano tra loro per formare le molecole che costituiscono i composti Legame covalente O H H Molecola Composto

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE 1) Il collagene è una proteina (globulare / fibrosa). È formata da tre (catene alfa/alfa eliche) con andamento (destrorso/sinistrorso) che vanno

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli