Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5"

Transcript

1 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5

2 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame peptidico ha parziale carattere di doppio legame Il legame peptidico è un ibrido di risonanza I legami peptidici nelle proteine assumono la conformazione trans

3 Condensazione di due amminoacidi

4 Condensazione di due amminoacidi

5 Oligopeptidi o polipeptidi La reazione lascia ancora disponibile un gruppo NH 3 a un estremità del peptide e un gruppo carbossilico libero all altra. Perciò la reazione potrebbe essere continuata aggiungendo uno o più amminoacidi all estremità COOH del peptide. Le estremità N-terminali di molte proteine sono bloccate da gruppi N-formilici o N- acetilici e alcune proteine presentano i carbossili C-terminali modificati in ammidi.

6 Risonanza del legame peptidico IL LEGAME PEPTIDICO E UN IBRIDO DI RISONANZA ha cioè ha un parziale carattere di doppio legame

7 Risonanza del legame peptidico C α O C N H C α C α O - C N + H C α C α O δ - C N H C α δ +

8 Coplanarità del legame peptidico Il gruppo peptidico è una struttura rigida, e cioè i quattro atomi CO-NH che lo definiscono e i due carboni α che esso collega sono coplanari. La relazione di coplanarità degli atomi del gruppo ammidico è sottolineata da un piano immaginario ombreggiato, che giace tra due carboni α successivi nello scheletro peptidico.

9 Lunghezza del legame peptidico Legame C-N 1,45 A Legame C=N 1,28 A Legame CO-NH 1,32 A

10 Proprietà dei legami peptidici Le cariche parziali, rispettivamente negativa e positiva, sull ossigeno e sull idrogeno del legame, rendono tali atomi particolarmente disponibili a formare legami a idrogeno. Gli unici legami di una catena polipeptidica su cui è teoricamente possibile libera rotazione sono quelli che il Cα di ciascun amminoacido forma con il carbonio carbonilico dell amminoacido che precede, e con l azoto ammidico dell amminoacido che segue: gli angoli di rotazione intorno a questi legami sono designati rispettivamente ψ e ϕ. ψ C α O δ - C N H ϕ C α δ + Da ciò consegue che l esatta definizione dei valori degli angoli diedri ψ e ϕ di una catena polipeptidica ci darebbe la conformazione del polipeptide.

11 Proprietà dei legami peptidici

12 Grafico di Ramachandran Dato l alto numero di valori possibili degli angoli ψ e ϕ per ciascun legame, il numero di conformazioni possibili è elevatissimo. Ma ci sono delle limitazioni a questo numero dovute agli impedimenti sterici dei gruppi peptidici e delle catene laterali. Ramachandran studiò i limiti imposti dall impedimento sterico alla libera rotazione sui legami ψ e ϕ e propose un grafico.

13 I legami peptidici assumono la conformazione trans IL LEGAME PEPTIDICI NELLE PROTEINE SONO IN CONFIGURAZIONE TRANS AD ECCEZIONE DEI LEGAMI PEPTIDICI IN CUI L AZOTO CHE PARTECIPA AL LEGAME E QUELLO, INSERITO IN UN ANELLO PIRROLICO, DELLA PROLINA. Fanno inoltre eccezione alcuni oligopeptidi ciclici, in cui le estremità N- e C- terminali sono legate tra loro.

14 I derivati degli amminoacidi Concetti chiave: Le catene laterali dei residui amminoacidici nelle proteine possono essere modificate covalentemente. Alcuni amminoacidi e i loro derivati fungono da ormoni e molecole regolatorie.

15 Gli amminoacidi modificati nelle proteine Oltre ai 20 amminoacidi proteici ci sono amminoacidi che svolgono una serie di funzioni biologiche importanti. Nelle proteine, le catene laterali degli amminoacidi possono essere modificate. Generalmente gli aa vengono modificati dopo la sintesi della catena polipeptidica.

16 I derivati degli amminoacidi biologicamente attivi Alcuni derivati di amminoacidi fungono da messaggeri chimici per la comunicazione tra cellule. Il GABA (prodotto di decarbossilazione della glutammina) e la dopamina (derivato della tirosina) sono neurotrasmettitori. L istamina (prodotto di decarbossilazione dell istidina) è un potente mediatore delle reazioni allergiche. La tiroxina (derivato della tirosina) è un ormone tiroideo.

17 I derivati degli amminoacidi biologicamente attivi La carnosina è un dipeptide naturale del tessuto muscolare. E anche utilizzata come integratore per le sue proprietà antiossidanti.

18 I derivati degli amminoacidi biologicamente attivi Vasopressina ed ossitocina sono ormoni costituiti da peptidi ciclici di nove amminoacidi che contengono un ponte S-S. Il C-terminale è ammidato. L ossitocina induce il travaglio, regola la contrazione muscolare uterina e stimola la produzione del latte materno. La vasopressina controlla la pressione del sangue regolando la contrazione della muscolatura liscia. Ha effetto antidiuretico.

19 I derivati degli amminoacidi biologicamente attivi Le encefaline sono pentapeptidi del cervello che fungono da analgesici (antidolorifici) naturali. Le loro proprietà sono dovute alla loro similarità strutturale con gli oppiacei come la morfina che legano probabilmente gli stessi recettori. Encefalina leucina (Leu-encefalina) Tyr-Gly-Gly-Phe-Leu YGGFL Encefalina metionina (Met-encefalina) Tyr-Gly-Gly-Phe-Met YGGFM

20 I derivati degli amminoacidi biologicamente attivi Alcuni peptidi batterici con proprietà antibiotiche contengono D-amminoacidi come la gramicidina S e la tirocidina A che sono prodotti dal batterio Bacillus brevis. Entrambi contengono anche ornitina, un amminoacido non proteico che svolge un ruolo come metabolita intermedio di molte vie metaboliche.

21 Dimerizzazione del glutatione Il Glutatione è un tripeptide con struttura Glu-Cys-Gly in cui il gruppo γ-carbossilico della catena laterale del Glu forma un legame isopeptidico con il gruppo amminico del residuo di Cys. Ha un ruolo fondamentale nel metabolismo cellulare nell inattivazione di composti ossidanti che sono in grado di danneggiare le strutture cellulari.

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

PROTIDI: LE PROTEINE E GLI AMMINOACIDI

PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Le proteine. Sintetizzate nei ribosomi come una sequenza lineare di amminoacidi assumono in seguito una struttura tridimensionale

Le proteine. Sintetizzate nei ribosomi come una sequenza lineare di amminoacidi assumono in seguito una struttura tridimensionale Le proteine Elementi funzionali e strutturali di fondamentale importanza per lo svolgimento di funzioni metaboliche, di trasporto, di trasmissione nervosa o contrattile, ormonale o immunitaria Sintetizzate

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 6 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 6 La struttura secondaria delle proteine Concetti chiave: Il carattere planare di un gruppo peptidico limita la flessibilitàconformazionale

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Amminoacidi e Proteine

Amminoacidi e Proteine Amminoacidi e Proteine Struttura generale di un α-amminoacido R = catena laterale AMMINOACIDI (AA) CELLULARI Gli amminoacidi presenti nella cellula possono essere il prodotto di idrolisi delle proteine

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

H N H R N H R N R R N R H H H

H N H R N H R N R R N R H H H AMMINE Sono derivati dell ammoniaca (NH 3 ) nei quali uno o più atomi di idrogeno sono sostituiti da altrettanti radicali alchilici (R-, come ad esempio il gruppo -CH 3 ). Come l ammoniaca anche le ammine

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

Composti carbonilici Acidi carbossilici

Composti carbonilici Acidi carbossilici Composti carbonilici Acidi carbossilici Acidi carbossilici: nomenclatura alcano -> acido alcanoico Acidi carbossilici: proprietà Il gruppo carbossilico ha caratteristiche comuni ai chetoni (C=O) e agli

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Lezione 2. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi

Lezione 2. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi Lezione 2 Bioinformatica Mauro Ceccanti e Alberto Paoluzzi Dip. Informatica e Automazione Università Roma Tre Dip. Medicina Clinica Università La Sapienza Lezione 2: AMMINOACIDI E POLIPEPTIDI Aminoacidi

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

SINTESI PEPTIDICA LEZIONE 4

SINTESI PEPTIDICA LEZIONE 4 SINTESI PEPTIDICA LEZIONE 4 PEPTIDI I legami peptidici sono legami ammidici che uniscono i residui amminoacidici. gruppo ammino libero a sx gruppo carbossilico libero a dx configurazione trans più stabile

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Digestione delle proteine: 6 fasi

Digestione delle proteine: 6 fasi orletto a spazzola Digestione delle proteine: 6 fasi 1. Idrolisi gastrica del legame peptidico 2. Digestione a peptidi più piccoli da parte delle proteasi pancreatiche nel lume dell intestino tenue 3.

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Omeostasi e coordinamento funzioni di un organismo

Omeostasi e coordinamento funzioni di un organismo Omeostasi e coordinamento funzioni di un organismo Organismi unicellulari Organismi pluricellulari Scambi attivi con l ambiente esterno Comunicazione elettrica Comunicazione chimica Meccanismi di comunicazione

Dettagli

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali):

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali): AMINOAIDI. Proteine (gr. pròtos = primo) > 50% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida (o alcalina) α-aminoacidi Struttura generale degli α-aminoacidi primari (standard,

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico

ACIDI CARBOSSILICI. ac. formico ac. acetico ac. benzoico ACIDI CARBOSSILICI ac. formico ac. acetico ac. benzoico Nomenclatura Nomenclatura acido malonico Acidi bicarbossilici a catena alifatica Proprietà fisiche I primi termini della serie sono liquidi incolori

Dettagli

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione:

La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Luciferasi Emoglobina Cheratina La struttura delle proteine viene suddivisa in quattro livelli di organizzazione: Struttura primaria Struttura secondaria Struttura terziaria Struttura quaternaria Sequenza

Dettagli

Amminoacidi - Peptidi - Proteine. Emoglobina

Amminoacidi - Peptidi - Proteine. Emoglobina Amminoacidi - Peptidi - Proteine Emoglobina 1 Emoglobina Gli amminoacidi sono le sostanze di base che costituiscono le proteine. Ogni proteina è caratterizzata da una precisa sequenza di mattoni di amminoacidi.

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE Le PROTEINE sono i biopolimeri maggiormente presenti all interno delle cellule, dal momento che costituiscono dal 40 al 70% del peso secco. Svolgono funzioni biologiche

Dettagli

N 2, malgrado la sua abbondanza, è un fattore limitante la crescita della maggior parte degli organismi

N 2, malgrado la sua abbondanza, è un fattore limitante la crescita della maggior parte degli organismi Glicina (Gly) Alanina (Ala) N 2, malgrado la sua abbondanza, è un fattore limitante la crescita della maggior parte degli organismi La digestione delle proteine endopeptidasi H O R H O R R H 3+ N -C-C-NH-C-C-NH-C-C-NH-C-C-NH-C-COO

Dettagli

Nei batteri non è presente una membrana nucleare

Nei batteri non è presente una membrana nucleare La cellula procariota (Bacteria e Archaea) Morfologia generale Composizione chimica Le strutture cellulari e le loro funzioni parte 1 L involucro Appendici esterne: Le strutture cellulari e le loro funzioni

Dettagli

FUNZIONI DELLE PROTEINE

FUNZIONI DELLE PROTEINE FUNZIONI DELLE PROTEINE 1 CATALISI ENZIMATICA 2 TRASPORTO E DEPOSITO 3 MOVIMENTO COORDINATO 4 SUPPORTO MECCANICO 5 PROTEZIONE IMMUNITARIA 6 GENERAZIONE E TRASMISSIONE DELL IMPULSO NERVOSO 7 CONTROLLO DELLA

Dettagli

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale:

Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: Gli amminoacidi Gli amminoacidi sono dei composti polifunzionali che hanno formula generale: N 2 Il nome ordinario degli amminoacidi prevale su quello della nomenclatura IUPA. Si possono avere α-amminoacidi,

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine)

SUBUNITA MAGGIORE = 60S (rrna 28S, 5.8S e 5S + 45 proteine) SUBUNITA MAGGIORE = 50S (rrna 23S e 5S + 34 proteine) TRADUZIONE I RIBOSOMI I Ribosomi hanno un diametro di circa 15-30 nm, sono costituiti da proteine ed rrna e sia nei Procarioti che negli Eucarioti, sono costituiti da una subunità maggiore e da una subunità

Dettagli

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica combustibili intermedi metabolici Impalcatura del DNA e RNA

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

LA CHIMICA DEL CARBONIO

LA CHIMICA DEL CARBONIO LA CHIMICA DEL CARBONIO E QUELLA PARTE DELLA CHIMICA CHE STUDIA IL CARBONIO E TUTTI I SUOI DERIVATI. I COMPOSTI DEL CARBONIO POSSONO ESSERE NATURALI (PROTEINE, ACIDI NUCLEICI, LIPIDI E CARBOIDRATI) O ESSERE

Dettagli

Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre

Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre Una risposta cellulare specifica può essere determinata dalla presenza di mediatori chimici (ormoni o altre molecole), dall interazione con altre cellule (contatto cellula-cellula) o con strutture extracellulari

Dettagli

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di

LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI PROTEINE. sono ACIDI NUCLEICI. molecole complesse = POLIMERI. formate dall'unione di LE BIOMOLECOLE LE BIOMOLECOLE DETTE ANCHE MOLECOLE ORGANICHE; CARBOIDRATI LE BIOMOLECOLE sono LIPIDI PROTEINE ACIDI NUCLEICI molecole complesse = POLIMERI formate dall'unione di molecole semplici = MONOMERI

Dettagli

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA Enzimi semplici Enzimi coniugati - utilizzano esclusivamente le reattività chimiche di alcuni residui AA - richiedono la reattività chimica aggiuntiva di COFATTORI o COENZIMI gruppi prostetici COENZIMI

Dettagli

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi

aa 2013-14 Proteine Struttura delle Proteine α Amminoacidi Proteine Biopolimeri degli α-amino acidi. Amino acidi sono uniti attraverso il legame peptidico. Alcune funzioni: Struttura (collagene, cheratina ecc.) Enzimi (maltasi, deidrogenasi ecc) Trasporto (albumine,

Dettagli

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine MFN0366-A1 (I. Perroteau) -traduzione delle proteine trna Traduzione: mrna -------> proteine mrna MFN0366-A1 (I. Perroteau) -traduzione

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole

Dettagli

dieta vengono convertiti in composti dei corpi chetonici.

dieta vengono convertiti in composti dei corpi chetonici. Metabolismo degli aminoacidi Metabolismo degli aminoacidi Gli aminoacidi introdotti in eccesso con la dieta vengono convertiti in composti precursori del glucosio, degli acidi grassi e dei corpi chetonici.

Dettagli

Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)

Dettagli

I composti organici. Il carbonio e i composti organici

I composti organici. Il carbonio e i composti organici I composti organici Il carbonio e i composti organici COSA SONO I COMPOSTI ORGANICI? I composti organici sono composti in cui uno o più atomi di carbonio (C) sono uniti tramite un legame covalente ad atomi

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

INTRODUZIONE ALLA PROTEINE BCP 1-2

INTRODUZIONE ALLA PROTEINE BCP 1-2 INTRODUZIONE ALLA BIOCHIMICA DELLE PROTEINE BCP 1-2 Pietre miliari Lehninger 1973 Biochemistry Proteine ricombinanti Protein engineering Cristallografia, NMR, EM, MS, spettroscopie... Computing Bioinformaticai

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine Nelle proteine vi sono quattro livelli di organizzazione strutturale Struttura Primaria: sequenza di aminoacidi legati tra loro da legami peptidici Tutte le proteine esistenti

Dettagli

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI

PROTEINE. sono COMPOSTI ORGANICI QUATERNARI PROTEINE sono COMPOSTI ORGANICI QUATERNARI Unione di elementi chimici diversi Il composto chimico principale è il C (carbonio) Sono quattro gli elementi chimici principali che formano le proteine : C (carbonio),

Dettagli

NH 2 CHCOOH AMINOACIDI PRESENTI NELLE PROTEINE. Abbreviazione internazionale. Nome. acido aspartico acido glutammico. CXasparagina.

NH 2 CHCOOH AMINOACIDI PRESENTI NELLE PROTEINE. Abbreviazione internazionale. Nome. acido aspartico acido glutammico. CXasparagina. Le proteine sono composti organici quaternari; esse sono costituite infatti da C,H,N e O. Pertanto rappresentano l'unica fonte di azoto del nostro organismo. Le proteine si formano per polimerizzazione

Dettagli

Farmaci del sistema nervoso autonomo

Farmaci del sistema nervoso autonomo Farmaci del sistema nervoso autonomo Farmaci colinergici Esercitano i loro effetti farmacologici sul sistema nervoso parasimpatico che utilizza Acetilcolina come mediatore chimico L acetilcolina (Ach)

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina Per molti organismi, l O 2 è una molecola di importanza vitale: l'ossigeno è infatti l'accettore finale degli elettroni, che "fluendo" attraverso i complessi della catena respiratoria,

Dettagli