Riepilogo 1^ lezione

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Riepilogo 1^ lezione"

Transcript

1 Riepilogo 1^ lezione

2 I 20 amminoacidi che si trovano comunemente nelle proteine sono uniti l uno all altro da legami peptidici. La sequenza lineare degli amminoacidi legati contiene l informazione necessaria a generare una proteina con una forma tridimensionale esclusiva. La struttura di una proteina è complessa: organizzazione in 4 livelli gerarchici (struttura primaria, secondaria, terziaria, quaternaria).

3 Gli amminoacidi possono unirsi tra loro con legami peptidici Estremità amminica Il ripetersi di questa reazione dà luogo a polipeptidi e proteine.

4 Proprieta del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. H H H N R C H C O O OH + H H R N R C H O C O OH H N R C C H N H C C H OH

5 Il legame peptidico è rigido e planare Gli atomi di Cα di amminoacidi adiacenti sono separati da tre legami covalenti: O H Cα C N Cα PROPRIETA DEL LEGAME PEPTIDICO I 6 atomi del gruppo peptidico giacciono sullo stesso piano l ossigeno legato al carbonio del gruppo carbonilico e l atomo di idrogeno legato all azoto amminico, si trovano in trans. L ossigeno carbonilico ha una parziale carica negativa e l azoto amminico ha una parziale carica positiva ciò genera un parziale dipolo elettrico. I legami ammidici C-N hanno un parziale carattere di doppio legame per effetto della risonanza non possono ruotare liberamente. La rotazione è permessa solo attorno ai legami N-Cα e Cα-C.

6 Il legame peptidico è rigido e planare φ e ψ sono di 180 quando il polipeptide è nella conformazione complanare estesa e tutti i gruppi peptidici sono sullo stesso piano. φ e ψ possono assumere tutti i valori compresi tra -180 e +180, ma molti valori risultano proibiti per interferenze steriche tra gli atomi dello scheletro del polipeptide e quelli delle catene laterali.

7 Caratteristiche del legame peptidico Ha il carattere di un doppio legame parziale (è più corto di un legame singolo). E rigido e planare (non è possibile la rotazione attorno al legame tra il carbonio carbonilico e l azoto del legame peptidico). In genere è un legame di tipo trans, a causa di interferenze steriche tra i gruppi -R (i legami tra un Cα e un gruppo α-amminico o α-carbossilico possono ruotare!) I gruppi -C=O ed -NH del legame peptidico non hanno una carica elettrica (a differenza del gruppo α- amminico all estremità N-terminale ed α-carbossilico al C-terminale) ma sono polari e partecipano alla formazione di legami a idrogeno.

8 I singoli amminoacidi in una catena peptidica sono chiamati residui amminoacidici. In genere le proteine sono composte da residui amminoacidi. La struttura primaria di una proteina è definita dalla sequenza lineare dei residui amminoacidici.

9 La peculiare sequenza amminoacidica di una catena polipeptidica rappresenta la struttura primaria Lisozima

10 Struttura secondaria Si riferisce alla conformazione locale della catena polipeptidica. E determinata da interazioni di tipo legame a idrogeno fra l ossigeno di un gruppo carbonilico del legame peptidico e l idrogeno del gruppo ammidico di un altro legame peptidico. Esistono due tipi di strutture secondarie: l α-elica ed il foglietto β.

11 proteine: struttura secondaria strutture dovute ad interazioni locali di tipo ponte-h α-elica ponte-h ogni 3,6 aminoacidi Il legame H si instaura tra l H dell azoto amidico e l O del gruppo carbonilico residui esterni alla spirale β-foglietto legami idrogeno fra aminoacidi di catene diverse foglietto piegato

12 Struttura secondaria (α-elica) E una struttura in cui la catena polipeptidica è avvolta a spirale. Le catene laterali degli amminoacidi (-R) si protendono verso l esterno rispetto all asse della spirale. L α-elica è stabilizzata da legami idrogeno intracatena che si formano tra l ossigeno carbonilico di un legame peptidico e l idrogeno ammidico di un legame peptidico situato a 4 residui di distanza sulla catena. La prolina interrompe l α-elica!!! Gli amminoacidi con catene laterali (-R ) voluminose o cariche possono interferire con la formazione dell α-elica.

13 Struttura secondaria: alfa elica Legame idrogeno Le proprietà idrofobiche o idrofiliche di una alfa-elica dipendono dalle catene laterali degli aa

14 Champe et al., Le basi della biochimica, Ed. Zanichelli

15 Legame H α-elica ponte-h ogni 3,6 aminoacidi Il legame H si instaura tra l H dell azoto amidico e l O del gruppo carbonilico

16 Esempio di proteina composta da alfa eliche

17 Struttura secondaria (foglietto β) E una struttura ripiegata, formata da 2 o più catene polipeptidiche (filamenti) quasi completamente distese. I legami a idrogeno sono intercatena e perpendicolari allo scheletro del peptide. Tutti i componenti di un legame peptidico partecipano alla formazione di legami a idrogeno. Tali legami si realizzano tra l ossigeno di un gruppo carbonilico di un legame peptidico e l idrogeno del gruppo ammidico di un altro legame peptidico appartenente ad un filamento diverso.

18 Struttura secondaria: foglietto beta

19 Nei foglietti pieghettati ci sono ancora dei legami ad idrogeno, ma stavolta sono tra fogli adiacenti (sheet)

20 Struttura secondaria (foglietto β) I polipeptidi che formano un foglietto β possono disporsi in modo parallelo o antiparallelo. Un foglietto β può essere formato anche da una singola catena polipeptidica ripiegata su se stessa: in tal caso i legami a H sono legami intracatena. La superficie dei foglietti β è pieghettata.

21 β Sheet Stabilizzata da legami H intercatena tra N-H & C=O 2 Orientations Parallel Not optimum H-bonds; less stable Anti-parallel Optimum H-bonds; more stable

22 Struttura secondaria (sequenze non ripetitive) Queste strutture non ripetitive non sono casuali. Hanno una forma meno regolare rispetto all α-elica ed al foglietto β. La catena polipeptidica assume una conformazione ad anse ed avvolgimenti.

23 Circa un terzo dei residui che costituiscono le proteine globulari sono coinvolti in ripiegamenti "a gomito" che invertono la direzione della catena polipeptidica alla superficie della molecola e rendono possibile la struttura globulare. Data la loro frequenza, questi ripiegamenti vengono classificati come terzo tipo di struttura secondaria oltre alle α-eliche e ai foglietti β. α-elica Foglietto-β β-turns Esistono diversi tipi di ripiegamento che coinvolgono diversi residui. I più frequenti sono i β-turns (tradotti in italiano come curve β, ripiegamenti β, etc.), che spesso uniscono due filamenti β antiparalleli a formare un'ansa a forcina. I β-turns sono definiti da 4 residui che occupano le posizioni designate da i a i+3 i i+1 i+2 i+3 Nell'ambito dei β-turns si possono identificare diversi tipi, ma i più frequenti sono quelli cosiddetti di Tipo I e Tipo II, anche se il Tipo I è 2-3 volte più frequente del Tipo II.

24 I ripiegamenti β sono frequenti nelle proteine. Le proteine globulari presentano circa 1/3 dei residui aa sotto forma di ripiegamenti o anse, dove la catena proteica inverte la sua direzione, i ripiegamenti β sono i più diffusi, collegano due estremità di un foglietto β antiparallelo, 4 residui con un angolazione di 180 e formazione di un ponte di H tra il Carbonile del I a. e l H dell N del IV amminoacido. Gly e Pro sono frequenti in questa conformazione. Gly perché piccola e flessibile Pro perché l imminoacido promuove la forma cis degli aa. coinvolti nel legame

25 Super-secondary Structure β-turns in una proteina permettono che eliche e foglietti si allineino βαβ αα β meander

26

27 Qui sopra sono riprodotte le 2 conformazioni descritte per la stessa proteina, la proteina prionica, la cui alterazione conformazionale provoca la cosiddetta malattia della Mucca Pazza(v. Connessioni Biochimiche, pag. 105 del Campbell-Farrell). A sinistra è illustrata la struttura a) della proteina prionica buona, che è presente in moltissimi organismi, uomo compreso. A destra (b) è riportata la struttura della proteina prionica cattiva. Come si può constatare nella forma a) esistono 2 tratti ad α-elica, 1 a sinistra (verde), ed 1 a destra (rosso). Nel passaggio alla forma b) il tratto verde cambia ripiegamento e genera 2 tratti β antiparalleli. Pure il tratto rosso fa altrettanto e genera i 2 tratti rossi βantiparalleli nella forma b),producendo, in definitiva, un unico foglietto β formato da 4 tratti β contigui.

28

29 Le strutture primarie sono mantenute da legami peptidici. Le strutture secondarie sono mantenute da legami idrogeno tra atomi di residui aminoacidici.

30 Quattro livelli di struttura determinano la forma di una proteina alfa Beta Primaria: la sequenza lineare degli amino acidi tenuti insieme da legami peptidici. Secondaria: l organizzazione di parti di una catena polipeptidica (es.: l α elica o il foglietto β), tenute da legami a ponte di H. Terziaria: la struttura tridimensionale completa di una catena polipeptidica, con molti tipi di legami e interazioni di cui solo uno covalente il ponte ds. Quaternaria: l associazione di due o più polipeptidi in una struttura complessa multi-subunità

31 Per funzionare una proteina deve assumere una struttura tridimensionale precisa collagene mioglobina

32 proteine: struttura terziaria Determina la struttura 3D R apolari verso l interno (eccetto in Stabilizzata da proteine integrali di membrana) ponti S-S R polari verso l esterno (solvatati da H 2 O) interazioni idrofobiche interazioni elettrostatiche (legami ionici) legami di Wan der Waals Suscettibile di denaturazione-rinaturazione

33 ponti disolfuro

34 Il Ponte Di-S si forma tra gruppi sulfidrilici adiacenti di cysteine (-S-H). La formazione avviene mediante ossidazione, il taglio in residui disulfidici mediante riduzione. Denatured inactive ribonuclease

35 Struttura terziaria : relazione a lungo raggio tra amminoacidi anche molto distanti tra di loro, I protagonisti sono i gruppi R che possono appartenere anche a filamenti con diverse strutture secondarie.

36

37

38 proteine: struttura terziaria effetto dell interazione idrofobica Non polare Catena laterale Legame a H si può formare sulla catena laterale sul lato esterno della molecola Core idrofobico contenente catene laterali non polari struttura 3D Polipeptide senza struttura terziaria Conformazione con struttura terziaria in ambiente acquoso

39 ORIGINE DELLA STRUTTURA TERZIARIA

40 L'effetto idrofobico è la forza motrice del ripiegamento di una proteina. La struttura terziaria si genera grazie alle interazioni tra i gruppi R, i quali si posizioneranno in risposta a attrazione o repulsione, generando la struttura finale.

41 Le strutture terziarie sono sempre compatte La superficie delle proteine è polare mentre l'interno è prevalentemente apolare eccezione per le proteine di membrana, dove è l opposto.

42 L'avvolgimento della catena deve essere tale da esporre sempre al solvente acquoso le catene laterali idrofile. Catene laterali cariche possono trovarsi all'interno di una proteina solo se la loro carica netta viene neutralizzata.

43 Legami responsabili della struttura terziaria Forze di Wan der Waals Legami a H Legami ionici Legami S-S 1-2 Kcal/mole 3-7 Kcal/mole 5 Kcal/mole 50 Kcal/mole

44

45

46

47 Le proteine con peso molecolare superiore a sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

48 Le proteine oligomeriche presentano un ulteriore livello di organizzazione srutturale la struttura quaternaria LA STRUTTURA QUATERNARIA descrive il modo in cui le singole catene polipeptidiche sono disposte l'una rispetto all'altra.

49 Classificazione generale delle strutture terziarie Proteine con predominanza di α elica Proteine miste Proteine con predominanza di β sheets Biofisica

50 Per la sintesi di una catena polipeptidica di 4000 residui aminoacidici è necessario un gene che contenga almeno 4OOO x 3 = basi azotate. Per la sintesi di 2O copie di una stessa catena polipeptidica di 200 residui è sufficiente un gene che contenga solo 200 x 3 = 600 basi

51 Emoglobina Emoglobina e collageno Collageno

52 La struttura terziaria è generata dal ripiegamento e dalla conformazione della catena polipeptidica. La struttura quaternaria è l organizzazione di polipeptidi in un unica unità funzionale che consiste di più di una subunità polipeptidica.

53 Rappresentazioni grafiche differenti della stessa proteina

54

55

56 In alcune catene polipeptidiche particolarmente lunghe (più di 200 residui) si ritrovano 2 o più zone distinte ( residui) a struttura globulare e compatta, congiunte da segmenti di catena polipeptidica relativamente flessibili. Queste strutture si definiscono DOMINI

57 LA STRUTTURA QUATERNARIA DI UNA PROTEINA PUÒ SUBIRE MODIFICHE CONFORMA ZIONALI REVERSIBILI AD OPERA DI LIGANDI, DEFINITI EFFETTORI ALLOSTERICI. LE MODIFICHE CONFORMAZIONALI POSSONO ALTERARE LA FUNZIONE DI UNA PROTEINA, REALIZZANDO IN TAL MODO UN IMPORTANTE MECCANISMO DI CONTROLLO DELLA SUA ATTIVITÀ BIOLOGICA.

58 Riepilogo 2^lezione

59 Le proteine oligomeriche presentano un ulteriore livello di organizzazione srutturale la struttura quaternaria LA STRUTTURA QUATERNARIA descrive il modo in cui le singole catene polipeptidiche sono disposte l'una rispetto all'altra.

60

61 La struttura quaternaria delle proteine La struttura quaternaria riguarda proteine costituite da 2 o più catene polipeptidiche o da più domini strutturali (es. proteine regolatrici). E possibile classificare le proteine in due gruppi: Proteine fibrose con catene disposte in lunghi fasci o foglietti e Proteine globulari con catene polipeptidiche ripiegate a formare forme globulari o sferiche Esempio: la emoglobina Le interazioni tra le subunità consentono grandi variazioni nell attività catalitica Biofisica

62 Per la sintesi di una catena polipeptidica di 4000 residui aminoacidici è necessario un gene che contenga almeno 4OOO x 3 = basi azotate. Per la sintesi di 2O copie di una stessa catena polipeptidica di 200 residui è sufficiente un gene che contenga solo 200 x 3 = 600 basi Biofisica

63 In alcune catene polipeptidiche particolarmente lunghe (più di 200 residui) si ritrovano 2 o più zone distinte ( residui) a struttura globulare e compatta, congiunte da segmenti di catena polipeptidica relativamente flessibili. Queste strutture si definiscono DOMINI Biofisica

64 Struttura terziaria (i domini) Le catene polipeptidiche formate da più di 200 amminoacidi in genere comprendono 2 o più piccole unità compatte: i domini. I domini sono le unità strutturali e funzionali di una proteina. Ciascun dominio è una regione globulare, compatta, che si forma per la combinazione di più elementi strutturali secondari (α-eliche, foglietti β, sequenze non ripetitive). Strutturalmente, ciascun dominio è indipendente da altri domini della stessa catena polipeptidica. La struttura terziaria riguarda sia il ripiegamento di ciascun dominio sia la disposizione reciproca finale dei domini di un polipeptide.

65 Le proteine con peso molecolare superiore a sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

66 Vantaggi della struttura quaternaria Risparmio di DNA Minimizzazione degli errori casuali durante la biosintesi proteica Presenza di interazioni allosteriche

67 La Ferritina ha un peso molecolare di circa daltons. Non è costituita da una sola catena polipeptidica di 400 a.a. ma di 20 catene identiche di circa 200 residui ciascuna.

68 LA GLICERALDEIDE-3-FOSFATO DEIDROGENASI È COSTITUITA DA 4 SUBUNITÀ IDENTICHE DI 330 RESIDUI (330 X 3 = 990 NUCLEOTIDI) SE LA PROTEINA CONSISTESSE IN 1 CATENA DI (330 X 4) 1320 RESIDUI OCCORREREBBE UN GENOMA DI 3 X 1320=3960 NUCLEOTIDI.

69

70

71 Generalmente nella formazione delle proteine oligomeriche le subunità difettose sono scartate.

72 Nelle cellule le proteine si sintetizzano ad una velocità molto elevata. Le cellule di E.Coli producono una molecola proteica biologicamente attiva contenente 100 residui aminoacidici in 5 sec a 37.

73 COME FANNO LE PROTEINE AD AVVOLGERSI NEL TEMPO DI POCHI SECONDI?

74 Supponiamo che ciascuno dei 2 angoli di torsione, φ ψ, di una proteina con n residui possa assumere 3 conformazioni stabili, le conformazioni possibili per questa proteina saranno 3 2n circa 100 n Se la proteina può esplorare una conformazione ogni secondi Il tempo in sec necessario per esplorare tutte le conformazioni possibili sarà t = 10 n / Per n= 100 t = ( 20 miliardi di anni!)

75 Le proteine non ricercano casualmente la conformazione nativa fra le molte possibili si ripiegano seguendo vie dirette

76 PICCOLI TRATTI DI STRUTTURA SECONDARIA SERVONO DA MEDIATORI DEL PROCESSO DI AVVOLGIMENTO.

77 LA FORMAZIONE DI CORTI SEGMENTI DI STRUTTURA SECONDARIA È MOLTO VELOCE.

78 Questi piccoli tratti (circa 15 residui) si stabilizzano formando dei complessi (es 2α, 2β, αβ) che si chiamano unità di avvolgimento. Intorno a questi centri si stabilizzano poi altri tratti di struttura secondaria

79 L'avvolgimento spontaneo delle catene polipeptidiche nella loro corretta struttura terziaria è un processo altamente cooperativo, in cui la formazione di piccoli elementi accelera la produzione di altri più grandi

80 Il processo di ripiegamento di una proteina procede da uno stato ad alta energia ed alta entropia ad uno a bassa energia e bassa entropia

81 IL processo di avvolgimento delle proteine può essere accelerato dall enzima proteina disolfuro isomerasi

82

83

84 Per alcune proteine a tale processo partecipano gli chaperoni molecolari che : contribuiscono al corretto avvolgimento di una proteina nascente consentono alle proteine ripiegate in modo non corretto di raggiungere la conformazione nativa

85 Esistono due classi di chaperoni molecolari : la famiglia Hsp70 e le chaperonine (Hps60 o GroEL ed o Hsp10 GroES )

86 Le chaperonine sono costituite da due tipi di proteine HP60 (GroEL) e HP10 (GroES) GroEL 14 subunità identiche (549 aa) disposte in due anelli sovrapposti (7+7) GroES 7 subunità identiche (97aa) formano un anello eptamerico

87

88 Conformazione, modificazione e degradazione delle proteine Una catena polipeptidica appena sintetizzata deve conformarsi e spesso subire modificazioni chimiche per generare la proteina finale Tutti i polipeptidi con la stessa sequenza amminoacidica assumono, in condizioni standard, la stessa conformazione (lo stato nativo), che è la più stabile conformazione che la molecola può assumere.

89 L informazione per il folding della proteina è contenuta nella sequenza

90 Proteine denaturare al calore, con acidi, o chimici perdono la struttura terziaria e secondaria e la funzione biologica. Il processo è reversibile

91 Le chaperonine assistono le proteine nella fase di folding, prevenendo il legame con ligandi inappropriati.

92

93 Molte malattie sono dovute al difettoso ripiegamento di una proteina Alcune patologie derivano da proteine che non sono in grado di raggiungere la loro struttura funzionale e che tendono a formare grossi aggregati (fibrille o forme amiloidi): Alzheimer, Parkinson, encefalopatia spongiforme, diabete di tipo II. In altri casi mutazioni puntiformi generano proteine che non raggiungono la loro locazione finale o che non sono più in grado di svolgere la loro funzione perché incapaci di legare i loro substrati. La fibrosi cistica è un difetto nella proteina transmembrana che agisce come un canale degli ioni cloro nelle cellule epiteliali (CFTR: 1480 amminoacidi). La mutazione più comune è la delezione di un amminoacido (Phe 508) e la proteina mutata non si avvolge correttamente.

94 Proteine conformate in modo aberrante sono implicate nello sviluppo di patologie Una placca amiloide nella malattia di Alzheimer è un agglomerato di filamenti proteici

95 Comparazione sequenze Hum αglobina: Bovis: Pig: mvlspadktn vkaawgkvga hageygaeal mvlsaadkgn vkaawgkvgg haaeygaeal vlsaadkan vkaawgkvgg qagahgaeal ermflsfptt ktyfphfdls hgsaqvkghg kkvadaltna vahvddmpna ermflsfptt ktyfphfdls hgsaqvkghg akvaaaltka vehlddlpga ermflgfptt ktyfphfnls hgsdqvkahg kvadaltka vghlddlpga lsalsdlhah klrvdpvnfk llshcllvtl aahlpaeftp avhasldkfl lselsdlhah klrvdpvnfk llshsllvtl ashlpsdftp avhasldkfl lsalsdlhah klrvdpvnfk llshcllvtl aahhpddfnp svhasldkfl asvstvltsk yr anvstvltsk yr anvstvltsk yr

96 L omologia delle sequenze suggerisce relazioni funzionali ed evolutive tra le proteine

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

SOSTEGNO proteine strutturali (collagene, cheratina, elastina, fibroina) CATALISI (enzimi)

SOSTEGNO proteine strutturali (collagene, cheratina, elastina, fibroina) CATALISI (enzimi) PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Forma e funzione Stretta correlazione fra forma e funzione delle proteine È la conformazione tridimensionale che conferisce alla proteina l'attività biologica

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Fondamentali in ogni organismo, hanno molteplici ruoli:

Fondamentali in ogni organismo, hanno molteplici ruoli: Le proteine Fondamentali in ogni organismo, hanno molteplici ruoli: Componenti strutturali (collagene, tessuto connettivo, citoscheletro, pelle) Trasportatori (emoglobina, albumina) Trasmettitori di messaggi

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

dominio strutturale dominio modulo

dominio strutturale dominio modulo Riepilogo 2^lezione DOMINI Si definisce dominio strutturale (o dominio o modulo) di una proteina: un'unità globulare o fibrosa formata da catene polipeptidiche ripiegate in più regioni compatte le quali

Dettagli

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica.

Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. Concanavalina A Emoglobina subunità Trioso fosfato isomerasi Una proteina qualsiasi assume costantemente un unica conformazione ben definita, cui è legata la sua azione biologica. 1 La conformazione è

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

La demolizione delle proteine è fondamentale quanto la loro costruzione:

La demolizione delle proteine è fondamentale quanto la loro costruzione: La demolizione delle proteine è fondamentale quanto la loro costruzione: la pepsina, la tripsina, insieme ad altri enzimi proteolitici, spezzettano le proteine complesse del cibo in amminoacidi, passaggio

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ

OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ Scaricato da Le proteine con peso molecolare superiore a 50.000 sono OLIGOMERICHE Sono costituite cioè da più catene polipeptidiche PROTOMERI O SUBUNITÀ SunHope.it 1 Scaricato da Le proteine oligomeriche

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

Acquisizione e Stabilità della struttura terziaria delle proteine

Acquisizione e Stabilità della struttura terziaria delle proteine Acquisizione e Stabilità della struttura terziaria delle proteine FORZE CHE STABILIZZANO LA STRUTTURA TERZIARIA DELLE PROTEINE 1. Legame covalente S-S (forte): non è presente in tutte le proteine che,

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60

Modello del collasso idrofobico. Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Modello gerarchico Modello del collasso idrofobico Il folding è facilitato dalla presenza di chaperons molecolari quali le Heat Shock Proteins, Hsp70 e Hsp60 Le Hsp70 si legano ai segmenti idrofobici di

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

Struttura e funzione delle proteine

Struttura e funzione delle proteine Proteine Struttura e funzione delle proteine Le cellule viventi contengono un corredo estremamente diversificato di molecole proteiche, ciascuna costituita da una catena lineare di aminoacidi uniti da

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina Per molti organismi, l O 2 è una molecola di importanza vitale: l'ossigeno è infatti l'accettore finale degli elettroni, che "fluendo" attraverso i complessi della catena respiratoria,

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine.

Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Struttura di proteine Gli amminoacidi Il legame peptidico Motivi strutturali classificazione, architettura topologia delle strutture tridimensionali di proteine. Correlazioni struttura-funzione Gli amminoacidi

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

La struttura delle proteine e. organizzazione. ramificati di aminoacidi

La struttura delle proteine e. organizzazione. ramificati di aminoacidi La struttura delle proteine e descritta da quattro livelli di organizzazione Struttura Primaria- la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Folding delle Proteine

Folding delle Proteine Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Folding delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari

Dettagli

Capitolo 1. Le proteine. 1.1 La struttura delle proteine

Capitolo 1. Le proteine. 1.1 La struttura delle proteine Capitolo 1 Le proteine 1.1 La struttura delle proteine Le proteine sono le macromolecole più versatili dei sistemi viventi e hanno un ruolo fondamentale in tutti i processi biologici. Le proteine possono

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina

CROMATINA ISTONI. Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina CROMATINA Complesso molecolare formato da DNA, istoni e proteine non istoniche ISTONI Proteine relativamente piccole, con forte carica positiva per la presenza degli aminoacidi lisina e arginina Si conoscono

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli