IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici."

Transcript

1 IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina la formazione del gruppo eme. L atomo di ferro forma 6 legami di coordinazione: 4 (nel piano dell anello) con gli atomi di azoto che fanno parte dell anello porfirinico 1 (perpendicolare al piano dell anello) con un residuo di istidina (His prossimale) 1 è il sito di legame per l ossigeno

2 Gli atomi di azoto coordinati (elettron donatori) impediscono la conversione del ferro nello stato ferrico (Fe 3+) non in grado di legare l ossigeno. Il legame del Fe 2+ con l ossigeno è reversibile.

3 STRUTTURA DELLA MIOGLOBINA Singolo peptide di 153 amminoacidi contenente una molecola di eme. La catena polipeptidica è ripiegata in 8 segmenti ad a elica (A H) collegati da ripiegamenti. La mioglobina conserva l ossigeno per i momenti in cui la domanda energetica diventa elevata.

4 CURVA IPOTETICA DEL LEGAME DI UN LIGANDO K ass = [PL]/ [P][L] K ass [L] = [PL]/[P] P + L PL θ = siti di legame occupati = [PL]/[PL]+[P] totale dei siti di legame θ = K ass [L][P]/K ass [L][P]+[P] = K ass [L]/ K ass [L]+1 = [L]/[L]+1/ K ass Il valore di [L] a cui metà dei siti di legame sono occupati dal ligando (θ = 0,5) corrisponde a 1/ K ass. Si definisce costante di dissociazione K d il valore 1/ K ass. K d è la costante di equilibrio della reazione di rilascio del ligando K d =[P][L]/[PL] [PL]= [P][L]/ K d θ= [L]/[L] + K d Nel caso della mioglobina [L] corrisponde alla concentrazione di ossigeno disciolta nel mezzo: θ= [O 2 ]/[O 2 ] + K d K d corrisponde alla [O 2 ] a cui metà dei siti disponibili sono occupati e quindi è uguale a [O 2 ] 0,5 θ= [O 2 ]/[O 2 ] + [O 2 ] 0,5 La concentrazione di una sostanza volatile in soluzione è sempre proporzionale alla sua pressione parziale nella fase gassosa in equilibrio con la soluzione. Definendo la pressione parziale di ossigeno [O 2 ] 0,5 come P 50 otteremo: q= po 2 /po 2 +P 50

5 Curva di legame dell ossigeno alla mioglobina L ossigeno si lega alla mioglobina con una P 50 di soli 2,6 kpa

6 Le interazioni fra il gruppo eme e i ligandi sono influenzati dalla struttura proteica L ossigeno si lega all eme formando un angolo con il ferro; una conformazione che si adatta facilmente agli spazi interni della mioglobina. Il monossido di carbonio forma con il ferro un legame perpendicolare con il piano dell eme. La presenza della catena polipeptidica impedisce questo tipo di legame forzandolo in una posizione simile a quella del legame dell ossigeno diminuzione dell affinità.

7 La mioglobina e le subunità dell emoglobina hanno una struttura tridimensionale estremamente simile

8 La struttura quaternaria dell emoglobina è caratterizzata da interazioni molto forti fra le quattro subunità L interfaccia α 1 β 1 (e la sua controparte α 2 β 2 ) comprende circa 30 residui. Le interfacce α 1 β 2 e α 2 β 1 comprendono 19 residui. A livello delle interfacce predominano le interazioni idrofobiche, ma vi sono anche molti legami idrogeno e solo poche coppie ioniche (ponti salini). L emoglobina può esistere in due stati conformazionali: T (tense) e R (relaxed); lo stato T, meno affine per l ossigeno, è stabilizzato da un maggior numero di ponti salini (soprattutto fra le interfacce α 1 β 2 e α 2 β 1 ).

9 Porzioni della molecola di deossiemoglobina nello stato T, in cui si evidenziano alcune coppie ioniche

10 TRANSIZIONE T fi R La modificazione della conformazione proteica costringe l eme ad assumere una conformazione planare:

11 L emoglobina lega l ossigeno in modo cooperativo Il legame cooperativo è descritto da una curva con andamento sigmoide. L emoglobina è molto più sensibile della mioglobina a piccole variazioni della concentrazione di ossigeno. L emoglobina è estremamente efficiente nel legare l ossigeno nei polmoni (dove la po2 è alta) e nel rilasciarlo nei tessuti periferici (dove la po2 è bassa).

12 MODELLI GENERALI PER L INTERCONVERSIONE DI FORMA INATTIVE E DI FORME ATTIVE IN PROTEINE CON UN LEGAME COOPERATIVO (a) Modello concertato Tutte le subunità nella stesa molecola proteica sono sempre nella stessa conformazione, o tutte a bassa affinità (inattive) o tutte ad alta affinità (attive) (b) Modello sequenziale Ogni subunità può essere sia nella forma a bassa affinità o in quella ad alta affinità. Sono possibili molti intermedi conformazionali

13 Effetto del ph sul legame dell ossigeno all emoglobina Il ph del sangue nei polmoni è 7,6 e nei tessuti scende a 7,2. I prodotti finali della respirazione cellulare sono H + e CO 2 La CO 2 prodotta in seguito all ossidazione delle sostanze nutrienti, viene idratata e forma bicarbonato grazie all azione dell anidrasi carbonica: CO 2 + H 2 O H + + HCO 3 - L affinità dell emoglobina per l ossigeno diminuisce man mano che si legano H + e CO 2

14 Gli ioni H + si legano a specifici residui amminoacidici. La protonazione favorisce la transizione allo stato T e il rilascio dell ossigeno L anidride carbonica si lega in forma di carbammato al gruppo α-amminico all estremità ammino-terminale di ciascuna catena globinica.; si forma carbamminoemoglobina. Questa reazione produce ioni H + e contribuisce a generare l effetto Bohr. I carbammati generano ponti salini che stabilizzano ulteriormente lo stato T.

15 IL LEGAME DELL OSSIGENO ALL EMOGLOBINA E REGOLATO DAL 2,3-BISFOSFOGLICERATO

16 Legame del BPG alla deossiemoglobina

17 Emoglobina normale ed emoglobina delle cellule falciformi

Le proteine che legano l ossigenol

Le proteine che legano l ossigenol Le proteine che legano l ossigenol Protoporfirina IX EME (Fe-protoporfirina IX) L atomo di ferro del gruppo eme può formare sei legami Struttura della mioglobina di capodoglio (J. Kendrew, anni 50)

Dettagli

Regolano il metabolismo, sia come enzimi, sia come ormoni (insulina, glucagone, ecc.)

Regolano il metabolismo, sia come enzimi, sia come ormoni (insulina, glucagone, ecc.) Grazie alla elevata dinamicità delle strutture proteiche (gli atomi sono in continuo movimento fluttuante) e per la capacità che hanno di legarsi in modo selettivo ad altre molecole, le proteine svolgono

Dettagli

FUNZIONI delle PROTEINE

FUNZIONI delle PROTEINE FUNZIONI delle PROTEINE Ha le dimensioni del reciproco di una concentrazione (M -1 ) Ha le dimensioni di una concentrazione (M) La frazione dei siti occupati rispetto ai siti totali è definita come θ FRAZIONE

Dettagli

Modulo 4. Una proteina in azione

Modulo 4. Una proteina in azione Modulo 4 Una proteina in azione Mioglobina ed emoglobina: un esempio di funzionamento di una proteina La funzione della maggior parte della proteine globulari è mediata dall interazione reversibile con

Dettagli

La struttura di una proteina e ruolo biologico da essa svolto sono strettamente connessi. Alcune funzioni biologiche delle proteine:

La struttura di una proteina e ruolo biologico da essa svolto sono strettamente connessi. Alcune funzioni biologiche delle proteine: La struttura di una proteina e ruolo biologico da essa svolto sono strettamente connessi. Alcune funzioni biologiche delle proteine: Catalizzatori = Enzimi Accumulo e trasporto di ossigeno = mioglobina

Dettagli

Le proteine che legano ossigeno:

Le proteine che legano ossigeno: Le proteine che legano ossigeno: . I cristalli si ottengono per precipitazione lenta della molecola da una soluzione, in condizioni che non dovrebbero alterare la sua struttura Un cristallo proteico È

Dettagli

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro.

Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Cos è n? po n 2 Y= n n p50 + po 2 Coefficiente di Hill ( n o n H ) = quanto i siti di legame per l O 2 sono cooperativi tra di loro. Per l Hb non è mai uguale al numero dei siti per l O 2, Le diverse emoproteine

Dettagli

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE Principi basilari: 1.Le funzioni di molte proteine richiedono il legame reversibile con altre molecole (LIGANDO) Un ligando può essere di natura diversa,

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina Per molti organismi, l O 2 è una molecola di importanza vitale: l'ossigeno è infatti l'accettore finale degli elettroni, che "fluendo" attraverso i complessi della catena respiratoria,

Dettagli

Mioglobina Emoglobina

Mioglobina Emoglobina Mioglobina Emoglobina Eventi successivi i alla comparsa dell O 2 Possibilità di ottenere circa 20 volte più energia dalla combustione del glucosio Sviluppo di un sistema circolatorio per la distribuzione

Dettagli

Esempi di proteine: Mioglobina ed Emoglobina

Esempi di proteine: Mioglobina ed Emoglobina Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Esempi di proteine: Mioglobina ed Emoglobina Mioglobina: caratteristiche generali, funzione

Dettagli

STRUTTURA E FUNZIONE

STRUTTURA E FUNZIONE STRUTTURA E FUNZIONE O 2 non solubile in acqua Esistono due proteine che permettono il trasporto di O 2 nel corpo emoglobina (Hb) si trova nei globuli rossi Trasporta anche CO 2 and H + Mioglobina (Mb)

Dettagli

Mioglobina ed emoglobina

Mioglobina ed emoglobina Mioglobina ed emoglobina α β Muscolo Deposito di O 2 Alta affinità per O 2 β α Globulo rosso Trasporto di O 2 Bassa affinità per O 2 Cooperativa ed allosterica Animali Mb-knockout (2003) : funzionalità

Dettagli

Nel corso dell evoluzione, con il passaggio dalla. progressivamente differenziati due meccanismi. un sistema circolatorio adeguato;

Nel corso dell evoluzione, con il passaggio dalla. progressivamente differenziati due meccanismi. un sistema circolatorio adeguato; PROTEINE RESPIRATORIE EMOGLOBINA & MIOGLOBINA Nel corso dell evoluzione, con il passaggio dalla vita anaerobia alla vita aerobia si sono progressivamente differenziati due meccanismi che sono in grado

Dettagli

Esempi di proteine: Mioglobina ed Emoglobina

Esempi di proteine: Mioglobina ed Emoglobina Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica Organica e Biochimica Esempi di proteine: Mioglobina ed Emoglobina Francesca Anna Scaramuzzo, PhD Dipartimento di Scienze di Base

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA E-mail: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina Per poter parlare in modo comprensibile dell emoglobina (Hb), è utile occuparsi prima della mioglobina (Mb) che è molto simile all emoglobina ma è molto più semplice. Tra emoglobina

Dettagli

Prof. Maria Nicola GADALETA

Prof. Maria Nicola GADALETA Prof. Maria Nicola GADALETA E-mail: m.n.gadaleta@biologia.uniba.it Facoltà di Scienze Biotecnologiche Corso di Laurea in Biotecnologie Sanitarie e Farmaceutiche Biochimica e Biotecnologie Biochimiche DISPENSA

Dettagli

Emoglobina e mioglobina

Emoglobina e mioglobina Emoglobina e mioglobina L emoglobina e la mioglobina proteine centrali per l evoluzione La transizione dalla vita anaerobica a quella aerobica rappresenta un passo fondamentale dell'evoluzione perchè ha

Dettagli

LEZIONE 25: EMOGLOBINA L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO

LEZIONE 25: EMOGLOBINA L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO LEZIONE 25: EMOGLOBINA L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO Lezione 25_emoglobina 1 Concentrazione di O 2 nel plasma Il contenuto totale di O2 nel sangue è pari alla quantità disciolta più quella legata

Dettagli

θ = (siti occupati)/(siti disponibili totali) Al numeratore ritrovo solo la mioglobina che ha complessato l'ossigeno, solo l'ossigenata)

θ = (siti occupati)/(siti disponibili totali) Al numeratore ritrovo solo la mioglobina che ha complessato l'ossigeno, solo l'ossigenata) LEZIONE DEL 03/04/2017 Emoglobina - complesso del metallo di transizione (ferro protoporfirina IX) complesso metallorganico. Derivazione della curva di legame iperbolica dell'ossigeno della mioglobina

Dettagli

Le proteine III. Corso di Biochimica 1. Prof. Giuseppina Pitari

Le proteine III. Corso di Biochimica 1. Prof. Giuseppina Pitari Le proteine III Corso di Biochimica 1 Prof. Giuseppina Pitari Ossi-mioglobina legame idrogeno lato distale La mioglobina L eme quindi consiste di una struttura organica alla quale è legato un atomo di

Dettagli

Trasporto di O 2 nel sangue

Trasporto di O 2 nel sangue Trasporto di O 2 nel sangue Il 97% dell O 2 trasportato nel plasma è chimicamente legato all Hb nei globuli rossi, solo il 3% è fisicamente disciolto Trasporto O 2 nel plasma Trasporto O 2 legato ad Hb

Dettagli

Fisiologia della Respirazione

Fisiologia della Respirazione Fisiologia della Respirazione 8.Trasporto dei gas nel sangue FGE aa.2016-17 Obiettivi Necessità di un sistema di trasporto chimico ad alta capacità dell O 2 nel sangue: l emoglobina Curva di dissociazione

Dettagli

L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO

L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO L EMOGLOBINA ED IL TRASPORTO DI OSSIGENO Lezione 23 1 Concentrazione di O 2 nel plasma Il contenuto totale di O2 nel sangue è pari alla quantità disciolta più quella legata all emoglobina: L O 2 totale

Dettagli

EMOGLOBINA, MIOGLOBINA MIOGLOBINA ED EMOGLOBINA NEL TRASPORTO DELL OSSIGENO

EMOGLOBINA, MIOGLOBINA MIOGLOBINA ED EMOGLOBINA NEL TRASPORTO DELL OSSIGENO EMOGLOBINA, MIOGLOBINA MIOGLOBINA ED EMOGLOBINA NEL TRASPORTO DELL OSSIGENO Trasporto dell ossigeno In tutti gli animali superiori, il metabolismo è aerobico L energia che si può estrarre dal glucosio

Dettagli

Il metalloma Struttura e reattività di metalloproteine. Il trasporto dell O 2

Il metalloma Struttura e reattività di metalloproteine. Il trasporto dell O 2 Il metalloma Struttura e reattività di metalloproteine Il trasporto dell O 2 Il trasporto dell ossigeno Nel sangue la solubilità dell O 2 è molto maggiore che in H 2 O In H 2 O la solubilità è 6.59 cm

Dettagli

EMOGLOBINA (Hb) nei globuli rossi e

EMOGLOBINA (Hb) nei globuli rossi e Nel metabolismo aerobio l O 2 è l accettore finale nel mitocondrio degli elettroni liberati dai composti carboniosi Proteine leganti l O 2 sono EMOGLOBINA (Hb) nei globuli rossi e MIOGLOBINA nelle fibre

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

Fisiologia della Respirazione 8.Trasporto dei gas nel sangue. Carlo Capelli Fisiologia Facoltà di Scienze Motorie- Università di Verona

Fisiologia della Respirazione 8.Trasporto dei gas nel sangue. Carlo Capelli Fisiologia Facoltà di Scienze Motorie- Università di Verona Fisiologia della Respirazione 8.Trasporto dei gas nel sangue Carlo Capelli Fisiologia Facoltà di Scienze Motorie- Università di Verona Obiettivi Necessità di un sistema di trasporto chimico ad alta capacità

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

ACQUISIZIONE SPERIMENTALE DELLA CONOSCENZA NELLE SCIENZE DELLA NATURA.

ACQUISIZIONE SPERIMENTALE DELLA CONOSCENZA NELLE SCIENZE DELLA NATURA. CLM C IN MEDICINA E CHIRURGIA C.I. Metodologia medico-scientifica di base II (Scienze umane 2 Epistemologia) A.A. 2013-2014 I anno, 2 semestre ACQUISIZIONE SPERIMENTALE DELLA CONOSCENZA NELLE SCIENZE DELLA

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

degli eritrociti è una proteina di trasporto indispensabile per veicolare l ossigeno l l anidride carbonica tra i polmoni e i tessuti

degli eritrociti è una proteina di trasporto indispensabile per veicolare l ossigeno l l anidride carbonica tra i polmoni e i tessuti l emoglobina degli eritrociti è una proteina di trasporto indispensabile per veicolare l ossigeno l e l anidride carbonica tra i polmoni e i tessuti Mioglobina, proteina di deposito,, presente nelle fibrocellule

Dettagli

Ogni globina ha una tasca in cui lega un gruppo EME, quindi l Hb può legare e trasportare 4 molecole di O 2

Ogni globina ha una tasca in cui lega un gruppo EME, quindi l Hb può legare e trasportare 4 molecole di O 2 Emoglobina (Hb): tetramero (le globine si associano formando due copie di dimeri αβ (α 1 β 1 e α 2 β 2 ) che si associano a formare un tetramero attraverso interazioni idrofobiche, legami H e ponti salini

Dettagli

Trasporto dei gas. Pressioni Volumi

Trasporto dei gas. Pressioni Volumi Trasporto dei gas Pressioni Volumi Il 97% dell O 2 trasportato nel plasma si trova chimicamente legato all Hb nei globuli rossi, solo lo 3% è fisicamente disciolto Trasporto O 2 nel plasma Trasporto O

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. Prof. Augusto Parente. Lezione 7. DiSTABiF. Corso di Laurea in SCIENZE BIOLOGICHE

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. Prof. Augusto Parente. Lezione 7. DiSTABiF. Corso di Laurea in SCIENZE BIOLOGICHE Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in SCIENZE BIOLOGICHE Insegnamento di CHIMICA BIOLOGICA Prof. Augusto Parente Anno Accademico 2014-15 Lezione 7 Mioglobina Emoglobina po

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche

Gli Enzimi. catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche catalizzatori biologici rendono possibile da un punto di vista cinetico le reazioni chimiche Gli Enzimi Sono le proteine più importanti e più specializzate Presentano un elevato grado di specificità per

Dettagli

Foto funzioni apparato respiratorio

Foto funzioni apparato respiratorio RESPIRAZIONE ESTERNA Foto funzioni apparato respiratorio RESPIRAZIONE INTERNA GLI SCAMBI GASSOSI QUOZIENTE RESPIRATORIO = CO 2 PRODOTTA O 2 CONSUMATO A riposo: Epitelio alveolare 200 ml/min 250 ml/min

Dettagli

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA

PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA PROTEINE RESPIRATORIE DEI VERTEBRATI EMOGLOBINA E MIOGLOBINA Svolgono la loro funzione legando reversibilmente l OSSIGENO. Aumentano la solubilità dell ossigeno nel plasma, da 3ml/L a 220 ml/l. La mioglobina

Dettagli

Regolazione enzimatica Isoenzimi

Regolazione enzimatica Isoenzimi Regolazione enzimatica Isoenzimi Gli enzimi regolatori nel metabolismo gruppi di enzimi lavorano insieme per produrre una via metabolica in cui il prodotto del primo enzima diventa il substrato del secondo

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Dopo la ventilazione alveolare, il passaggio successivo del processo respiratorio consiste nella diffusione dell O2 dagli alveoli al sangue e della

Dopo la ventilazione alveolare, il passaggio successivo del processo respiratorio consiste nella diffusione dell O2 dagli alveoli al sangue e della Dopo la ventilazione alveolare, il passaggio successivo del processo respiratorio consiste nella diffusione dell O2 dagli alveoli al sangue e della CO2 in direzione opposta. R = quoziente respiratorio,

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

CLASSIFICAZIONE O.T.I.L.Is. Lig

CLASSIFICAZIONE O.T.I.L.Is. Lig GLI ENZIMI CHE COSA SONO? Sono delle proteine altamente specializzate con attività catalitica, accelerano le reazioni chimiche rimanendo inalterati al termine della reazione stessa. CLASSIFICAZIONE O.T.I.L.Is.

Dettagli

LA MIOGLOBINA e L EMOGLOBINA

LA MIOGLOBINA e L EMOGLOBINA UNITÀ VET. DIDATTICA DI PROPEDEUTICA BIOCHIMICA LA MIOGLOBINA e L EMOGLOBINA Roberto Giacominelli Stuffler LA MIOGLOBINA E L EMOGLOBINAL I vertebrati hanno selezionato due meccanismi principali per rifornire

Dettagli

Il trasporto dell ossigeno

Il trasporto dell ossigeno Prof. Giorgio Sartor Il trasporto dell ossigeno Copyright 2001-2016 by Giorgio Sartor. All rights reserved. Versione 1.9.2 mar 2016 Trasporto dell ossigeno egli organismi aerobi il trasporto dell ossigeno

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Gli amminoacidi nelle molecole proteiche sono tutti stereoisomeri L IDROFOBOCI IDROFOBOCI IDROFILICI Secondo gruppo

Dettagli

LEZIONE DEL 27/03/2017

LEZIONE DEL 27/03/2017 LEZIONE DEL 27/03/2017 Struttura primaria sequenze amminoacidiche --> ponti disolfuro; Strutture secondarie (stabilizzate dai legami idrogeno intercatena): dipendono dal legame peptidico; Strutture terziarie

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 10

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 10 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 10 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

Amminoacidi/peptidi/proteine. Chimica Organica II

Amminoacidi/peptidi/proteine. Chimica Organica II Amminoacidi/peptidi/proteine Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II Amminoacidi Chimica Organica II II Amminoacidi: chiralità

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Trasporto O 2 nel sangue

Trasporto O 2 nel sangue Trasporto O 2 nel sangue 97% legato all Hb nei globuli rossi 3% fisicamente disciolto (determina il valore di po 2 ) Trasporto O 2 nel plasma Trasporto O 2 legato ad Hb Saturazione Hb 97% 0.3 ml/100ml

Dettagli

EMOGLOBINA ... www.pianetachimica.it

EMOGLOBINA ... www.pianetachimica.it EMGLBIA www.pianetachimica.it L'emoglobina è una proteina specializzata nel trasporto di ossigeno, si trova all interno dei globuli rossi del sangue ai quali conferisce il caratteristico colore rosso intenso.

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli

2) La presenza di gruppi funzionali specifici che partecipano alla catalisi (quelli delle catene laterali dei suoi residui amminoacidici e/o quelli ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari (sono in grado di aumentare la velocità delle reazioni biologiche anche di 10 20 volte). Durante

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Riabilitativa 2015/2016

Riabilitativa 2015/2016 Emoglobina e collageno Spina Riabilitativa 2015/2016 WWW.SUNHOPE.IT Alla grande varietà di strutture tridimensionali corrisponde una grande varietà di funzioni Ogni proteina presenta diversi livelli di

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Trasporto dell ossigeno

Trasporto dell ossigeno Prof. Giorgio Sartor Trasporto dell ossigeno Copyright 2001-2011 by Giorgio Sartor. All rights reserved. Versione 0.1 oct 2011 Trasporto dell ossigeno egli organismi aerobi il trasporto dell ossigeno avviene

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

COMPOSIZIONE DELL ARIA ATMOSFERICA SECCA E PRESSIONI PARZIALI DEI GAS - (760 TORR, 15 C)

COMPOSIZIONE DELL ARIA ATMOSFERICA SECCA E PRESSIONI PARZIALI DEI GAS - (760 TORR, 15 C) COMPOSIZIONE DELL ARIA ATMOSFERICA SECCA E PRESSIONI PARZIALI DEI GAS - (760 TORR, 15 C) COMPOSIZIONE ARIA NELL ATMOSFERA = COSTANTE A PARTE LE VARIAZIONI DELLA QUANTITA DI VAPORE ACQUEO A 0 C 1 torr =

Dettagli

Rapporto Struttura/Funzione delle Proteine

Rapporto Struttura/Funzione delle Proteine Macromolecole Biologiche Chimica Biologica A.A. 2010-2011 Rapporto Struttura/Funzione delle Proteine Struttura/Funzione delle Proteine Interazioni proteina-ligando come base della funzione di molte proteine

Dettagli

La chimica della vita. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

La chimica della vita. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 La chimica della vita 1 Tutta la materia è composta da elementi chimici È materia qualsiasi cosa, vivente e non vivente, che occupi dello spazio e che abbia una massa. La materia è composta da elementi

Dettagli

Dipartimento di Biochimica e Biofisica F. Cedrangolo Emoglobina ed introduzione alle emoglobinopatie.

Dipartimento di Biochimica e Biofisica F. Cedrangolo Emoglobina ed introduzione alle emoglobinopatie. Dipartimento di Biochimica e Biofisica F. Cedrangolo Emoglobina ed introduzione alle emoglobinopatie. Trasportatori di Ossigeno nei Vertebrati Mioglobina Emoglobina Muscoli Sangue L Emoglobina (Hb) Struttura

Dettagli

Tipi di trasportatori di elettroni nella catena respiratoria

Tipi di trasportatori di elettroni nella catena respiratoria Tipi di trasportatori di elettroni nella catena respiratoria 1. Flavoproteine 2. Proteine Ferro Zolfo 3. Citocromi 4. Citocromi contenenti Rame 5. Chinone: Coenzima Q All eccezione del coenzima Q, tutti

Dettagli

Trasporto dei gas respiratori nel sangue

Trasporto dei gas respiratori nel sangue Trasporto dei gas respiratori nel sangue La soluzione dei gas nei liquidi C Legge di Henry acq P gas S gas C acq = quantità di gas disciolta nella fase acquosa P gas = pressione parziale del gas nella

Dettagli

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA

- utilizzano esclusivamente le reattività chimiche di alcuni residui AA Enzimi semplici Enzimi coniugati - utilizzano esclusivamente le reattività chimiche di alcuni residui AA - richiedono la reattività chimica aggiuntiva di COFATTORI o COENZIMI gruppi prostetici COENZIMI

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Regolazione allosterica

Regolazione allosterica Macromolecole Biologiche Biotecnologie applicate alla progettazione e sviluppo di molecole biologicamente attive A.A. 2010-2011 Modulo di Biologia Strutturale Regolazione allosterica Marco Nardini Dipartimento

Dettagli

BIOCHIMICA APPLICATA e CLINICA

BIOCHIMICA APPLICATA e CLINICA BIOCHIMICA APPLICATA e CLINICA Regolazione Enzimatica Biosegnalazione Regolazione Ormonale Specializzazioni metaboliche (Biochimica d Organo) Integrazione del metabolismo BIOCHIMICA APPLICATA e CLINICA

Dettagli

possiede una propria struttura, da cui dipende la specifica funzione

possiede una propria struttura, da cui dipende la specifica funzione LE PROTEINE SONO DEI POLIMERI LE CUI UNITA RIPETITIVE SONO GLI -AMMINO ACIDI: ogni proteina possiede una propria struttura, da cui dipende la specifica funzione AMMINOACIDI E PROTEINE Le proteine rappresentano

Dettagli

La nuova biologia.blu

La nuova biologia.blu David Sadava, David M. Hillis, H. Craig Heller, May R. Berenbaum La nuova biologia.blu Il corpo umano PLUS 2 Capitolo C3 L apparato respiratorio 3 L apparato respiratorio L apparato respiratorio fornisce

Dettagli

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene

ENZIMI. Durante la reazione l enzima può essere temporaneamente modificato ma alla fine del processo ritorna nel suo stato originario, un enzima viene ENZIMI Tutti gli enzimi sono PROTEINE che funzionano da catalizzatori biologici nelle reazioni cellulari, e lavorano in condizioni blande di temperatura e ph (sono in grado di aumentare la velocità delle

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli