CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE"

Transcript

1 CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente.

2 Alcheni Ibridazione sp 2 2s p x p y p z 2s p x p y p z promozione ibridazione 1s 1s 1s Legame π Origina dalla sovrapposizione laterale di orbitali p situati su atomi adiacenti sp 2 sp 2 Trigonale planare 120

3 Legame π : Origina dalla sovrapposizione laterale di orbitali p situati su atomi adiacenti È impedita la rotazione intorno al doppio legame C=C Gli orbitali sp 2 giacciono tutti sullo stesso piano Il legame C=C è più corto del legame C-C: doppietti elettronici condivisi = nuclei più vicini

4 2) Dare il nome IUPAC ai seguenti composti n. Atomi di C: propan Gruppi funzionali : olo 2-propanolo Cis 2-butene Trans 2-butene

5 3) Ciclizzare la molecola del fruttosio partendo dalla sua forma lineare. a) Che tipo di reazione è? b) Che gruppi funzionali sono coinvolti?

6 CICLIZZAZIONE DEL FRUTTOSIO: Il fruttosio forma un anello facendo reagire il gruppo aldeidico con un ossidrile nella catena β

7 I COMUNI MONOSACCARIDI HANNO STRUTTURE CICLICHE *

8 4) Disegnare in forma ciclica: a) un dimero del glucosio con un legame β (1 4) (entrambe le molecole di glucosio nella configurazione β) b) un dimero del glucosio con legame α (1 6) a) Cellobiosio O-β-D-glucopiranosil (1 4) β-d-glucopiranosio b) Isomaltosio O-α-D-glucopiranosil (1 6) α-d-glucopiranosio

9 5) Disegnare una molecola del disaccaride Lattosio. Da quali monosaccaridi è costituito? Di che tipo di reazione si tratta? Che legame si forma tra le unità monosaccaridiche?

10 DISACCARIDI Due MONOSACCARIDI uniti da legame O-glicosidico

11 DISACCARIDI Due MONOSACCARIDI uniti da legame O-glicosidico Estremità riducente

12 6) Scrivere la proiezione di Fisher del D-ribosio e del suo enantiomero. Come si chiama?

13 n centri chiralici =2 n stereoisomeri H H Enantiomeri CHO CHO C C OH OH CH 2 OH HO C H HO C H CH 2 OH Enantiomeri CHO C HO H C OH H O C H H O C H H C OH CH 2 OH C H 2 OH D-Eritrosio L-Eritrosio L-Treosio D-Treosio Epimeri differiscono tra loro soltanto per la configurazione attorno ad un atomo di C chiralico

14 ATTENZIONE!!! NON SONO ENANTIOMERI Se Differiscono per la configurazione attorno ad un solo carbonio chirale sono anche detti EPIMERI

15 7)Quali sono le funzioni dei carboidrati in natura?

16 Carboidrati: funzioni Fornire energia chimica Sostegno (parete cellulare vegetale) Protezione (parete batterica) Lubrificanti delle giunture scheletriche Adesione tra cellule "Riconoscimento" cellulare

17 8) Data la seguente sequenza per uno dei filamenti di un oligonucleotide a doppia elica: 5 ACCGTAAGGCTTTAG 3 scrivete la sequenza del filamento del DNA complementare

18 Nel DNA I contenuti di adenina sono sempre uguali a quelli di timina I contenuti di citosina sono sempre uguali a quelli di guanina Regola di Chargaff

19 Questa osservazione ha condotto ad una conclusione: Il DNA e costituito da due filamenti Ogni base di un filamento e legata con una base dell altro filamento (base complementare) mediante legami idrogeno L adenina si lega sempre alla timina, la guanina si lega sempre alla citosina Tra le coppie A-T si possono formare due legami idrogeno Tra le coppie C-G si possono formare tre legami idrogeno

20 Disposizione dei legami Idrogeno nelle coppie di basi

21 8) Data la seguente sequenza per uno dei filamenti di un oligonucleotide a doppia elica: 5 ACCGTAAGGCTTTAG 3 scrivete la sequenza del filamento del DNA complementare 5 ACCGTAAGGCTTTAG 3 3 TGGCATTCCGAAATC 5

22 9) I due filamenti complementari del DNA a doppia elica: (Rispondete V o F) a) sono tenuti insieme da interazioni idrofobiche. b) sono tenuti insieme da legami a idrogeno. c) contengono una quantità uguale di ciascuna delle quattro basi azotate in ciascun filamento. d) L adenina e la timina di eliche complementari sono tenute insieme da tre legami idrogeno.

