La struttura terziaria delle proteine

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "La struttura terziaria delle proteine"

Transcript

1 La struttura terziaria delle proteine 1

2 La struttura terziaria L arrangiamento spaziale degli aminoacidi di una singola catena polipeptidica a formare la sua struttura tridimensionale a domini viene chiamata struttura terziaria. L unità fondamentale della struttura terziaria è il dominio. Il termine di struttura terziaria viene usato sia per indicare il modo in cui i motivi si arrangiano a formare i domini (nel caso di proteine mono-dominio), sia il modo in cui una singola catena polipeptidica si ripiega in uno o più domini. In generale si osserva che se esiste una significativa omologia di sequenza aminoacidica fra due domini di proteine diverse, questi domini hanno struttura terziaria simile. 2

3 La struttura terziaria Nella struttura terziaria gli aminoacidi sono spazialmente distribuiti a seconda della loro polarità. Gli aminoacidi non polari si trovano nella parte interna della proteina, per evitare contatti con il solvente. Tale distribuzione viene promossa dalle interazioni idrofobiche. Gli aminoacidi polari carichi si trovano sulla superficie della proteina, in contatto con il solvente. La loro presenza all interno della proteina è dovuta ad una loro specifica funzione chimica, come promuovere la catalisi o partecipare al legame di ioni metallo. Gli aminoacidi polari non carichi di solito si trovano sulla superficie della proteina, ma spesso anche nella parte interna della macromolecola. In questo secondo caso, questi aminoacidi formano legami idrogeno con altri gruppi della proteina, neutralizzando così la polarità di questi gruppi. 3

4 Conservazione di strutture terziarie (FOLD) Mb 3-on-3 fold trhb 2-on-2 fold CD F A 4

5 conservazione di fold 5

6 delle proteine 6

7 L ultimo livello nella gerarchia strutturale delle proteine è rappresentato dalla struttura quaternaria. Strutture supersecondarie (Motivi) Domini 7

8 Le proteine che sono costituite da una sola catena polipeptidica sono chiamate monomeriche. Esiste un consistente numero di proteine costituite da un certo numero di catene polipeptidiche identiche, chiamate subunità, che si associano in modo specifico a formare una molecola multimerica. Si dice che queste proteine hanno una struttura quaternaria. Le zone di contatto fra le subunità sono costituite da catene laterali non polari e caratterizzate da interazioni di van der Waals, legami idrogeno, ponti salini (int. elettrostatiche) e talvolta ponti disolfuro intermolecolari. Le subunità possono funzionare in modo indipendente una dall altra oppure in modo cooperativo, così che la funzione di una subunità sia dipendente dallo stato funzionale delle altre subunità. Altre proteine sono costituite da catene polipeptidiche, e quindi da subunità, diverse, ciascuna con una diversa funzione. 8

9 Sono svariate le ragioni per cui le proteine costituite da diverse subunità (invece che da un unica catena polipeptidica) sono così comuni. In particolare: - eventuali difetti possono essere riparati sostituendo la subunità difettosa. - il sito di formazione della subunità può essere diverso da quello di assemblaggio della struttura finale e la sola informazione genetica necessaria è specificare le diverse subunità che si devono assemblare. 9

10 - nel caso degli enzimi, aumentarne le dimensioni attraverso l associazione di subunità identiche è più efficiente che aumentare la lunghezza della catena polipeptidica, poiché ogni subunità ha un sito attivo. Inoltre, la costituzione a subunità fornisce le basi strutturali per la regolazione della loro attività. 10

11 Nel formare i multimeri, le subunità si dispongono in modo simmetrico, cioè occupano posizioni geometricamente equivalenti, secondo le seguenti operazioni di simmetria rotazionale: - simmetria ciclica, in cui le subunità sono correlate da un singolo asse di rotazione; - simmetria diedrica, caratterizzata dalla composizione di un asse di rotazione di ordine n con un asse di rotazione di ordine 2 (che si intersecano perpendicolarmente); - altre simmetrie possibili sono quella tetraedrica, ottaedrica e icosaedrica. 11

12 Alcune proteine multimeriche presentano simmetria elicoidale. Le subunità chimicamente identiche dell elica non sono strettamente equivalenti, perché, per esempio, quelle alle estremità dell elica sono in un ambiente diverso rispetto a quelle nel mezzo. Tuttavia l intorno di tutte le subunità nell elica, tranne quelle vicino alle estremità, sono sufficientemente simili, per cui le subunità sono dette quasiequivalenti. 12

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana)

Proteine. Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Proteine Enzimi Fattori di Trascrizione Proteine di Membrana (trasportatori, canale, recettori di membrana) Ormoni e Fattori di crescita Anticorpi Trasporto Trasporto (emoglobina, LDL, HDL.) Fenotipo Proteine

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE

30/10/2015 LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE LIVELLI DI ORGANIZZAZIONE STRUTTURALE DELLE PROTEINE 1 CARATTERISTICHE DEL LEGAME PEPTIDICO lunghezza intermedia tra un legame singolo e uno doppio ibrido di risonanza per il parziale carattere di doppio

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE

STRUTTURA TRIDIMENSIONALE DELLE PROTEINE STRUTTURA TRIDIMENSIONALE DELLE PROTEINE Biologia della Cellula Animale 2016 1 STRUTTURA PROTEINE Cooper: The Cell, a Molecular Approach, 2 nd ed. http://en.wikipedia.org/wiki/protein_structure STRUTTURA

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Costituenti chimici della materia vivente

Costituenti chimici della materia vivente Costituenti chimici della materia vivente Le macromolecole biologiche Macromolecole (dal greco macros = grande) biologiche. Classi di composti biologici multifunzionali: Polisaccaridi proteine acidi

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici STRUTTURA TERZIARIA La struttura tridimensionale

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH

Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH Nomenclatura AMIDI Alcol + alcol etere R-OH + R -OH R-O-R + H 2 O Aldeide + alcol emiacetale R-CHO + R -OH R-CHOH-O-R Acido + Acido anidride R-COOH + R -COOH R-CO-O-CO-R + H 2 O Alcol + Acido estere R-COOH

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto Unità n 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia Capitolo 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H

Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale. legame peptidico. O O - N N + H H Il legame peptidico Il gruppo peptidico ha una struttura rigida e planare, dovuta al parziale (~40 %) carattere di doppio legame del legame peptidico. O O - C C N N + H H Il legame peptidico pp Il legame

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi

Dettagli

La FORMA delle MOLECOLE

La FORMA delle MOLECOLE La FORMA delle MOLECOLE Quando una molecola è costituita da due soli atomi, non vi è alcun dubbio sulla sua forma: gli atomi sono semplicemente disposti uno accanto all altro. Le molecole formate da tre

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

lati esterni altamente Idrofilici

lati esterni altamente Idrofilici I due filamenti complementari del DNA sono antiparalleli: uno è in direzione 5-3 e l altro in direzione 3-5. parte interna idrofobica lati esterni altamente Idrofilici APPAIAMENTO DELLE BASI AZOTATE: 2

Dettagli

Proteine ed acidi nucleici

Proteine ed acidi nucleici Proteine ed acidi nucleici Prof.ssa Flavia Frabetti aa. 2010-11 PRTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,,,

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

La chimica della pelle

La chimica della pelle La chimica della pelle 1 Gli amminoacidi Queste unità hanno la particolare caratteristica di contenere nella stessa molecola un gruppo acido (- COOH) ed uno basico (- NH 2 ), legati tra loro attraverso

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei.

Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. DNA e RNA Composizione e proprietà Struttura Analisi 1 STRUTTURA DAGLI ACIDI NUCLEICI Nel DNA e nell RNA i nucleotidi sono legati covalentemente da legami fosfodiesterei. I gruppi fosforici hanno pka vicino

Dettagli

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto

STRUTTURA TERZIARIA. H 3 N + COO - β-foglietto STRUTTURA TERZIARIA α-eliche H 3 N + COO - β-foglietto La catena polipeptidica delle proteine GLOBULARI oltre ad organizzarsi in strutture di tipo secondario va incontro ad un ulteriore ripiegamento sino

Dettagli

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole.

Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. 4.1 Angolo di legame e forma delle molecole Le proprietà delle sostanze dipendono dal tipo di legame che unisce gli atomi e dalla forma delle molecole. La forma e le dimensioni delle molecole, la disposizione

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

Struttura dei Virus. Terminologia. Acido nucleico + ogni molecola che ne determina la stabilità Struttura proteica che

Struttura dei Virus. Terminologia. Acido nucleico + ogni molecola che ne determina la stabilità Struttura proteica che Struttura dei Virus Terminologia Core Capside Capsomero Nucleocapside Envelope Peplomeri Virione Acido nucleico + ogni molecola che ne determina la stabilità Struttura proteica che racchiude l acido nucleico

Dettagli

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS

BIOMOLECOLE LE BASI DELLA BIOCHIMICA. Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE LE BASI DELLA BIOCHIMICA Capitolo 1 Dal Carbonio agli OGM PLUS BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici Proteine BIOMOLECOLE Carboidrati Lipidi Acidi Nucleici - monosaccaridi - disaccaridi

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Funzioni delle proteine

Funzioni delle proteine Funzioni delle proteine ENZIMI Proteine di trasporto Proteine di riserva Proteine contrattili o motili Proteine strutturali Proteine di difesa Proteine regolatrici Proteine di trasporto Emoglobina Lipoproteine

Dettagli

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE

CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE CORSO DI BIOCHIMICA PER INGEGNERIA BIOMEDICA I ESERCITAZIONE 1) Che tipo di ibridazione ha il carbonio coinvolto nel doppio legame degli alcheni? Descrivi brevemente. Alcheni Ibridazione sp 2 2s p x p

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

Le trasformazioni chimiche e fisiche della materia. Lezioni d'autore di Giorgio Benedetti

Le trasformazioni chimiche e fisiche della materia. Lezioni d'autore di Giorgio Benedetti Le trasformazioni chimiche e fisiche della materia Lezioni d'autore di Giorgio Benedetti INTRODUZIONE (I) VIDEO INTRODUZIONE (II) La comprensione delle proprietà delle sostanze e le trasformazioni che

Dettagli

2. I legami chimici. Gli ATOMI. Biologia Molecolare e Cellulare - D'Addario

2. I legami chimici. Gli ATOMI. Biologia Molecolare e Cellulare - D'Addario 2. I legami chimici contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale Gli ATOMI sono a loro volta costituiti da particelle

Dettagli

Principi di biologia TEMI - TRASVERSALI FONDAMENTALI IN BIOLOGIA E GENETICA

Principi di biologia TEMI - TRASVERSALI FONDAMENTALI IN BIOLOGIA E GENETICA BIOLOGIA è la scienza della vita, che indaga le caratteristiche dei sistemi viventi Principi di biologia biologia animale biologia cellulare biologia molecolare programma interno morte ordine riproduzione

Dettagli

Importanza dei legami non covalenti in Biologia

Importanza dei legami non covalenti in Biologia Importanza dei legami non covalenti in Biologia Biotecnologie / BSA Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise

Dettagli

02/03/2016. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Legami covalenti

02/03/2016. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Legami covalenti Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di atomi. La formazione del legame covalente si basa

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

I PROTIDI ASPETTI GENERALI

I PROTIDI ASPETTI GENERALI I PROTIDI ASPETTI GENERALI I PROTIDI O PROTEINE SONO SOSTANZE ORGANICHE AZOTATE, DI STRUTTURA MOLTO COMPLESSA, PRESENTI IN OGNI FORMA DI VITA. LE PROTEINE SONO COMPOSTI QUATERNARI, OSSIA SONO FORMATE DA

Dettagli

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11

Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA. Angela Chambery Lezione 11 Corso di Laurea in Farmacia Insegnamento di BIOCHIMICA Angela Chambery Lezione 11 Funzioni delle proteine Concetti chiave: La varietà strutturale delle proteine consente loro di svolgere un enorme quantità

Dettagli

Brady Senese Pignocchino Chimica.blu Zanichelli 2014 Soluzione degli esercizi Capitolo 10

Brady Senese Pignocchino Chimica.blu Zanichelli 2014 Soluzione degli esercizi Capitolo 10 Brady Senese Pignocchino Chimica.blu Zanichelli 201 Soluzione degli esercizi Capitolo 10 Esercizio PAG 207 ES 1 Risposta 1. Decidi quali atomi devono legarsi 2. Conta tutti gli elettroni di valenza 3.

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

struttura quaternaria. supersecondaria Domini

struttura quaternaria. supersecondaria Domini La struttura quaternaria La struttura quaternaria L ultimo livello nella gerarchia strutturale delle proteine è rappresentato dalla struttura quaternaria. Struttura supersecondaria Domini La struttura

Dettagli

Proteine. Struttura tridimensionale Parte II

Proteine. Struttura tridimensionale Parte II Proteine Struttura tridimensionale Parte II (D.L. Nelson, M.M. Cox, Lehninger Principles of Biochemistry, 4th ed., W.H. Freeman & Co., 2005) Plot di Ramachandran Una situazione opposta a quella della glicina

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Le molecole biologiche. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Le molecole biologiche 1 Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 2 Il carbonio deve acquistare quattro elettroni

Dettagli

LE MEMBRANE CELLULARI

LE MEMBRANE CELLULARI LE MEMBRANE CELLULARI Sono strutture sovramolecolari che racchiudono e delimitano l ambiente intracellulare e negli eucarioti anche gli organuli citoplasmatici. Hanno funzione di Protezione. Sostegno.

Dettagli

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi.

AMMINOACIDI. Gli amminoacidi si distinguono in base alla diversità della catena laterale R in ciascuno di essi. AMMINOACIDI Gli amminoacidi sono composti polifunzionali, infatti essi presentano sia un gruppo carbossilico, che conferisce loro caratteristiche acide, sia un gruppo amminico, che conferisce loro caratteristiche

Dettagli

I materiali della vita

I materiali della vita I materiali della vita I componenti chimici dei viventi Il corpo dei viventi è formato da relativamente pochi elementi chimici e in percentuale diversa da quella del mondo non vivente. Le molecole dei

Dettagli

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA)

La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) La chimica della vita: i composti organici. CARBOIDRATI LIPIDI PROTEINE ACIDI NUCLEICI (DNA, RNA) L atomo del carbonio (C).. C. Atomo tetravalente. C C C C Gli idrocarburi I legami del carbonio 109.5 gradi

Dettagli

Legami secondari e lo stato fisico

Legami secondari e lo stato fisico Legami secondari e lo stato fisico Gli stati aggregati (stato solido, liquido) richiedono la presenza di forze intermolecolari tra le molecole che compongono la sostanza. Legame ione dipolo (si forma fra

Dettagli

Le biomolecole si trovano negli organismi viventi

Le biomolecole si trovano negli organismi viventi Le biomolecole si trovano negli organismi viventi I viventi sono formati per la maggior parte da acqua e molecole, chiamate biomolecole. Le biomolecole sono sostanze contenenti carbonio. I composti del

Dettagli

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici.

Il carbonio è l elemento di base delle biomolecole. Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. Il carbonio è l elemento di base delle biomolecole Una cellula batterica può contenere fino a 5000 tipi diversi di composti organici. 1 Il carbonio deve acquistare quattro elettroni per essere stabile

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

Importanza dei legami non covalenti in Biologia

Importanza dei legami non covalenti in Biologia Importanza dei legami non covalenti in Biologia Biotecnologie / Biologia Sperimentale Applicata Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni

Dettagli

LE MOLECOLE BIOLOGICHE

LE MOLECOLE BIOLOGICHE LE MOLECOLE BIOLOGICHE Le cellule contengono quattro famiglie principali di molecole organiche Zuccheri (monosaccaridi) - forniscono una fonte di energia - subunità dei polisaccaridi Amminoacidi - subunità

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

Il legame peptidico è polare

Il legame peptidico è polare Scaricato da Il legame peptidico è polare SONO FAVORITE QUELLE CONFIGURAZIONI CHE CONSENTONO IL MAGGIOR NUMERO DI INTERAZIONI TRA LE PARTI DELLA CATENA POLIPEPTIDICA. A CAUSA DELLA POLARITA' DEL LEGAME

Dettagli

Nucleotidi e acidi nucleici

Nucleotidi e acidi nucleici Nucleotidi e acidi nucleici ACIDI NUCLEICI Biomolecole fondamentali per tutti gli organismi viventi Unici nella capacità di autoduplicazione Conservazione e trasmissione da una generazione all altra dell

Dettagli

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di atomi. La formazione del legame covalente si basa

Dettagli

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1)

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise da coppie di atomi. Legami covalenti Importanza dei legami non covalenti in Biologia

Dettagli

Teoria degli orbitali. Lo spazio intorno al nucleo in cui è possibile trovare con la massima probabilità gli elettroni viene chiamato orbitale.

Teoria degli orbitali. Lo spazio intorno al nucleo in cui è possibile trovare con la massima probabilità gli elettroni viene chiamato orbitale. Teoria degli orbitali Lo spazio intorno al nucleo in cui è possibile trovare con la massima probabilità gli elettroni viene chiamato orbitale. orbitale nucleo STPA-Chimica Organica 1 L orbitale 1s Gli

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

ELETTRONEGATIVITA CAPACITA DI UN ATOMO DI ATTIRARE UNA COPPIA DI ELETTRONI DI LEGAME DETERMINANDO COSI IL TIPO DI LEGAME CHE SI VIENE A FORMARE. DERIVA DA ALTRE DUE GRANDEZZE I. Energia di ionizzazione:

Dettagli

1. Le biomolecole: Struttura e funzione delle proteine

1. Le biomolecole: Struttura e funzione delle proteine 1. Le biomolecole: Struttura e funzione delle proteine Corso 240/350: Didattica di biochimica e biologia molecolare con laboratorio (2 CFU) 16 ore) Marco Scocchi ( BIO/10-11) Le biomolecole Biomolecola:

Dettagli

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1 1. La forma delle molecole Molte proprietà delle sostanze dipendono dalla forma

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 15 Le forze intermolecolari e gli stati condensati della materia 3 Sommario 1. Le forze intermolecolari 2. Molecole polari e

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto

Gli acidi nucleici, DNA (acido deossiribonucleico) e RNA (acido. ribonucleico), sono polimeri biologicamente importanti in quanto Gli acidi nucleici, DA (acido deossiribonucleico) e RA (acido ribonucleico), sono polimeri biologicamente importanti in quanto svolgono ruoli fondamentali nell ereditarietà e nella sintesi proteica. Sono

Dettagli

La Chimica della Vita

La Chimica della Vita La Chimica della Vita I componenti chimici delle cellule Nell atomo il numero di elettroni è uguale al numero di protoni del suo nucleo. Il nucleo dei diversi isotopi di uno stesso elemento contiene lo

Dettagli