Amminoacidi Peptidi Proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Amminoacidi Peptidi Proteine"

Transcript

1 Amminoacidi Peptidi Proteine

2 Amminoacidi-Peptidi-Proteine

3 Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico

4

5 Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente disposizione tridimensionale. NON sono sovrapponibili enantiomeri Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L

6 I 20 amminoacidi vengono suddivisi in 4 classi in base al loro gruppo -R Amminoacidi Gruppi R alifatici NON polari Gruppi R aromatici Gruppi R carichi positivamente Gruppi R carichi negativamente

7 IDROFOBOCI

8 IDROFOBOCI

9 IDROFILICI

10 Secondo gruppo amminico primario IDROFILICI Gruppo imidazolico Gruppo guanidinico Secondo Gruppo carbossilico

11

12 FORMAZIONE DEI PONTI DISOLFURO PONTE DISOLFURO

13 PONTI DISOLFURO Stabilizzano La struttura delle proteine. Uniscono parti della stessa proteina o proteine diverse La permanente sfrutta la presenza dei ponti disolfuro

14

15 Amminoacidi non standard

16 PROPRIETÀ ACIDO-BASE DEGLI AMMINOACIDI Ione dipolare switterione Sono molecole ANFOTERE Donatore di protoni Accettore di protoni

17 Proprietà acido-basiche degli aminoacidi H 3 N COOH C R H Forma cationica diprotica H 3 N COO H+ H+ C R H Forma ionica dipolare o zwitterionica COO H 2 N C H R Forma anionica a ph fisiologico il gruppo amminico porta una carica positiva e il gruppo carbossilico una carica negativa

18 Proprietà acido-basiche degli aminoacidi A ph acido: H 3 N COO C R H + H 3 O + H 3 N C COOH R H + H 2 O A ph basico: H 3 N COO C R H + OH - H 2 N C COO R H + H 2 O

19 La carica degli aminoacidi dipende dal ph della soluzione dal proprio punto isoelettrico carica positiva al di sotto del pi carica negativa al di sopra del pi carica netta 0 al pi

20 Titolazione degli aminoacidi Graduale aggiunta o rimozione di protoni carica negativa al di sopra del pi Punto Isoelettrico pi ph caratteristico a cui la carica totale netta della molecola è 0 carica positiva al di sotto del pi

21 Peptidi & Proteine Polimeri di Amminoacidi Amminoacidi Peptidi Catene di Amminoacidi proteine

22 Il legame Peptidico

23 Il legame Peptidico

24

25

26 Il legame Peptidico Dipolo Più corto di un legame singolo Ha parziale carattere di doppio legame È rigido, non permette deformazioni e rotazioni attorno al legame C-N

27 Piano ammidico ψ φ nel legame peptidico gli atomi di O, C, N e H sono rigidamente sullo stesso piano il legame C-C α ed legame N-C α sono legami singoli perciò è possibile la libera rotazione

28 Piano ammidico ψ φ

29 Ciascun carbonio α appartiene contemporaneamente a due piani peptidici, i quali formano un angolo diedro Il legame peptidico è quasi sempre di tipo trans in quanto l impedimento sterico tra gruppi R di aminoacidi contigui rende poco stabile la configurazione cis

30 peptide Oligopeptide: piccolo numero di Amminoacidi Polipeptide: elevato numero di Amminoacidi, Massa molecolare < Proteina: elevato numero di Amminoacidi, Massa molecolare >

31

32 Peptidi.. Esempi 1) Derivati da proteine per parziale proteolisi 2) Biomolecole funzionali: glutatione encefaline peptidi salivari (PRP, istatine, cistatine, staterine.)

33 Peptidi.. Esempi 1) Derivati da proteine per parziale proteolisi 2) Biomolecole funzionali: glutatione encefaline peptidi salivari (PRP, istatine, cistatine, staterine.)

34 Peptidi.. Esempi 3) Ormoni: somatostatina glucagone ossitocina 4) Antibiotici: gramicidina valinomicina

35 Proteine Semplici Contengono solo amminoacidi Coniugate Contengono gruppi chimici addizzionali associati

36 Proteine: Livelli strutturali La sequenza amminoacidica determina il ripiegamento in una specifica struttura tridimensionale che a sua volta stabilisce la funzione della proteina

37 La SEQUENZA con cui si ripetono i residui amminoacidici definisce la STRUTTURA PRIMARIA Proteine con lo stesso numero di residui aminoacidici che differiscono nella struttura primaria svolgono funzioni diverse. Le proteine si distinguono per la COMPOSIZIONE e per la SEQUENZA dei residui amminoacidici

38 Funzioni biologiche delle proteine Catalisi: (Enzimi) Trasmissione dei segnali chimici: Proteine di difesa (Ormoni) (Anticorpi) Proteine contrattili (actina e miosina) Proteine di trasporto (Emoglobina) Proteine di riserva (ovalbumina) Proteine strutturali: (collageno, elastina, cheratina)

39 Carica delle proteine: ph< pi 0 ph>pi catione ph<pi anfoione ph=pi anione ph>pi

40 Struttura secondaria delle proteine Tipica disposizione spaziale dei residui amminoacidici che sono adiacenti nella struttura primaria. Ripiegamento della catena polipeptica la cui catena principale si dispone nello spazio tridimensionale formando una struttura ripetitiva. Conformazione: organizzazione spaziale degli atomi di una proteina. α-elica, β-foglietto

41 Struttura secondaria delle proteine Per conformazione si intende l organizzazione spaziale degli atomi di una proteina. Le Conformazioni che una proteina può assumere sono quelle termodinamicamente più stabili (minore ΔG) Le proteine che si trovano nella loro conformazione funzionale vengono dette native Possiamo quindi definire la stabilità di una proteina come la sua tendenza a mantenere la conformazione nativa

42 Struttura secondaria delle proteine 1) INTERAZIONI IDROFOBICHE: Le catene laterali degli amminoacidi idrofobici tendono a raggrupparsi all interno delle proteine 2) LEGAMI H Massimo numero all interno della proteina

43 Struttura secondaria delle proteine: C=O α elica C N

44 Struttura secondaria delle proteine: Disposizione elicoidale della catena principale α elica Sinistrorsa Destrorsa

45 Struttura secondaria delle proteine: α elica N C C=O α - eliche delle proteine: destrorsa ogni giro di elica 3,6 residui di amminoacidi passo = 3,6 residui

46 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno il gruppo C=O di un amminoacido forma un legame H con il gruppo N-H dell amminoacido che si trova 4 residui più avanti nella stessa catena

47 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno L atomo di ossigeno del legame peptidico di ogni aminoacido forma legame idrogeno con l idrogeno del legame peptidico del quarto aminoacido successivo

48 Struttura secondaria delle proteine: α elica Il Dipolo Elettrico del legame peptidico viene trasmesso lungo un segmento elicoidale mediante i legami H intercatena generando un dipolo complessivo dell elica + = costituenti amminici -= costituenti carbossilici

49 Struttura secondaria delle proteine: α elica

50 Struttura secondaria delle proteine: α elica

51 PROLINA & GLICINA: residui incompatibili con la struttura dell α-elica Dove c è una prolina c è un ripiegamento

52 Struttura secondaria delle proteine: Stabilizzato tramite legami idrogeno Foglietto β tra segmenti adiacenti della catena polipeptidica

53 Struttura secondaria delle proteine: Foglietto β

54 Struttura secondaria delle proteine: Foglietto β

55 55

56 56

57 Ripiegamenti β Collegano le estremità di due segmenti adiacenti con strutture ad α elica oppure a foglietto β

58 Struttura terziaria delle proteine Definisce la disposizione di tutti gli atomi di una proteina nello spazio tridimensionale

59 Struttura terziaria delle proteine la struttura terziaria di una proteina può essere considerata come un insieme di segmenti peptidici con conformazioni ad α elica e a foglietto β uniti da tratti di connessione: Motivo Avvolgimento polipeptidico caratteristico formato da due o più elementi di struttura secondaria e dalle connessioni che le uniscono È ricorrente in proteine diverse

60 Struttura terziaria delle proteine Dominio: parte di una catena polipeptidica di per se stabile

61 Struttura terziaria delle proteine

62 Legame a idrogeno Ponte disolfuro Struttura terziaria delle proteine C H 2 N O CH 2 CH 2 S S CH 2 CH 2 CH 2 CH 2 Legame ionico Interazioni idrofobiche H O CH 2 CH 2 CH 2 NH 3 COO CH2 CH2 + - CH CH 3 CH 3 CH 3 CH 3 CH Struttura terziaria: riguarda la disposizione nello spazio e l interazione di residui di amminoacidi distanti tra loro nella sequenza lineare

63 Struttura terziaria delle proteine

64 Struttura terziaria delle proteine le interazioni tra le catene laterali degli aminoacidi determinano il modo in cui una lunga catena polipeptidica si ripiega nella forma tridimensionale della proteina

65 Struttura terziaria delle proteine Esempi: Mioglobina

66 Struttura terziaria delle proteine

67 Struttura terziaria delle proteine Residui Polari Residui Apolari Gli amminoacidi apolari tendono a sfuggire il contatto con l acqua e guidano interi segmenti della proteina ad occupare zone più interne della macromolecola ripiegata Gli amminoacidi polari si trovano più frequentemente sulla superficie della proteina stessa, a contatto con le molecole d acqua

68 Ripiegamento non corretto delle proteine

69 Denaturazione : perdita della struttura tridimensionale della proteina Agenti denaturanti: Calore ph estremi Solventi organici detergenti Rinaturazione delle proteine

70 Ripiegamento non corretto delle proteine MALATTIE PRIONICHE (morbo della mucca pazza) Prione, dall'inglese prion (acronimo di "PRoteinaceus Infective ONly particle"=particella infettiva solamente proteica), è il nome attribuito da Stanley B. Prusiner ad un allora ipotetico "agente infettivo non convenzionale" di natura proteica. AMILOIDOSI: Associazione spontanea di proteine non correttamente ripiegate sono un gruppo di malattie causate dal deposito in vari tessuti di proteine anomale. In ciascun tipo di amiloidosi, una diversa proteina prodotta dall'organismo acquisisce la proprietà di accumularsi in diversi organi e tessuti sotto forma di fibrille. I depositi formati da queste fibrille sono chiamati amiloidi. Il progressivo accumulo dell'amiloide provoca un danno degli organi coinvolti e causa i sintomi della malattia. Es: Morbo di Alzheimer (malattia neurodegenerativa) Morbo di Parkinson

71 Ripiegamento non corretto delle proteine Prione nel cervello dell individuo sano Prione nel cervello di un malato di encefalopatia spongiforme Le proteine riescono a svolgere la loro funzione solamente se possiedono una struttura corretta

72 Struttura quaternaria delle proteine Complessi tridimensionali che derivano dall associazione di due o più catene polipeptidiche SUBUNITA

73 Struttura quaternaria delle proteine: alcune proteine contengono più di una catena polipeptidica ogni catena polipeptidica: subunità EMOGLOBINA N di subunità: 1Monomerica 2Dimerica 3Trimerica 4Tetramerica n: multimerica struttura quaternaria = interazione nello spazio delle subunità

74 Ricapitolando Ad una determinata struttura corrisponde una specifica funzione struttura primaria struttura secondaria α eliche foglietti β struttura terziaria struttura quaternaria

75 Ricapitolando Ad una determinata struttura corrisponde una specifica funzione Proteine formate da più subunità

76 Considerando i diversi livelli di organizzazione strutturale possiamo classificare le proteine in base a struttura e solubilità Globulari Fibrose la maggior parte degli enzimi e delle proteine regolatrici determinano la resistenza, la forma e la protezione esterna delle cellule

77 Classificazione, Struttura & Funzione delle proteine Proteine fibrose: catene polipeptidiche disposte in lunghi fasci o foglietti. Normalmente è presente un solo elemento di struttura 2 a ripetuto più volte. Prevalente funzione strutturale. Insolubili in acqua. Proteine globulari: Segmenti di una catena o di catene polipeptidiche diverse si avvolgono l uno sull altro catene polipeptidiche ripiegate e forma sferica. Normalmente sono presenti più tipi di struttura 2 a. Prevalente funzione regolatoria ed enzimatica.

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

La biochimica è anche definita la chimica del C :

La biochimica è anche definita la chimica del C : Tutte le cellule viventi sono composte da macromolecole simili, costituite dalle stesse piccole molecole di base. La grande diversità è data dalle diverse combinazioni di 4 principali elementi C carbonio

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Modulo 2. Struttura e funzione delle proteine

Modulo 2. Struttura e funzione delle proteine Modulo 2 Struttura e funzione delle proteine Le proteine e i suoi costituenti Macromolecole più abbondanti e varie delle cellule - sbalorditiva diversità Ruolo primario nelle cellule e nell organismo (da

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

I PROTIDI. Aspetti generali

I PROTIDI. Aspetti generali I PROTIDI Aspetti generali I protidi o proteine sono sostanze organiche azotate, di struttura molto complessa, presenti in ogni forma di vita. In natura esistono moltissime proteine: si calcola, ad esempio,

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Riepilogo 1^ lezione

Riepilogo 1^ lezione Riepilogo 1^ lezione I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli