Chimotripsina Una proteina globulare. Glicina Un amminoacido

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Chimotripsina Una proteina globulare. Glicina Un amminoacido"

Transcript

1 Chimotripsina Una proteina globulare Glicina Un amminoacido

2 - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard = differenti peptidi con 4 amminoacidi differenti proteine con 300 amminoacidi - Solo un numero limitato delle possibili catene polipeptidiche può assumere una singola conformazione tridimensionale stabile. - Le proteine che non hanno una conformazione stabile non sono utili e vengono eliminate dalla selezione naturale - Le proteine sono state costruite in un modo così preciso che il cambio di pochi atomi di un amminoacido può talvolta distruggere la struttura di una proteina e comprometterne la funzione.

3

4 Diversi conformeri della molecola dell etano

5

6 Livelli di struttura nell architettura delle proteine Struttura primaria: Struttura secondaria: Sequenza degli amminoacidi e posizione dei ponti disolfuro. Insieme dei legami covalenti. Disposizione nello spazio dei residui amminoacidici adiacenti nella sequenza lineare. Disposizioni particolarmente stabili dei residui amminoacidici che danno origine a organizzazioni ricorrenti Tipiche e più comuni strutture secondarie: α elica, foglietto β, ripiegamento β Struttura secondaria di una proteina = distribuzione di α eliche, foglietti β e turns lungo la catena proteica.

7 Livelli di struttura nell architettura delle proteine (b) Struttura terziaria: Disposizione nello spazio dei residui amminoacidici lontani tra loro nella sequenza lineare. Descrive tutti gli aspetti del ripiegamento tridimensionale di un polipeptide Struttura quaternaria: In proteine con più di una catena polipeptidica (subunità) si riferisce alla distribuzione nello spazio di queste subunità e alla natura dei contatti che esistono tra loro.

8

9 Le interazioni chimiche che stabilizzano la conformazione di una proteina sono: Ponti disolfuro (nelle proteine extracellulari) Legami non covalenti: Legami idrogeno Interazioni ioniche Interazioni di van der Waals Interazioni idrofobiche La conformazione di una proteina con la minore energia libera (cioè la più stabile) è generalmente quella con il maggior numero di interazioni deboli

10 Il ripiegamento (o folding) delle proteine 1) I residui idrofobici devono essere localizzati all interno della proteina, lontano dal contatto con l acqua. 2) Il numero di legami idrogeno deve essere massimo.

11 Il ripiegamento (o folding) delle proteine (b) La maggior parte della variazione di energia libera che si ha durante il folding di una proteina è dovuta all aumento di entropia della soluzione acquosa. Si ha aumento dell entropia dell acqua quando le catene laterali degli amminoacidi idrofobici tendono a raggrupparsi all interno della proteina Si ha aumento dell entropia dell acqua quando si generano legami idrogeno intramolecolari o interazioni ioniche tra gruppi carichi della molecola

12 Il numero di molecole d acqua negli strati ordinati è proporzionale all area superficiale del soluto idrofobico

13 Interazioni idrofobiche Molecole non polari in un ambiente acquoso tendono a raggrupparsi. L aggreagazione delle molecole non polari in acqua porta ad un aumento dell entropia del sistema dovuto alla riduzione della superficie esposta al solvente ed alla conseguente riduzione delle molecole d acqua negli strati ordinati. Queste associazioni di molecole non polari in ambiente acquoso sono dette Interazioni (o attrazioni) idrofobiche

14 Molecole non polari in una soluzione acquosa vengono tenute insieme non tanto perché hanno affinità tra loro ma per ridurre la superficie esposta all acqua.

15 Il ripiegamento (o folding) ) delle proteine (c) La scomparsa degli strati di molecole di acqua altamente ordinate rappresenta la forza entropica trainante che guida l avvolgimento di una proteina

16 IL legame amidico C-N in un peptide (1,32 Å) ha una lunghezza intermedia tra quella di un singolo legame C-N (1,49 Å) e di un doppio legame C=N (1,27 Å) (Pauling and Corey, 1930) Nel legame peptidico vi è parziale ridistribuzione delle 2 coppie di elettroni tra l atomo di ossigeno carbonilico e l atomo di azoto amidico. Il legame C-N ha caratteristiche parziali di doppio legame ed è pertanto rigido. L idrogeno del gruppo aminico sostituito è quasi sempre trans (opposto) rispetto all ossigeno del gruppo carbonilico.