23 10) Scrivete la struttura di una porzione di amido che consenta di evidenziare le parti funzionali, indicando quali tipi di legami sono coinvolti. Quali sono le differenze strutturali con la cellulosa?

24 POLISACCARIDI OMOPOLISACCARIDI ETEROPOLISACCARIDI 1 solo tipo di unità monomerica 2 o più tipi di unità monomeriche

25 Omopolisaccaridi di riserva: Amido polimeri di α-glucosio amilosio: catena lineare amilopectina: catena ramificata (ramificazioni ogni 24/30 residui)

26 Omopolisaccaridi con funzione strutturale: CELLULOSA polimeri di β-glucosio Legami β1 4 Non presenta ramificazioni

27 11) Disegnare la struttura di un tripeptide a scelta, indicando: a) I residui aminoacidici costituenti b) I piani ammidici c) Descrivere le caratteristiche del legame peptidico.

28 Il legame Peptidico Reazione di condensazione

29 Il legame Peptidico Dipolo Più corto di un legame singolo Ha parziale carattere di doppio legame È rigido, non permette deformazioni e rotazioni attorno al legame C-N

30 Piano ammidico ψ φ nel legame peptidico gli atomi di O, C, N e H sono rigidamente sullo stesso piano il legame C-C α ed legame N-C α sono legami singoli perciò è possibile la libera rotazione

31 Ciascun carbonio α appartiene contemporaneamente a due piani peptidici, i quali formano un angolo diedro Il legame peptidico è quasi sempre di tipo trans in quanto l impedimento sterico tra gruppi R di aminoacidi contigui rende poco stabile la configurazione cis rispetto a quella trans

32 12) Indicare se le seguenti affermazioni riguardanti l istidina sono vere o false. a) Contiene un secondo gruppo amminico primario b) si classifica come amminoacido acido c) contiene un anello imidazolico d) contiene un gruppo carbossilico nella catena laterale e) è implicato nella formazione di ponti disolfuro

33 13) Quale è il nome della molecola qui rappresentata? A quale classe di biomolecole appartiene? Elenca tutte le molecole che conosci che contengono la struttura qui rappresentata

34 Nucleotidi: Basi azotate

35 Legame N-β-glicosidico

36 Adenosina MonoFosfato AMP Legame FOSFOESTERE mostra le proprietà dei normali esteri fosforici, relativamente resistenti all idrolisi Adenosina DiFosfato ADP ADP e ATP hanno gruppi fosforilici addizionali uniti per mezzo di legami a ponte di ossigeno P O P, che hanno le caratteristiche dei legami fosfoanidridici. Legami FOSFOANIDRIDICI Adenosina TriFosfato ATP Tali legami possiedono una energia Libera di idrolisi molto elevata, e vengono definiti legami ricchi di energia. La scissione di tali legami rende quindi disponibile molta energia, utilizzabile per rendere possibili reazioni endoergoniche.

37

38 14) Quali delle seguenti affermazioni sulla struttura terziaria delle proteine è vera a) la struttura terziaria è stabilizzata esclusivamente da legami covalenti b) è stabilizzata da un grande numero di legami idrogeno c) è data dalla regolare ripetizione di motivi strutturali d) Non sono mai presenti interazioni di tipo idrofobico

39 Struttura terziaria delle proteine

40 Struttura terziaria delle proteine

41 Struttura terziaria delle proteine

42 Struttura terziaria delle proteine Residui Polari Residui Apolari Gli amminoacidi apolari tendono a sfuggire il contatto con l acqua e guidano interi segmenti della proteina ad occupare zone più interne della macromolecola ripiegata Gli amminoacidi polari si trovano più frequentemente sulla superficie della proteina stessa, a contatto con le molecole d acqua

43 15) Descrivere sinteticamente le caratteristiche strutturali delle -eliche, dei filamenti e dei ripiegamenti ( -turn), indicando anche in che modo sono stabilizzate le diverse strutture

44 Struttura secondaria delle proteine Tipica disposizione spaziale dei residui amminoacidici che sono adiacenti nella struttura primaria. Ripiegamento della catena polipeptica la cui catena principale si dispone nello spazio tridimensionale formando una struttura ripetitiva. Conformazione: organizzazione spaziale degli atomi di una proteina. α-elica, β-foglietto

45 Struttura secondaria delle proteine 1) INTERAZIONI IDROFOBICHE: Le catene laterali degli amminoacidi idrofobici tendono a raggrupparsi all interno delle proteine 2) LEGAMI H Massimo numero all interno della proteina

46 Struttura secondaria delle proteine: α elica N C C=O α - eliche delle proteine: destrorsa ogni giro di elica 3,6 residui di amminoacidi passo = 3,6 residui

47 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno il gruppo C=O di un amminoacido forma un legame H con il gruppo N-H dell amminoacido che si trova 4 residui più avanti nella stessa catena

48 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno L atomo di ossigeno del legame peptidico di ogni aminoacido forma legame idrogeno con l idrogeno del legame peptidico del quarto aminoacido successivo

49 PROLINA & GLICINA: residui incompatibili con la struttura dell α-elica Dove c è una prolina c è un ripiegamento

50 Struttura secondaria delle proteine: Stabilizzato tramite legami idrogeno Foglietto β tra segmenti adiacenti della catena polipeptidica

51 Struttura secondaria delle proteine: Foglietto β

52 Ripiegamenti β Collegano le estremità di due segmenti adiacenti con strutture ad α elica oppure a foglietto β

Carboidrati. Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati

Carboidrati. Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati Carboidrati Principale ciclo energetico della biosfera si basa sul metabolismo dei carboidrati Carboidrati: funzioni Fornire energia chimica Sostegno (parete cellulare vegetale) Protezione (parete batterica)

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 10 Le basi della biochimica 3 Sommario 1. Le molecole biologiche si dividono in quattro classi 2. I carboidrati sono il «carburante»

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

H N H R N H R N R R N R H H H

H N H R N H R N R R N R H H H AMMINE Sono derivati dell ammoniaca (NH 3 ) nei quali uno o più atomi di idrogeno sono sostituiti da altrettanti radicali alchilici (R-, come ad esempio il gruppo -CH 3 ). Come l ammoniaca anche le ammine

Dettagli

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica

CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica CARBOIDRATI Sono aldeidi o chetoni con diversi gruppi ossidrilici (formula molecolare di base (CH2O)n, con n =>3) Funzioni riserva energetica combustibili intermedi metabolici Impalcatura del DNA e RNA

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

Immagini e concetti della biologia

Immagini e concetti della biologia Sylvia S. Mader Immagini e concetti della biologia 2 A3 Le molecole biologiche 3 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

I composti più importanti dal punto di vista biologico, detti anche. BIOMOLECOLE, appartengono a quattro classi: carboidrati, proteine,

I composti più importanti dal punto di vista biologico, detti anche. BIOMOLECOLE, appartengono a quattro classi: carboidrati, proteine, I composti più importanti dal punto di vista biologico, detti anche BIMLELE, appartengono a quattro classi: carboidrati, proteine, acidi nucleici e lipidi. arboidrati: polimeri di monosaccaridi Proteine:

Dettagli

Acidi Nucleici: DNA = acido deossiribonucleico

Acidi Nucleici: DNA = acido deossiribonucleico Acidi Nucleici: DNA = acido deossiribonucleico depositario dell informazione genetica RNA: acido ribonucleico trascrizione e traduzione dell informazione genetica dogma centrale della biologia molecolare

Dettagli

Irrancidimento (ossidazione) degli acidi grassi insaturi

Irrancidimento (ossidazione) degli acidi grassi insaturi Irrancidimento (ossidazione) degli acidi grassi insaturi Aldeidi STPA-Chimica rganica Alcuni saggi sui grassi numero di acidità (titolazione in presenza di fenolftaleina con base forte diluita a temperatura

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA

Nucleotidi e Acidi Nucleici. Struttura di DNA e RNA Nucleotidi e Acidi Nucleici Nucleosidi Nucleotidi Funzioni biologiche dei nucleotidi Struttura di DNA e RNA Concatenazione e appaiamento dei nucleotidi Lo scheletro degli acidi nucleici Componenti degli

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

CARBOIDRATI SEMPLICI

CARBOIDRATI SEMPLICI CARBOIDRATI Dal greco glucos =dolce Glucidi Zuccheri Sostanze formate acqua e carbonio Hanno forma molecolare (CH₂O)n 1 CARBOIDRATI SEMPLICI Monosaccaridi, una sola unità di poliidrossi aldeide o di poliidrossi

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

BIOMOLECOLE. I mattoni delle cellule.

BIOMOLECOLE. I mattoni delle cellule. BIMLECLE I mattoni delle cellule PRINCIPALI GRUPPI FUNZINALI I gruppi funzionali sono gruppi di atomi, uniti da legami covalenti, che conferiscono alla molecola di cui fanno parte un comportamento chimico

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

LA CHIMICA DELLA VITA

LA CHIMICA DELLA VITA LA CHIMICA DELLA VITA L elemento presente in tutte le molecole caratteristiche degli esseri viventi è IL CARBONIO Il carbonio ha numero atomico 6 (Z=6). Ha valenza 4: ai suoi atomi mancano 4 elettroni

Dettagli

Di cosa è fatta una cellula?

Di cosa è fatta una cellula? Di cosa è fatta una cellula? Composizione delle cellule - L acqua (H 2 O) rappresenta il 70% del massa della cellula - C,H,N,O,P,S rappresentano il 99% della massa della cellula - Altri elementi più rari

Dettagli

Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone

Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone Carboidrati Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone Glucosio Carboidrati modificati: membrane cellulari, acidi nucleici, Da carbonio idrato: glucosio= C 6 H 12

Dettagli

Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone

Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone Carboidrati Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone Glucosio Carboidrati modificati: membrane cellulari, acidi nucleici, Da carbonio idrato: glucosio= C 6 H 12

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

ACIDI GRASSI INSATURI

ACIDI GRASSI INSATURI LIPIDI ACIDI GRASSI SATURI ACIDI GRASSI INSATURI TRIGLICERIDI TRIGLICERIDI Grassi neutri o lipidi semplici glicerolo + 1 acido grasso monogliceride glicerolo + 2 acidi grassi digliceride glicerolo + 3

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Capitolo 15 O C H CH 2 OH. Risposte a Domande ed esercizi di fine capitolo. Tipi di carboidrati

Capitolo 15 O C H CH 2 OH. Risposte a Domande ed esercizi di fine capitolo. Tipi di carboidrati apitolo 15 Risposte a Domande ed esercizi di fine capitolo Tipi di carboidrati 15.1 Un monosaccaride è lo zucchero più semplice e consiste di una singola unità saccaridica. Un disaccaride è formato da

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Dal carbonio agli OGM Biochimica e biotecnologie SOLUZIONI DEGLI ESERCIZI Capitolo 0 Il mondo del carbonio 1. b, e 2. d 3. 7 4. 5. 6. 7. a) Isomeria di posizione; b) i due composti non sono isomeri; c)

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Il DNA conserva l informazione genetica

Il DNA conserva l informazione genetica Il DNA conserva l informazione genetica Gli esperimenti di Frederick Griffith (1928) Gli esperimenti di Oswald Avery (1944) + Estratti dal ceppo IIIS ucciso al calore di Polisaccaridi Lipidi Proteine Acidi

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

I composti organici. Il carbonio e i composti organici

I composti organici. Il carbonio e i composti organici I composti organici Il carbonio e i composti organici COSA SONO I COMPOSTI ORGANICI? I composti organici sono composti in cui uno o più atomi di carbonio (C) sono uniti tramite un legame covalente ad atomi

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

Disaccaridi: cellobiosio e maltosio

Disaccaridi: cellobiosio e maltosio Disaccaridi: cellobiosio e maltosio I disaccaridi contengono un legame glicosidico tra il carbonio anomerico di uno zucchero e un ossidrile qualunque di un secondo zucchero. Il legame può essere a o b.

Dettagli

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310.

Daniela Carotti. Dipartimento di Scienze Biochimiche III piano - stanza 310. Daniela Carotti Dipartimento di Scienze Biochimiche III piano - stanza 310 06 49910969 daniela.carotti@uniroma1.it organismo cellula componenti biochimiche acqua ioni carboidrati riserva di energia ruolo

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

Monosaccaridi essenziali

Monosaccaridi essenziali Monosaccaridi essenziali Questi monosaccaridi sono normalmente assunti con la dieta e sono utilizzati per la biosintesi di glicoproteine etc. Ad esempio dall acido N-acetil-D-neuramminico hanno origine

Dettagli

http://digilander.libero.it/glampis64 Idrogeno, ossigeno, carbonio e azoto costituiscono il 99% delle cellule. I composti del carbonio sono chiamati composti organici o molecole organiche. I composti organici

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Chimica e chimica della vita

Chimica e chimica della vita Chimica e chimica della vita Tocca, Oliver diceva, lanciandomi una barretta non c è niente al mondo come il tungsteno sinterizzato Batteva sulle barrette e queste emettevano un tintinnio profondo Il suono

Dettagli

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte.

Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. Indagine biologica: elevato livello di organizzazione delle strutture coinvolte. L organizzazione biologica si basa su una gerarchia di livelli strutturali Si parte dall atomo tessuti organi molecola organismo

Dettagli

hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche

hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche - Il termine carboidrato fu adottato perché molte formule corrispondevano a idrati del carbonio, C n (H 2 O)

Dettagli

Lezione 39 Chimica organica - stereoisomeria

Lezione 39 Chimica organica - stereoisomeria Lezione 39 Chimica organica - stereoisomeria 1. La stereoisomeria In un atomo di carbonio ibridato sp 3 i quattro orbitali ibridi, e quindi i quattro legami da essi formati sono orientati, come detto,

Dettagli

Vengono sintetizzati dalle piante durante la fotosintesi e quindi accumulati in forma di cellulosa o amido

Vengono sintetizzati dalle piante durante la fotosintesi e quindi accumulati in forma di cellulosa o amido Carboidrati Carboidrati puri : zucchero e amido nei cibi, cellulosa nel legno, carta e cotone Glucosio Carboidrati modificati: membrane cellulari, acidi nucleici, Da carbonio idrato: glucosio= C 6 H 12

Dettagli

F. Fogolari Milano, Marzo

F. Fogolari Milano, Marzo Biomolecole - 1 Federico Fogolari Dipartimento Scientifico e Tecnologico Universita di Verona Ca Vignal 1, Strada Le Grazie 15 37134 Verona, Italy tel. ++39-045-8027906 fax. ++39-045-8027929 email: fogolari@sci.univr.it

Dettagli

Organizzazione della materia

Organizzazione della materia Organizzazione della materia Elementi: sostanze che non possono essere scisse in altre più semplici mediante reazioni chimiche ordinarie. Atomo: è la porzione più piccola di un elemento, formato da 3 particelle

Dettagli

I carboidrati. (CH 2 O)n n>3. Mono-, oligo-, polisaccaridi. n = 3 triosi n = 4 tetrosi n = 5 pentosi n = 6 esosi

I carboidrati. (CH 2 O)n n>3. Mono-, oligo-, polisaccaridi. n = 3 triosi n = 4 tetrosi n = 5 pentosi n = 6 esosi I carboidrati (CH 2 O)n n>3 Mono-, oligo-, polisaccaridi n = 3 triosi n = 4 tetrosi n = 5 pentosi n = 6 esosi I monosaccaridi sono derivati aldeidici e chetonici di alcoli poliossidrilici a catena lineare,

Dettagli

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole I parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole I parte Lezioni d'autore di Giorgio Benedetti LE BIOMOLECOLE Le biomolecole, presenti in tutti gli esseri viventi, sono molecole composte principalmente da carbonio, idrogeno, azoto e ossigeno.

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Lezione 1 ELEMENTI, COMPOSTI E LEGAMI

Lezione 1 ELEMENTI, COMPOSTI E LEGAMI Lezione 1 ELEMENTI, COMPOSTI E LEGAMI 1 1.4 Le particolari proprietà dell acqua favoriscono la vita esplorando Nell acqua, l ossigeno acquista una parziale carica negativa, mentre gli atomi di idrogeno

Dettagli

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri).

Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Gli acidi nucleici sono eteropolimeri lineari costituiti da subunità nucleotidiche (monomeri). Un nucleotide è formato da: uno zucchero: (Ribosio o Deossiribosio), a 5 atomi di carbonio in forma ciclica

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) POLIMERI Le cellule sintetizzano un enorme numero di grosse molecole a partire da una ristretta serie di

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Chimica Organica. Studio dei composti del CARBONIO

Chimica Organica. Studio dei composti del CARBONIO Chimica Organica Studio dei composti del CARBONIO 1 Contengono C, H e possono contenere N, O, S Carbonio legato covalentemente ad un metallo Tutti gli elementi possibili Composti organici 2 Perché si formano

Dettagli

ACIDI NUCLEICI ESPERIMENTI

ACIDI NUCLEICI ESPERIMENTI ACIDI NUCLEICI ESPERIMENTI 1869 FRIEDRICK MIESCHER Isolò per la prima volta una sostanza zuccherina leggermente acida contenente fosforo Questa sostanza venne chiamata: acido nucleico perché scoperta nel

Dettagli

Cellula batterica. ioni, piccole molecole 4% Fosfolipidi 2% DNA 1% RNA 6%

Cellula batterica. ioni, piccole molecole 4% Fosfolipidi 2% DNA 1% RNA 6% Le macromolecole, assieme, costituiscono la maggior parte del contenuto secco degli organismi viventi Cellula batterica ioni, piccole molecole 4% Fosfolipidi 2% DNA 1% RNA 6% CLASSIFICAZIONE DEI CARBOIDRATI:

Dettagli

hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche

hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche hanno origine nelle piante da CO 2 e H 2 O attraverso la fotosintesi e altre vie metaboliche - Il termine carboidrato fu adottato perché molte formule corrispondevano a idrati del carbonio, C n (H 2 O)

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica Capitolo 1 I CARBIDRATI SLUZINI 1 La biochimica è la chimica degli organismi viventi; comprende lo studio delle molecole che svolgono un ruolo negli organismi viventi, la loro

Dettagli

24.1 La sostanze di importanza biologica sono per la maggior parte composti organici

24.1 La sostanze di importanza biologica sono per la maggior parte composti organici 24 BIOCHIMICA 24.1 La sostanze di importanza biologica sono per la maggior parte composti organici La biochimica è la disciplina che studia in modo sistematico le sostanze chimiche nei sistemi viventi,

Dettagli

Si dividono in monosaccaridi, disaccaridi, oligosaccaridi e polisaccaridi.

Si dividono in monosaccaridi, disaccaridi, oligosaccaridi e polisaccaridi. Glucidi, carboidrati o zuccheri I glucidi, detti anche carboidrati, zuccheri o saccàridi, sono sostanze ternarie (costituite da,, ), di fondamentale importanza biologica. Innanzitutto sono i soli composti

Dettagli

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica.

NUCLEOTIDI. Hanno la funzione di conservare, trasmettere e modulare l informazione genetica e di tradurla nella sintesi proteica. NUCLEOTIDI a) Forma di energia utilizzata nel metabolismo cellulare (ATP, GTP) b) Entrano a far parte della struttura di cofattori enzimatici (coenzimi) e intermedi metabolici c) Costituiscono gli ACIDI

Dettagli

Quali sono le proprietà chimiche che rendono uniche le caratteristiche dei carboidrati?

Quali sono le proprietà chimiche che rendono uniche le caratteristiche dei carboidrati? Quali sono le proprietà chimiche che rendono uniche le caratteristiche dei carboidrati? 1) L esistenza di uno o più centri di asimmetria 2) La possibilità di assumere sia strutture lineari che ad anello

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste

Dettagli

LA CHIMICA DEI GLUCIDI

LA CHIMICA DEI GLUCIDI 1.1 La classificazione chimica dei glucidi LA CHIMICA DEI GLUCIDI GLUCIDI (sono comunemente chiamati zuccheri) Si dividono in: SEMPLICI Sono chiamati MONOSACCARIDI Sono formati da una sola molecola di

Dettagli

Le biomolecole organiche

Le biomolecole organiche Le biomolecole organiche Le biomolecole organiche tendono ad unirsi tra loro a formare complessi detti macromolecole. Un particolare tipo di macromolecole sono i polimeri, ovvero sequenze di molte unità

Dettagli

pentosi ed esosi aldosi e chetosi monosaccaridi carboidrati di, tri, tetra saccaridi oligosaccaridi polisaccaridi amido glicogeno cellulosa

pentosi ed esosi aldosi e chetosi monosaccaridi carboidrati di, tri, tetra saccaridi oligosaccaridi polisaccaridi amido glicogeno cellulosa I carboidrati sono composti a base di C, e ; il nome deriva dal fatto che formalmente la formula è (C. 2 ) 6, da cui carboidrati = idrati di carbonio. Si tratta in tutti i casi di poliidrossialdeidi o

Dettagli

I carboidrati. energia,, sia come sostanze nutrienti che come intermedi metabolici.

I carboidrati. energia,, sia come sostanze nutrienti che come intermedi metabolici. I carboidrati I carboidrati sono importanti per conservare l energial energia,, sia come sostanze nutrienti che come intermedi metabolici. Il ribosio e il deossiribosio (due carboidrati semplici o monosaccaridi)

Dettagli

Capitolo 10 Carboidrati

Capitolo 10 Carboidrati Chimica Organica Scienze della Terra, dell Ambiente e del Territorio Capitolo 10 Carboidrati Organic Chemistry, 5 th Edition L. G. Wade, Jr. Prentice all Organic Chemistry, 3 rd Edition Paula Y. Bruice,

Dettagli