Amminoacidi Peptidi Proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Amminoacidi Peptidi Proteine"

Transcript

1 Amminoacidi Peptidi Proteine

2 Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L

3 IDROFOBOCI

4 IDROFOBOCI

5 IDROFILICI

6 Secondo gruppo amminico primario IDROFILICI Gruppo imidazolico Gruppo guanidinico Secondo Gruppo carbossilico

7 FORMAZIONE DEI PONTI DISOLFURO PONTE DISOLFURO

8 PROPRIETÀ ACIDO-BASE DEGLI AMMINOACIDI Ione dipolare zwitterione Sono molecole ANFOTERE Donatore di protoni Accettore di protoni

9 La carica degli aminoacidi dipende dal ph della soluzione dal proprio punto isoelettrico carica positiva al di sotto del pi carica negativa al di sopra del pi carica netta 0 al pi

10 Peptidi & Proteine Polimeri di Amminoacidi Amminoacidi Peptidi Catene di Amminoacidi proteine

11 Il legame Peptidico

12 Il legame Peptidico Dipolo Più corto di un legame singolo Ha parziale carattere di doppio legame È rigido, non permette deformazioni e rotazioni attorno al legame C-N

13 Ciascun carbonio α appartiene contemporaneamente a due piani peptidici, i quali formano un angolo diedro Il legame peptidico è quasi sempre di tipo trans in quanto l impedimento sterico tra gruppi R di aminoacidi contigui rende poco stabile la configurazione cis

14 peptide Oligopeptide: piccolo numero di Amminoacidi Polipeptide: elevato numero di Amminoacidi, Massa molecolare < Proteina: elevato numero di Amminoacidi, Massa molecolare >

15 Proteine Semplici Contengono solo amminoacidi Coniugate Contengono gruppi chimici addizzionali associati

16 Proteine: Livelli strutturali La sequenza amminoacidica determina il ripiegamento in una specifica struttura tridimensionale che a sua volta stabilisce la funzione della proteina

17 La SEQUENZA con cui si ripetono i residui amminoacidici definisce la STRUTTURA PRIMARIA Proteine con lo stesso numero di residui aminoacidici che differiscono nella struttura primaria svolgono funzioni diverse. Le proteine si distinguono per la COMPOSIZIONE e per la SEQUENZA dei residui amminoacidici

18 Struttura secondaria delle proteine Tipica disposizione spaziale dei residui amminoacidici che sono adiacenti nella struttura primaria. Ripiegamento della catena polipeptica la cui catena principale si dispone nello spazio tridimensionale formando una struttura ripetitiva. Conformazione: organizzazione spaziale degli atomi di una proteina. α-elica, β-foglietto

19 Struttura secondaria delle proteine Per conformazione si intende l organizzazione spaziale degli atomi di una proteina. Le Conformazioni che una proteina può assumere sono quelle termodinamicamente più stabili (minore ΔG) Le proteine che si trovano nella loro conformazione funzionale vengono dette native Possiamo quindi definire la stabilità di una proteina come la sua tendenza a mantenere la conformazione nativa

20 Struttura secondaria delle proteine 1) INTERAZIONI IDROFOBICHE: Le catene laterali degli amminoacidi idrofobici tendono a raggrupparsi all interno delle proteine 2) LEGAMI H Massimo numero all interno della proteina

21 Struttura secondaria delle proteine: α elica N C C=O α - eliche delle proteine: destrorsa ogni giro di elica 3,6 residui di amminoacidi passo = 3,6 residui

22 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno il gruppo C=O di un amminoacido forma un legame H con il gruppo N-H dell amminoacido che si trova 4 residui più avanti nella stessa catena

23 Struttura secondaria delle proteine: α elica stabilizzata da legami idrogeno L atomo di ossigeno del legame peptidico di ogni aminoacido forma legame idrogeno con l idrogeno del legame peptidico del quarto aminoacido successivo

24 PROLINA & GLICINA: residui incompatibili con la struttura dell α-elica Dove c è una prolina c è un ripiegamento

25 Struttura secondaria delle proteine: Stabilizzato tramite legami idrogeno Foglietto β tra segmenti adiacenti della catena polipeptidica

26 Struttura secondaria delle proteine: Foglietto β

27 Ripiegamenti β Collegano le estremità di due segmenti adiacenti con strutture ad α elica oppure a foglietto β

28 Struttura terziaria delle proteine Definisce la disposizione di tutti gli atomi di una proteina nello spazio tridimensionale

29 Struttura terziaria delle proteine

30 Legame a idrogeno Ponte disolfuro Struttura terziaria delle proteine C H 2 N O CH 2 CH 2 S S CH 2 CH 2 CH 2 CH 2 Legame ionico Interazioni idrofobiche H O CH 2 CH 2 CH 2 NH 3 COO CH2 CH2 + - CH CH 3 CH 3 CH 3 CH 3 CH Struttura terziaria: riguarda la disposizione nello spazio e l interazione di residui di amminoacidi distanti tra loro nella sequenza lineare

31 Struttura terziaria delle proteine

32 Struttura terziaria delle proteine le interazioni tra le catene laterali degli aminoacidi determinano il modo in cui una lunga catena polipeptidica si ripiega nella forma tridimensionale della proteina

33 Struttura terziaria delle proteine la struttura terziaria di una proteina può essere considerata come un insieme di segmenti peptidici con conformazioni ad α elica e a foglietto β uniti da tratti di connessione: Motivo Avvolgimento polipeptidico caratteristico formato da due o più elementi di struttura secondaria e dalle connessioni che le uniscono È ricorrente in proteine diverse

34 Struttura terziaria delle proteine Dominio: parte di una catena polipeptidica di per se stabile

35 Struttura terziaria delle proteine

36 Struttura terziaria delle proteine Residui Polari Residui Apolari Gli amminoacidi apolari tendono a sfuggire il contatto con l acqua e guidano interi segmenti della proteina ad occupare zone più interne della macromolecola ripiegata Gli amminoacidi polari si trovano più frequentemente sulla superficie della proteina stessa, a contatto con le molecole d acqua

37 Ripiegamento non corretto delle proteine

38 Struttura quaternaria delle proteine Complessi tridimensionali che derivano dall associazione di due o più catene polipeptidiche SUBUNITA

39 Considerando i diversi livelli di organizzazione strutturale possiamo classificare le proteine in base a struttura e solubilità Globulari Fibrose la maggior parte degli enzimi e delle proteine regolatrici determinano la resistenza, la forma e la protezione esterna delle cellule

40 Classificazione, Struttura & Funzione delle proteine Proteine fibrose: catene polipeptidiche disposte in lunghi fasci o foglietti. Normalmente è presente un solo elemento di struttura 2 a ripetuto più volte. Prevalente funzione strutturale. Insolubili in acqua. Proteine globulari: Segmenti di una catena o di catene polipeptidiche diverse si avvolgono l uno sull altro catene polipeptidiche ripiegate e forma sferica. Normalmente sono presenti più tipi di struttura 2 a. Prevalente funzione regolatoria ed enzimatica.

41 Gli Enzimi

42 catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche Gli Enzimi Sono le proteine più importanti e più specializzate Presentano un elevato grado di specificità per il substrato Operano in soluzioni acquose con temperature e ph blandi

43 Struttura generale degli enzimi Sono proteine globulari complesse : Addotto enzima-substrato Parte proteica Parte non-proteica Cofattore (ione metallico) Coenzima (natura organica: vitamina o altro) Gruppo Prostetico

44 SITO ATTIVO: specifica porzione dell enzima, deputata al legame con il substrato che porta alla formazione dell addotto ES Addotto ES

45 Proprietà dei Catalizzatori I catalizzatori sono sostanze capaci di abbassare l energia di attivazione rendendo piú facile la formazione dell addotto ES: la reazione diviene quindi piú veloce.

46

47 La K equilibrio è correlata alla variazione di energia libera ΔG = in condizioni standard: 25 C, 1M ΔG = - R T lnk eq Un ΔG negativo indica che la formazione dei prodotti è favorita termodinamicamente, ma non fornisce informazioni sulla velocità della reazione

48 E+S ES EP E+P viene resa più veloce sia la reazione diretta, sia la reazione inversa viene raggiunto più velocemente l equilibrio ΔG =energia di attivazione G prodotti -G substrati ( G ) < 0 Reazione esoergonica

49 E+S ES EP E+P Stato di transizione (ǂ) Stato di transizione (ǂ) Reazione ESOERGONICA Reazione ENDOERGONICA

50 A(S) B(P) I catalizzatori abbassano l energia di attivazione delle reazioni favoriscono lo stato di transizione formando l addotto ES G prodotti -G substrati ( G ) < 0 Reazione esoergonica

51

52 Molti catalizzatori non facilitano la formazione dello stato di transizione, ma sostituiscono la reazione difficile con 2 o più reazioni entrambe con uno stato di transizione facile da formare E+S ES EP E+P Risultato: accelerazione della reazione globale. ΔG =energia di attivazione

53

54 A(S) B(P)

55 ADDOTTO Enzima-Substrato L energia usata per aumentare la velocità enzimatica deriva dalle interazioni deboli (legami idrogeno, interazioni ioniche e idrofobiche) che si formano tra enzima e substrato ENERGIA di LEGAME

56 Gli enzimi sono caratterizzati da elevata specificità

57 CATALISI ENZIMATICA

58 CATALISI ENZIMATICA

59 CATALISI ENZIMATICA Adattamento indotto

60 Enzimi: Aumentano la velocità di una reazione ma NON ne modificano l equilibrio Consideriamo la generica equazione: a A + b B c C + d D Definiamo costante di equilibrio K eq K eq [ C] [ A] c a [ D] [ B] d b a temperatura costante! Le concentrazioni sono all equilibrio La velocità della reazione diretta è uguale alla velocità della reazione inversa

61 CINETICA ENZIMATICA velocità di una reazione (V): numero di molecole di substrato che si trasformano in prodotto nell unità di tempo. (V) si esprime come mmol/l di prodotto formatosi in un minuto (mm/min). Velocità iniziale V 0 Nelle analisi delle reazioni enzimatiche si utilizzano soltanto le velocità di reazione iniziali (v 0 ), quelle che si misurano non appena si mescolano l enzima ed il substrato. In tal modo la variazione di [S] può essere considerata trascurabile.

62 FATTORI CHE MODIFICANO LA VELOCITA DELLE REAZIONI ENZIMATICHE: 1) ph (curva a campana) 2) temperatura (curva bifasica a causa della denaturazione) 3) [S] (iperbole rettangolare a causa della saturazione) 4) inibitori CINETICA ENZIMATICA

63 CINETICA ENZIMATICA: ph Ciascun enzima ha un ph ottimale al quale la reazione è catalizzata con la massima efficienza. Esso in genere rispecchia il ph dell ambiente in cui l enzima svolge normalmente le sue funzioni. La concentrazione degli H + (ph) influenza l attività enzimatica modificando la geometria del sito attivo e la distribuzione delle cariche elettriche dei gruppi coinvolti nel legame del substrato o nel processo catalitico stesso. Valori di ph estremi possono anche provocare la denaturazione dell enzima.

64 CINETICA ENZIMATICA: ph

65 CINETICA ENZIMATICA: temperatura La velocità di reazione aumenta con l aumentare della temperatura fino a raggiungere un picco. Un ulteriore innalzamento della temperatura provoca una diminuzione della velocità di reazione a causa della denaturazione dell enzima.

66 CINETICA ENZIMATICA: temperatura

67 CINETICA ENZIMATICA: concentrazione del substrato La velocità di una reazione catalizzata da un enzima aumenta all aumentare della concentrazione del substrato fino a raggiungere una velocità massima (V max ). In questa condizione i siti attivi dell enzima sono saturi del substrato Quando tutto l enzima è saturato con il substrato: [ES] = [E tot ] V 0 = Vmax

68 CINETICA DELLO STATO STAZIONARIO

69 La curva che esprime la relazione tra V 0 e S ha un andamento iperbolico ed è espressa algebricamente dalla equazione di Michaelis-Menten Costante di Michaelis e Menten La Km è quella concentrazione di substrato a cui la V 0 è pari a metà della Vmax

70 L equazione di Michaelis-Menten descrive la variazione della velocità di reazione al variare della concentrazione del substrato. v 0 = velocità iniziale della reazione V max = velocità massima K m = costante di Michaelis-Menten [S] = concentrazione del substrato

71 Caratteristiche della K m La K m è pari alla concentrazione di substrato alla quale la velocità della reazione (V 0 ) è 1/2 della V max. La K m riflette l affinità dell enzima per il substrato: K m piccola = alta affinità dell enzima per il substrato K m grande = bassa affinità dell enzima per il substrato. Ogni enzima ha una K m caratteristica per un dato substrato. La K m non varia al variare della [E].

72 I PARAMETRI CINETICI POSSONO ESSERE USATI PER CONFRONTARE LE ATTIVITA DEGLI ENZIMI

73 Inibizione Enzimatica Inibitori ostacolano o impediscono il funzionamento degli enzimi Inibitore reversibile: Ha un azione temporanea, è possibile allontanare l inibitore dall enzima, consentendo il regolare esplicarsi dell attività catalitica. inibitore irreversibile: la ripresa dell attività enzimatica non è possibile, in quanto non è possibile in nessun modo allontanare l inibitore dall enzima

74 Inibizione Enzimatica Un Inibitore di tipo competitivo si lega al sito attivo dell enzima, precludendo il legame dell enzima stesso col substrato. Si forma un addotto enzima-inibitore, che non può evolvere verso il prodotto e che sottrae enzima alla reazione catalitica.

75 Inibizione Enzimatica un inibitore incompetitivo si lega ad un sito distinto da quello del substrato, legandosi al complesso ES

76 Inibizione Enzimatica un inibitore misto si lega ad un sito distinto da quello del substrato, ma si può legare sia all addotto ES sia al solo E

77 Inibizione Enzimatica

78 un enzima regolatore è quello che controlla le quantità di sostanze che devono essere trasformate in una via metabolica (catalizza la reazione più lenta, in genere la prima di una serie) tali enzimi non seguono la cinetica di Michaelis Menten e sono responsabili della modulazione della velocità con cui decorre l intero processo metabolico Enzimi regolatori ENZIMI ALLOSTERICI struttura quaternaria (due o più subunità proteiche) in essi esistono più siti chimicamente attivi Effettore o MODULATORE: molecola che interagendo con l enzima in siti lontani dal sito attivo, esercita un effetto positivo o negativo sulla sua attività

79 Modificazione allosterica Enzimi regolatori

80 Enzimi regolatori

81 Enzimi regolatori Inibizione retroattiva Gli enzimi allosterici possono essere inibiti dai prodotti terminali di una via metabolica

82 Enzimi regolatori Inibizione retroattiva

83 Enzimi regolatori modificazione covalente reversibile

84 Enzimi regolatori modificazione covalente reversibile

85 Enzimi regolatori Scissione proteolitica di un precursore (zimogeno inattivo) modificazione covalente irreversibile

86 Enzimi regolatori

87 Enzimi regolatori

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

CLASSIFICAZIONE O.T.I.L.Is. Lig

CLASSIFICAZIONE O.T.I.L.Is. Lig GLI ENZIMI CHE COSA SONO? Sono delle proteine altamente specializzate con attività catalitica, accelerano le reazioni chimiche rimanendo inalterati al termine della reazione stessa. CLASSIFICAZIONE O.T.I.L.Is.

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi)

Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi) ENZIMI Gli enzimi sono i catalizzatori dei processi biologici. Possono essere proteine globulari oppure acidi nucleici (ribozimi) Sono in grado di aumentare la velocità dei processi catalizzati fino a

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari (sono in grado di aumentare la velocità delle reazioni biologiche anche di 10 20 volte). Durante

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari, e lavorano in condizioni blande di temperatura e ph (sono in grado di aumentare la velocità delle

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Protidi. Protidi 16/01/2019

Protidi. Protidi 16/01/2019 Protidi I protidi sono macromolecole costituite dall unione di amminoacidi tra loro. I protidi, a seconda del numero di amminoacidi che li costituiscono, sono distinti in: oligopeptidi, formati da pochi

Dettagli

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA Enzimi semplici Enzimi coniugati - utilizzano esclusivamente le reattività chimiche di alcuni residui AA - richiedono la reattività chimica aggiuntiva di COFATTORI o COENZIMI gruppi prostetici COENZIMI

Dettagli

Regolazione enzimatica Isoenzimi

Regolazione enzimatica Isoenzimi Regolazione enzimatica Isoenzimi Gli enzimi regolatori nel metabolismo gruppi di enzimi lavorano insieme per produrre una via metabolica in cui il prodotto del primo enzima diventa il substrato del secondo

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

Fondamenti di Chimica Farmaceutica. Inibizione enzimatica

Fondamenti di Chimica Farmaceutica. Inibizione enzimatica Fondamenti di Chimica Farmaceutica Inibizione enzimatica Cinetica enzimatica E + S k 1 k 1 ES k2 E + P La reazione catalizzata dall enzima avviene in due passaggi: la formazione del complesso enzima-substrato:

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole

Introduzione alla biologia della cellula. Lezione 2 Le biomolecole Introduzione alla biologia della cellula Lezione 2 Le biomolecole Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono

Dettagli

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche Gli Enzimi Sono le proteine più importanti e più specializzate Presentano un elevato grado di specificità per

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Regolazione dell attività enzimatica. Allosteria Modificazioni covalenti Isoenzimi

Regolazione dell attività enzimatica. Allosteria Modificazioni covalenti Isoenzimi Regolazione dell attività enzimatica Allosteria Modificazioni covalenti Isoenzimi Regolazione della attività enzimatica L attività enzimatica deve potere essere regolata in base alle specifiche richieste

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Enzimi e loro ruolo nel metabolismo

Enzimi e loro ruolo nel metabolismo Enzimi e loro ruolo nel metabolismo Definizioni e ruoli degli enzimi Cinetica enzimatica Localizzazione degli enzimi Enzimi come bersaglio di farmaci Enzimi come markers in Biochimica Clinica Errori congeniti

Dettagli

COMPORTAMENTO ANFOTERO DEGLI AA

COMPORTAMENTO ANFOTERO DEGLI AA Proprietà acido-basiche degli aminoacidi FORMA NON IONICA Non esiste a nessun valore di ph FORMA ZWITTERIONICA È la forma prevalente a ph 7 COMPORTAMENTO ANFOTERO DEGLI AA CARICA NETTA +1 CARICA NETTA

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

ENZIMI. Un enzima è un catalizzatore (acceleratore) di reazioni biologiche.

ENZIMI. Un enzima è un catalizzatore (acceleratore) di reazioni biologiche. ENZIMI ENZIMI Un enzima è un catalizzatore (acceleratore) di reazioni biologiche. Catalizzatore = sostanza in grado di accelerare lo svolgimento di una reazione chimica e quindi di aumentarne la sua velocità,

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE)

REGOLAZIONE DELL ATTIVITA ENZIMATICA 1) MODULAZIONE ALLOSTERICA NON-COVALENTE (REVERSIBILE) REGOLAZIONE DELL ATTIVITA ENZIMATICA - Regolazione a lungo termine: la quantità di enzima può essere controllata regolando la velocità della sua sintesi o degradazione (minuti o ore) - Regolazione a breve

Dettagli

costruire un equazione che potesse descrivere in generale il comportamento cinetico degli enzimi e quindi di determinare parametri cinetici più

costruire un equazione che potesse descrivere in generale il comportamento cinetico degli enzimi e quindi di determinare parametri cinetici più Cinetica Enzimatica OBIETTIVO PRINCIPALE: costruire un equazione che potesse descrivere in generale il comportamento cinetico degli enzimi e quindi di determinare parametri cinetici più importanti (K M,

Dettagli

proteine enzimi RNA ribozimi substrati altamente specifici -asi

proteine enzimi RNA ribozimi substrati altamente specifici -asi I catalizzatori sono sostanze che aumentano la velocità delle reazioni senza subire modificazioni. Un catalizzatore non induce una reazione che non può avvenire, fa solo in modo che avvenga più velocemente.

Dettagli

Trattamento quantitativo della complessazione e della reattività nei sistemi supramolecolari

Trattamento quantitativo della complessazione e della reattività nei sistemi supramolecolari Trattamento quantitativo della complessazione e della reattività nei sistemi supramolecolari Assunzione di principio: i sistemi si trovano in condizioni di controllo termodinamico e non cinetico (tutti

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA 2 ESERCITAZIONE 1) Il collagene è una proteina (globulare / fibrosa). È formata da tre (catene alfa/alfa eliche) con andamento (destrorso/sinistrorso) che vanno

Dettagli

BIOLOGIA GENERALE 19 dicembre 2006

BIOLOGIA GENERALE 19 dicembre 2006 Biologia generale Massolo Alessandro massolo@unifi.it; Tel. 347-9403330 BIOLOGIA GENERALE 19 dicembre 2006 Facoltà di Psicologia Corso di Laurea in Scienze e Tecniche di Psicologia Generale e Sperimentale

Dettagli

Il meccanismo d azione degli enzimi può essere trattato: -analizzando i cambiamenti energetici che si verificano nel corso della reazione -

Il meccanismo d azione degli enzimi può essere trattato: -analizzando i cambiamenti energetici che si verificano nel corso della reazione - Il meccanismo d azione degli enzimi può essere trattato: -analizzando i cambiamenti energetici che si verificano nel corso della reazione - esaminando il modo in cui il sito attivo favorisce la catalisi

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

2. Quale delle seguenti affermazioni relative ad una reazione enzimatica è vera?

2. Quale delle seguenti affermazioni relative ad una reazione enzimatica è vera? 1. Gli enzimi agendo come catalizzatori: a) innalzano l'energia di attivazione b) innalzano il livello energetico dei prodotti c) abbassano il livello energetico dei reagenti d) diminuiscono l'energia

Dettagli

BIOCHIMICA APPLICATA e CLINICA

BIOCHIMICA APPLICATA e CLINICA BIOCHIMICA APPLICATA e CLINICA Regolazione Enzimatica Biosegnalazione Regolazione Ormonale Specializzazioni metaboliche (Biochimica d Organo) Integrazione del metabolismo BIOCHIMICA APPLICATA e CLINICA

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COOH che un gruppo amminico -NH2. Le proteine, a

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

GLI ENZIMI: proteine con attività CATALITICA

GLI ENZIMI: proteine con attività CATALITICA Cap. 6 GLI ENZIMI: proteine con attività CATALITICA Catalizzatori biologici: permettono alle reazioni biochimiche di avvenire a temperature e pressioni fisiologiche e a velocità misurabile. Aumentano la

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

Il legame peptidico è un ibrido di risonanza: scaricato da

Il legame peptidico è un ibrido di risonanza: scaricato da Il legame peptidico è un ibrido di risonanza: - O ha una parziale carica negativa - - la coppia di e - del legame C=O è parzialmente spostata verso O - N ha una parziale carica positiva + - la coppia di

Dettagli

Biologia. Lezione 09/11/2010

Biologia. Lezione 09/11/2010 Biologia Lezione 09/11/2010 Tutte le molecole contenute nelle cellule sono costituite da composti del carbonio Zuccheri Lipidi Proteine Acidi nucleici Polimeri Sono macromolecole formate da unità (MONOMERI)

Dettagli

TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30)

TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30) TEORIA DELLO STATO DI TRANSIZIONE (Henry Eyring anni 30) A + B-C A-B + C (A B C) Complesso attivato Stato di transizione Coordinata di reazione H A H B + H C H A + H B H C A+ K B X k' P + Q [ P] d dt =

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

La struttura terziaria delle proteine

La struttura terziaria delle proteine La struttura terziaria delle proteine 1 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata

Dettagli

v = Δ[P] = _ Δ[S] S P

v = Δ[P] = _ Δ[S] S P CINETICA ENZIMATICA Gli esperimenti di cinetica enzimatica si basano sulla determinazione della velocità di reazione, misurata come variazione della concentrazione del prodotto o del reagente in un dato

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

1. Ossidoreduttasi 2. Transferasi 3. Idrolasi 4. Liasi 5. Isomerasi 6. Ligasi

1. Ossidoreduttasi 2. Transferasi 3. Idrolasi 4. Liasi 5. Isomerasi 6. Ligasi 1. Ossidoreduttasi 2. Transferasi 3. Idrolasi 4. Liasi 5. Isomerasi 6. Ligasi ATP + glucosio glucochinasi ADP + glucosio-6-p E.C 2.7.1.2 glucochinasi E.C 2.7.1.1 esochinasi Energia libera,g S k 1 k 1 =

Dettagli

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

La struttura delle proteine e e descritta da quattro livelli di organizzazione

La struttura delle proteine e e descritta da quattro livelli di organizzazione La struttura delle proteine e e descritta da quattro livelli di organizzazione Struttura Primaria- - la sequenza di aminoacidi Struttura Secondaria - strutture locali stabilizzate da legami H che coinvolgono

Dettagli

Scaricato da 1

Scaricato da   1 A AB B Scaricato da www.sunhope.it 1 1 1 1 2 2 2 3 45 5 5 4 20 20 5 40 40 6 40 20 23 7 5 12 8 35 2 6 9 1 1 Numero di mole ecole 30 25 20 15 10 5 0 0 2 4 6 8 10 Energia Scaricato da www.sunhope.it 2 Scaricato

Dettagli

Le molecole biologiche. Le proteine

Le molecole biologiche. Le proteine Le molecole biologiche Le proteine Le proteine sono macromolecole che costituiscono la maggior parte delle strutture cellulari ed extra-cellulari Così come nel caso di lipidi e carboidrati, anch esse

Dettagli

Gli amminoacidi ( 20) hanno proprietà strutturali comuni

Gli amminoacidi ( 20) hanno proprietà strutturali comuni Quando nel XIX secolo gli scienziati rivolsero per la prima volta la loro attenzione alla nutrizione, in breve tempo scoprirono che i prodotti naturali contenenti azoto erano essenziali per la nutrizione

Dettagli

Le proteine o protidi

Le proteine o protidi Le proteine o protidi A differenza di glucidi e lipidi (che di regola non contengono azoto), le proteine sono composti organici quaternari, che possiedono sempre atomi di azoto nella loro molecola (quasi

Dettagli

Principi di Biochimica

Principi di Biochimica Principi di Biochimica Augusto Innocenti Biologo Nutrizionista Perfezionamento in Biochimica e Biologia Molecolare Phd in Neurobiologia e Neurofisiologia Materia: Atomi e Molecole La materie è costituita

Dettagli

Mioglobina Emoglobina

Mioglobina Emoglobina Mioglobina Emoglobina RESPIRAZIONE : assunzione di O 2 dall ambiente e rilascio di CO 2 La RESPIRAZIONE CELLULARE è un processo redox attraverso il quale vengono trasferiti atomi di idrogeno da un composto

Dettagli

Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi.

Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. ENZIMI Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. Svolgono il loro ruolo con modalità differenti

Dettagli

CINETICA ENZIMATICA - velocità di reazione

CINETICA ENZIMATICA - velocità di reazione [P] Velocità iniziale (V 0 ) CINETICA ENZIMATICA - velocità di reazione + + k 1 E + S ES ES E + P k 2 k 3 k 4 V = d[p]/dt = k 3 [ES] Velocità iniziale (V 0 ) quando [S] >> [P] V max t CINETICA ENZIMATICA:

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche Gli Enzimi Sono le proteine più importanti e più specializzate Presentano un elevato grado di specificità per

Dettagli

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO

CARBOIDRATI C H O ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO CARBOIDRATI ZUCCHERO SACCARIDE GLUCIDE CARBOIDRATO C H O carboidrati C n H 2n O n H C O C O Il glucosio è un monosaccaride con 6 atomi di carbonio GLUCOSIO Forma ciclica Forma lineare a ph 7 circa lo 0,0026%

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Enzimi come catalizzatori biologici

Enzimi come catalizzatori biologici Enzimi come catalizzatori biologici Gli enzimi sono molecole proteiche aventi il compito di catalizzare praticamente tutte le reazioni chimiche che avvengono negli organismi viventi. La catalisi procede

Dettagli