17 Il legame peptidico

18 Legami peptidici trans e cis La forma trans è fortemente favorita perché nella forma cis vi sono impedimenti sterici.

19 Legami X-Pro cis e trans Le energie di queste due forme sono paragonabili perchè impedimenti sterici sono presenti in entrambe le configurazioni La prolina può partecipare anche a legami peptidici di tipo cis

20 Tipiche distanze di legame in una unità peptidica

21 I legami peptidici sono strutture rigide e planari

22 Gruppo peptidico (rigido)

23 Ciascuna unità peptidica può ruotare intorno a 2 legami N - Cα e Cα - C L angolo di rotazione intorno al legame N - Cα = φ (phi) L angolo di rotazione intorno al legame Cα C = ψ (psi) φ e ψ possono teoricamente assumere tutti i valori compresi tra -180 e + 180

24 C è libertà di rotazione intorno ai legami che uniscono i gruppi peptidici agli atomi di carbonio α.

25 Catena principale (Scheletro covalente) Catena laterale

26 Piano amidico Carbonio α Gruppo laterale Piano amidico

27 Per convenzione, gli angoli φ e ψ sono definiti pari a 0 o quando i due legami peptidici che fiancheggiano un atomo di carbonio α sono sullo stesso piano e nella posizione qui mostrata. In una proteina questa conformazione non è consentita per le sovrapposizioni steriche tra l atomo di ossigeno carbonilico e l atomo di idrogeno α-amminico

28 Interferenze steriche tra due gruppi peptidici adiacenti. Una rotazione può portare a una conformazione in cui l atomo di idrogeno amidico e l atomo di ossigeno carbonilico del residuo successivo sono più vicini delle loro distanze di van der Waals

29 B) Visione lungo il legame tra l atomo di azoto e il carbonio α che mostra come si misura φ C) Visione lungo il legame tra il carbonio α e il cabonio carbonilico che mostra come si misura ψ Una rotazione in senso orario intorno a ciascun legame del gruppo più lontano in una visione frontale come quelle qui mostrate, corrisponde a un valore positivo; una rotazione in senso antiorario corrisponde a un valore negativo

30 Un residuo di una catena polipeptidica non può avere qualunque coppia di valori degli gli angoli φ e ψ, perché certe combinazioni non sono possibili per interferenze steriche tra gli atomi dello scheletro del polipeptide e quelli delle catene laterali. I valori permessi di questi angoli possono essere riportati in un grafico in cui ψ viene analizzato in funzione di φ, un indagine che va sotto il nome di grafico di Ramachandran.

31 Un grafico di Ramachandran per residui di L-alanina - Conformazioni ulteriori sono possibili per la glicina (in rosso) perché la sua catena laterale è piccola (H).

32

33

34 α-elica Nella struttura ad α-elica lo scheletro del polipeptide è avvolto intorno all asse longitudinale della molecola e le catene laterali dei residui amminoacidici sporgono verso l esterno

35 α-elica L α elica è stabilizzata da legami idrogeno che si formano tra il gruppo C = O di un residuo n ed il gruppo N-H del residuo n+4 Tutti i gruppi C = O ed N-H, eccetto il primo N-H ed il primo C=O, sono impiegati in legami idrogeno Sono presenti 3,6 residui per giro.

36 I piani dei legami peptidici rigidi sono paralleli all asse dell elica. α elica

37 = catene laterali R

38 Modello spaziale dell α elica, in cui si può osservare come sono ammassati gli atomi

39 C C N N

40 L avvitamento dell elica è più comunemente destrorso con angoli φ e ψ compresi tra e

41 L avvolgimento dell α elica consente la formazione di interazioni tra la catena laterale di un amminoacido e quella del residuo distante 3 (a volte 4) residui in entrambe le direzioni dell elica. Spesso gli amminoacidi carichi positivamente si trovano distanziati di 3 residui da amminoacidi carichi negativamente, in modo da formare interazioni ioniche. Due amminoacidi aromatici possono anch essi essere distanziati di 3 residui in modo da generare un interazione idrofobica.

42 Elica affossata nella molecola Elica parzialmente esposta al solvente Elica completamente esposta al solvente = residuo idrofobico = residuo polare = residuo carico

43 Residuo di prolina impegnato in un legame peptidico La presenza di un residuo di prolina limita la formazione di un α-elica 1) L atomo di azoto imminico di un residuo di prolina fa parte di un anello rigido e quindi non è possibile rotazione intorno al legame N - Cα (φ). 2) L atomo di azoto di un residuo di prolina coinvolto in un legame peptidico non ha l atomo di idrogeno sostituente che è necessario per generare un legame idrogeno con altri residui.

44 In ogni legame peptidico esiste un piccolo dipolo elettrico I dipoli si sommano attraverso i legami idrogeno presenti nell elica e quindi il dipolo aumenta con la lunghezza dell elica In quattro amminoacidi alle due estremità di un elica non partecipano completamente alla formazione di legami idrogeno. Le cariche parziali negative e positive del dipolo delle eliche risiedono sui gruppi N-H e C=O dei legami peptidici, vicino all estremità ammino- e carbossi-terminale dell elica. Amminoacidi carichi negativamente sono spesso presenti vicino all estremità amminoterminale di un elica, dove possono generare interazioni stabilizzanti con la carica positiva del dipolo dell elica. Residui carichi positivamente nella stessa posizione sono destabilizzanti. Il contrario accade all estremità carbossi-terminale.

45 Tre modi differenti di rappresentare una α-elica: a) modello a palle e bastoncini; b) modello a nastro; c) modello a cilindro

46 La ferritina: una proteina che serve per accumulare il ferro, ha una struttura costituita prevalentemente da α-eliche.

47 Conformazione β E la conformazione più estesa delle catene polipeptidiche. Lo scheletro della catena polipaptidica è esteso con un andamento a zig-zag

48

49 Conformazione β Si formano legami igrogeno tra i gruppi C=O di un filamento e i gruppi N-H di un filamento adiacente.

50 Conformazione β Catene adiacenti di una struttura β possono avere direzioni opposte (foglietto β antiparallelo): C N N C Coppie di legami idrogeno ravvicinate si alternano a coppie a maggiore distanza. I legami idrogeno sono perpendicolari alla direzione dei filamenti.

51

52 Conformazione β Catene adiacenti di una struttura β possono avere la stessa direzione (foglietto β parallelo): N C N C Le coppie di legami idrogeno si presentano regolarmente distanziate e non sono perpendicolari alla direzione dei filamenti.

53

54 Foglietto β di tipo misto:

55 I gruppi R di residui amminoacidici adiacenti sporgono al di fuori della struttura a zig-zag, alternativamente da una parte o dall altra del piano La catena principale forma tutti i legami idrogeno possibili tranne nel caso dei due filamenti esterni che, trovandosi ai due lati del foglietto, sono affiancati da un solo filamento β.

56 A) Foglietti β antiparalleli B) Foglietti β paralleli

57 Modi differenti di rappresentare una struttura β: a) Un modello a palle e bastoncini

58 b) Un modello schematico b) Rotazione di 90 o della rappresentazione schematica per mettere in evidenza la torsione dei diversi filamenti β.

59 La struttura di una proteina che lega gli acidi grassi, costituita quasi esclusivamente da foglietti β

60 La fibroina della seta La fibroina della seta è costituita da strati di foglietti β antiparalleli ricchi di residui di Alanina e Glicina. Catene laterali di Alanina Catene laterali di Glicina Le catene laterali piccole di questi residui consentono un avvicinamento perfetto degli strati di foglietti. Sequenza (Gly-Ser-Gly-Ala-Gly-Ala) n

61 Fotografia colorata al microscopio elettronico di fili di fibroina che escono dalla filiera di un ragno

62 Ripiegamento β (β turn) Nelle proteine globulari, circa un terzo dei residui sono presenti in ripiegamenti o anse a livello dei quali la catena polipeptidica modifica la sua direzione I ripiegamenti che uniscono due segmenti consecutivi di un foglietto β antiparallelo sono detti ripiegamenti β. La struttura è un ripiegamento di circa 180 o, che comprende 4 residui amminoacidici La struttura è stabilizzata da un legame idrogeno tra il gruppo carbonilico del primo amminoacido (i) e il gruppo amminico del quarto residuo (i+3). Il secondo e il quarto legame peptidico non partecipano alla formazione di legami.

63 Ripiegamento β

64 Ripiegamento β (β turn) Nei ripiegamenti β sono spesso presenti residui di Glicina e di Prolina. Glicina : amminoacido piccolo e flessibile Prolina : il legame peptidico con l azoto imminico della prolina assume facilmente la configurazione cis, una forma che si adatta bene ad un cambio di direzione molto stretto.

65 Legami X-Pro cis e trans Le energie di queste due forme sono paragonabili perchè impedimenti sterici sono presenti in entrambe le configurazioni La prolina può partecipare anche a legami peptidici di tipo cis

66 la configurazione cis si adatta bene ad un cambio di direzione molto stretto.

67 Gly

68 Loop (Anse) sulla superficie di una proteina I β turn sono frequentemente localizzati sulla superficie delle proteine dove i gruppi peptidici dei due residui centrali della struttura possono formare legami idrogeno con le molecole di acqua Una parte di una molecola di un anticorpo. Sono evidenziati i loop sulla superficie che sono coinvolti nell interazione con altre molecole

69

70 I valori degli angoli φ e ψ per tutti gli amminoacidi, eccetto le glicine nell enzima piruvato chinasi da coniglio

71 Probabilità relative della presenza di un dato amminoacido nei tre tipi più comuni di struttura secondaria

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

GLI AMMINOACIDI E LE PROTEINE

GLI AMMINOACIDI E LE PROTEINE UNITÀ VET. DIDATTICA DI PROPEDEUTICA BIOCHIMICA GLI AMMINOACIDI E LE PROTEINE Roberto Giacominelli Stuffler INTRODUZIONE Tutte le proteine, sia nei batteri, sia nelle forme di vita più complesse, sono

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU)

CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE DI BIOCHIMICA (6 CFU) Roberto Giacominelli Stuffler IL CORSO MONODISCIPLINARE DI BIOCHIMICA È SUDDIVISO IN DUE UNITÀ

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

carbonio idrogeno ossigeno azoto

carbonio idrogeno ossigeno azoto Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di

Dettagli

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto Gli acidi nucleici, DA (acido deossiribonucleico) e RA (acido ribonucleico), sono polimeri biologicamente importanti in quanto svolgono ruoli fondamentali nell ereditarietà e nella sintesi proteica. Sono

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta

α-cheratine (α-elica) collageni e cheratine β-cheratine (conformazione β) M.N. Gadaleta Per la scoperta delle conformazioni più comuni delle catene polipeptidiche cioè α-elica e β-conformazione è stato particolarmente importante lo studio delle cheratine, proteine fibrose, e l analisi della

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C carbonio

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C H O N

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

LIVELLI DI STRUTTURA DELLE PROTEINE

LIVELLI DI STRUTTURA DELLE PROTEINE FUNZIONI E STRUTTURA DELLE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 LIVELLI

Dettagli

Adenina Adenine H H N N N N N Z

Adenina Adenine H H N N N N N Z Adenina Adenine Z Guanina O GUAIA Z Citosina CITOSIA Z O Timina Thymine C3 O Z O Siti di attacco elettrofilo 3 Thymine Basi appaiate: Timina-Adenina Adenine C 3 O O 3.ooA Basi appaiate: Citosina-Guanina

Dettagli

STRUTTURA E FUNZIONE DELLE

STRUTTURA E FUNZIONE DELLE STRUTTURA E FUNZIONE DELLE PROTEINE Compongono la STRUTTURA della cellula ma hanno anche altre FUNZIONI intelaiatura citoscheletrica strutture cellulari (organelli) impalcatura di sostegno extracellulare

Dettagli

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole.

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. 4.1 Angolo di legame e forma delle molecole Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. La forma e le dimensioni delle molecole, la disposizione

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli