Interazioni non-covalenti

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Interazioni non-covalenti"

Transcript

1 BCP 3-4 Interazioni non-covalenti

2 Interazioni non covalenti D H A δ - δ + δ -

3 Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto a 83 kcal/mol (347 kj/mol) per un legame C C). Questi legami deboli possono formarsi sia fra parti diverse della stessa macromolecola, sia fra parti di macromolecole diverse. Essi giocano un ruolo fondamentale in molti processi biologici, fra cui la fedele replicazione del DNA, il folding delle proteine, il riconoscimento specifico di substrati da parte di enzimi, il riconoscimento di molecole segnale. Le interazioni non covalenti si possono classificare in: - interazioni elettrostatiche - interazioni di van der Waals - legami idrogeno - effetto idrofobico

4 Le interazioni non covalenti Energie di legame associate alle principali interazioni non covalenti: Tipo di interazione non covalente Energia dell interazione (kcal/mole) Interazioni elettrostatiche Legame idrogeno Interazioni di van der Waals Nel considerare i vari contributi energetici che stabilizzano una proteina non si può prescindere dal fatto che la proteina è immersa in un solvente, cheè costituito principalmente p da acqua. Le proprietà p fisiche del solvente sono estremamente importanti per la stabilità della proteina.

5 Le interazioni non covalenti Le interazioni elettrostatiche, i legami idrogeno e le interazioni di van der Waals tra due molecole in un ambiente acquoso non sono particolarmente favorevoli dal punto di vista energetico, perché sono in competizione con interazioni di analoga intensità fra le molecole isolate e l acqua che le circonda. Infatti, l acqua è una molecola polare, con una grande capacità di formare legami idrogeno: queste sue caratteristiche la rendono una molecola-solvente quasi ideale. L acqua indebolisce fortemente le forze elettrostatiche e i legami idrogeno fra molecole polari: - l acqua diminuisce l intensità delle interazioni elettrostatiche di un fattore di circa 80 rispetto alle stesse interazioni nel vuoto; - l acqua può competere con gruppi della proteine nella formazione di legami idrogeno.

6 Interazioni elettrostatiche Due gruppi elettrostaticamente carichi si attraggono o si respingono con una forza: F = q 1q 2 r 2 D Legge di Coulomb dove q 1 eq 2 sono le cariche (Coulomb) dei due gruppi r è la distanza tra q 1 eq 2, D è la costante dielettrica del mezzo in cui si trovano le cariche. L energia dell interazione e inversamente proporzionale alla prima potenza di r. L interazione è maggiore nel vuoto (D = 1), minore in un mezzo come l acqua (D = 80). Non è facile misurare D per una proteina: in genere viene assegnato un valore di 3-5. Sistemi biologici: si considerano solo cariche formali che si manifestano se Sistemi biologici: si considerano solo cariche formali, che si manifestano se gruppi chimici sono ionizzati.

7 Interazioni elettrostatiche In una macromolecola biologica non e facile descrivere tutte le interazioni elettrostatiche piu complesse di quella carica-carica: - carica dipolo (andamento come 1/R 2 ) - dipolo dipolo (andamento come 1/R 3 ) - carica dipolo indotto (andamento come 1/R 4 ) - dipolo dipolo indotto (andamento come 1/R 5 )

8 Interazioni elettrostatiche Lisina, Arginina e Istidina Sono tre aminoacidi basici, carichi positivamente a ph fisiologico. Acido aspartico e Acido glutammico Sono due aminoacidi acidi, carichi negativamente sopra ph = 4

9 Interazioni elettrostatiche Esempio di ponte salino (o legame ionico): Interazione elettrostatica tra l acido glutammico b:21 che porta una carica formale di 1 unità, e l arginina i b:154 che ha carica +1. La carica di ciascun residuo e in buona parte delocalizzata I ponti salini sono poco numerosi nelle proteine e si concentrano prevalentemente t sulla superficie proteica. Ponti salini in zone meno accessibili delle proteine si realizzano sotto condizioni particolari (per es. la triade catalitica Asp-His-Ser delle proteasi a serina).

10 Interazioni di van der Waals Sono interazioni attrattive aspecifiche fra molecole non cariche, che giocano un ruolo quando gli atomi distano tra loro 3-4 Å. A) Forze di London o di dispersionei Esprimono il fatto che esiste una mutua attrazione fra molecole od atomi anche uguali fra loro ed elettricamente simmetrici. Tale simmetria è però presente solo da un punto di vista statistico e l origine lorigine di queste forze attrattive è dovuta all effetto di spostamenti temporanei di carica elettronica che generano dipoli transienti nell atomo o nella molecola considerata. A loro volta tali dipoli transienti generano dei dipoli transienti indotti nelle molecole più vicine e quindi forze attrattive di natura elettrostatica. B) A distanze brevi diventano predominanti forti forze repulsive, perché le nuvole elettroniche più esterne tendono a sovrapporsi.

11 Interazioni di van der Waals Le interazioni di van der Waals sono spesso rappresentate da un energia potenziale E(d), funzione della distanza d, che include sia la forza attrattiva, sia quella repulsiva a corto raggio. Questa energia è rappresentata dl dal potenziale il di Lennard-Jones: B A E(d) = - d 12 d 6 = E(d) 1/d 12 Termine repulsivo Termine attrattivo 1/d 6 d A e B sono delle costanti empiriche

12 Interazioni di van der Waals La distanza in corrispondenza della quale si ha la migliore interazione fra due atomi, data dal minimo del potenziale, corrisponde alla somma dei rispettivi raggidivander Waals. Il termine raggio di van der Waals, utilizzando per l atomo il modello a sfere rigide, si riferisce alla minima distanza di contatto fra due atomi adiacenti, osservati in composti cristallini campione, non legati covalentemente. E(d) 1/d 12 1/d 6 d La forza attrattiva fra due atomi aumenta quando essi si avvicinano, fino a quando raggiungono la distanza di van der Waals di contatto. A di t if i i ll di ttt di t d i ti f ti f A distanze inferiori a quella di contatto diventano predominanti forti forze repulsive, perché le nuvole elettroniche più esterne tendono a sovrapporsi.

13 Interazioni di van der Waals Dall andamento andamento del potenziale di Lennard- Jones deriva quello dei cosiddetti raggi di van der Waals che sono calcolati in base al valore di d in corrispondenza del minimo energetico. La somma dei raggi di van der Waals di due atomi è data approssimativamente dalla distanza d a cui l energia comincia a crescere rapidamente. Per distanze d minori della somma dei raggi di van der Waals i due atomi si respingono, per distanze maggiori si attraggono. E(d) 1/d 12 1/d 6 d

14 Legami idrogeno Il legame idrogeno può essere formato sia tra molecole non cariche che cariche. In un legame idrogeno un atomo di idrogeno viene condiviso da due atomi. L atomo di idrogeno è legato covalentemente a uno dei due atomi, chiamato donatore (D) di idrogeno, ed interagisce con l altro atomo, chiamato accettore (A) di idrogeno. Nel caso di una specie non carica essa può avere un ampia polarizzazione, cioè i suoi orbitali elettronici sono distribuiti in modo tale che parte della molecola ha meno elettroni (quindi porta una carica positiva) mentre l altra parte ha un eccesso di elettroni (quindi porta una carica negativa). In una molecola nella quale uno o più atomi di H sono legati covalentemente ad un elemento più elettronegativo, si genera un dipolo in cui l atomo/gli atomi di H rappresentano la parte positiva:

15 Legami idrogeno H F (δ + ) (δ - ) H (δ + ) (δ - ) H O H H N H (δ + ) (δ - ) Se l elemento è fortemente elettronegativo (F, O, N) la polarizzazione dell atomo H ètaledapermettergli di legare elettrostaticamente un altro atomo elettronegativo della stessa o di un altra molecola. Le piccole dimensioni dell atomo di H e la presenza in esso di un solo elettrone (assenza di elettroni di schermo) rendono particolarmente intenso il campo elettrico dell atomo H protonizzato rendendo possibile la formazione di un legame elettrostatico con un altro atomo che disponga di un doppietto elettronico solitario (orbitale completo di 2 elettroni).

16 Legami idrogeno Se sia D che A sono elettronegativi, allora la nuvola elettronica relativa a D H è polarizzata verso D, cioè si ha un eccesso δ - di carica negativa su D. A ha una parziale carica negativa δ - che attrae l atomo di idrogeno. In questo senso, il legame idrogeno si può pensare come un intermedio nel trasferimento di un protone da un acido ad una base. - interazione elettrostatica di δ - e δ + D H A δ - δ + δ - - deformazione degli orbitali molecolari - depauperamento di elettroni nell orbitale di H avvicinamento fra H ed A

17 Legami idrogeno Nelle e proteine pote eil donatore in un legame e idrogeno doge oè un atomo o di ossigeno o o azoto che ha un atomo di idrogeno legato covalentemente. L accettore può essere sia un atomo di ossigeno che di azoto. - la lunghezza di dei legami idrogeno è intermedia tra quella dei legami covalenti e le interazioni di van der Waals. Di solito la distanza tra atomo H e accettore A è 10-25% inferiore della somma dei corrispondenti raggi di van der Waals. - i legami idrogeno sono altamente direzionali. I legami idrogeno più intensi si hanno quando A e D sono co-lineari (legame fortemente direzionale).

18 Legami idrogeno In generale, e e, le energie e ein gioco goconel legame e idrogeno o sono o dell ordine d e di qualche kcal/mol (in teoria, per legami-h nel vuoto). In realtà, se consideriamo il legame idrogeno che si può formare tra due gruppi in una proteina, ti l energia associata it è minore, circa kcal/mole. l Si deve tenere conto del fatto che una proteina non si trova nel vuoto ma in una soluzione acquosa. Affinchè si formi un legame idrogeno fra due gruppi appartenenti alla proteina, si devono prima rompere i legami idrogeno che ciascun gruppo fa con una molecola l d acqua. Tenendo conto dell energia che si spende per rompere tali legami idrogeno, si arriva ai valori di kcal/mole.

19 Legami-idrogenoidrogeno Una variante del legame idrogeno particolarmente forte si ha in presenza di gruppi carichi.

20 Legami idrogeno I legami idrogeno sono fondamentali nelle strutture proteiche. L abilità degli ossigeni carbonilici della catena principale di formare legami idrogeno con i gruppi amminici della catena principale permetteestabilizzalaformazione delle strutture secondarie come α-eliche e foglietti β. α-elica foglietto β

21 Effetto idrofobico Le interazioni fra acqua e superfici non polari non sono favorevoli: proprio come l olio loliodisperso nell acqua tende a raccogliersi in un unica unica goccia, anche i gruppi non polari nelle proteine tendono ad aggregarsi, per ridurre la superficie apolare a contatto con l acqua. Questa preferenza di specie non polari per ambienti i non acquosi viene detto effetto idrofobico: esso è uno dei principali fattori di stabilità delle proteine. L effetto idrofobico fa sì che sostanze non polari minimizzino il loro contatto con l acqua, e molecole anfipatiche (come per esempio i detergenti) formino micelle in soluzioni acquose. Il i fi i i i à l i l d l i i Il meccanismo fisico per cui entità non polari sono escluse da soluzioni acquose è di carattere entropico.

22

23 Effetto idrofobico Le molecole d acqua allo stato liquido formano dinamicamente un alto numero di legami idrogeno, in funzione della temperatura. L introduzione di una molecola non polare nell acqua liquida crea una sorta di cavità nell acqua, che temporaneamente rompe alcuni legami idrogeno fra le molecole d acqua, poiché un gruppo non polare non può né accettare né donare legami idrogeno con le molecole d acqua. Le molecole d acqua spostate si riorientano per formare il maggior numero di nuovi legami idrogeno, creando una struttura ordinata, una specie di gabbia, detta clatrato, intorno alla molecola non polare.

24 Effetto idrofobico Poiché il numero di modi con cui le molecole d acqua formano legami idrogeno sulla superficie di un gruppo non polare è inferiore a quello che farebbero in sua assenza si ha una diminuzione di entropia del sistema. Anche se, da un punto di vista entalpico, il sistema clatrato è più stabile (ΔH < 0, per una debole liberazione di energia dovuto alla formazione di legami idrogeno ed interazioni di van der Waals), globalmente: ΔG = ΔH TΔS > 0 processo non spontaneo L aggregazione di gruppi non polari minimizza l area superficiale della cavità occupata dal gruppo apolare e quindi la perdita di entropia del sistema. acqua C 6 H 6 C 6 H 6 acqua 2xC 6 H 6 L effetto idrofobico rappresenta una interazione chiave per il folding delle proteine, in cui residuii con catene laterali idrofobiche si ripiegano verso l interno della proteina lasciando esposti al solvente in superficie residui polari.

25 Effetto idrofobico & Folding La catena polipeptidica contiene sia gruppi polari che non polari, per cui si avrà un diverso comportamento dei residui nell acqua. Si osserva, infatti, che i gruppi apolari sono in gran parte raccolti nella parte interna (core) e idrofobica della proteina, mentre i residui polari sono esposti al solvente. Ribosoma Proteina estesa (unfolded) Molten globule (U) Unfolded Folded (F) Proteina globulare (folded) ΔG FOLDING = G F G U = ΔH TΔS < 0 processo spontaneo di folding > 0 processo non spontaneo

26 Effetto idrofobico & Folding ΔH = variazione di entalpia fra stato finale ed iniziale (interazioni di van der Waals, elettrostatiche, legami idrogeno). ΔH risulta << 0. T = temperatura assoluta (K) ΔS = variazione di entropia (disordine del sistema) fra stato finale ed iniziale. Poiché S U >> S F (S F -S U )=ΔS<<0 Nel ΔG FOLDING il contributo TΔS è positivo ed elevato, e sia ΔH che TΔS assumono valori grandi (migliaia i di kcal/mol). l) Al contrario ΔG FOLDING ha valori piccoli: ΔG FOLDING = -10, -15 kcal/mol Quindi il processo di folding avviene grazie ad un minimo prevalere di ΔH su TΔS; è sufficiente un piccolo aumento di T per causare unfolding (e spesso denaturazione) della proteina.

27 Effetto idrofobico & Folding Responsabile della variazione di entropia è l effetto idrofobico. ΔS FOLDING =S F S U = ΔS CATENA + ΔS SOLVENTE sempre < 0 Nel caso di un soluto apolare in un mezzo acquoso, le molecole d acqua che formano il clatrato attorno alla molecola apolare sono caratterizzate da una variazione di entropia negativa. Spontaneamente le molecole apolari si riuniscono in modo da minimizzare la variazione negativa di ΔS SOLVENTE. Nel caso del folding proteico di proteine globulari solubili, si forma una zona interna, core idrofobico di residui apolari che, nella forma proteica unfolded erano coinvolti nella formazione dei clatrati con molecole d acqua ordinate attorno ad essi.

28 Effetto idrofobico Superficie accessibile al solvente di una proteina (o di catena laterale) La superficie proteica è definita dall insieme dei punti degli atomi esterni, ciascuno descritto come una sfera rigida avente come raggio il raggio di van der Waals (superficie i di van der Waals). l) Le molecole l d acqua sono considerate sfere con raggio di van der Waals pari a 1.4 Å. La superficie accessibile al solvente (ASA) è definita come l area descritta dal centro di una molecola d acqua che rotola sopra la superficie di van der Waals della proteina (o della catena laterale). superficie di van der Waals

29 ..\..\..\..\..\..\..\..\Program Files\DeLano Scientific\PyMOL\PyMOLWin.exe

30 Effetto idrofobico ΔG di trasferimento delle catene laterali degli aminoacidi E stato misurato il ΔG di trasferimento di ciascun aminoacido dall acqua ad un solvente organico (per esempio etanolo o diossano). Per avere la misura del ΔG di trasferimento della sola catena laterale, bisogna non considerare il contributo della catena principale (che falserebbe la misura, avendo sempre una carica negativa del gruppo carbossilico COO - e una positiva del gruppo aminico NH 3+ ). Ciò equivale a sottrarre dal valore di ΔG di trasferimento di ciascun aminoacido il ΔG di trasferimento della Gly. ΔG cat.lat. = ΔG aa - ΔG Gly

31 Effetto idrofobico Esiste una relazione lineare tra ΔG di trasferimento (dall acqua acqua ad un solvente apolare) e superficie accessibile al solvente per catene laterali completamente non polari. Nl Nel caso di aminoacidi idi moderatamente polari (Thr, Ser, Met, Tyr e Trp) una relazione analoga è relativamente valida, applicando una diminuzione di circa 1.5 kcal/mole nel ΔG di trasferimento.

32 Effetto idrofobico Si può quindi dire che il ΔG di trasferimento è proporzionale alla superficie non polare accessibile al solvente. La costante di proporzionalità (coefficiente angolare della retta) vale: kcal/mole Å 2. Questo significa che si guadagnano kcal/mole (o equivalentemente 25 cal/mole) l per ogni Å 2 di superficie i apolare che si seppellisce nel cuore di una proteina.

33 Effetto idrofobico Correlazione effetto idrofobico con la temperatura Si consideri il trasferimento di una molecola A da un solvente organico ad uno polare (acqua). ΔG =ΔH TΔS [A] H2O K = ΔG = RT lnk [A] Quindi: RT lnk = ΔH TΔS ΔH ΔS lnk = + relazione di van t Hoff RT R [A] ORG Org H 2 O A

34 Effetto idrofobico Correlazione effetto idrofobico con la temperatura ΔH ΔS lnk = + RT R relazione di van t Hoff Esiste quindi una relazione lineare fra lnk e1/t. All aumentare di T, lnk (e quindi K) diminuisce aumenta la concentrazione di A ORG. L effetto idrofobico è favorito dall aumento della temperatura T (naturalmente deve essere complessivamente ΔG<0).

35 Hydrophobicity of amino acid residues and hydropathy plots A) Several Hydrophobicity scales: Hphob.Doolittle.html Hphob.Eisenberg.html B) Calculation of Hydropathy plot, starting from amino acid sequences: protscale.pl.htm

36 Hydrophobic effect and mebrane structure-stability t t

Macromolecole Biologiche Interazioni non covalenti

Macromolecole Biologiche Interazioni non covalenti Interazioni non covalenti D H A δ - δ + δ - Le interazioni non covalenti Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle

Dettagli

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti:

Le interazioni non covalenti si possono classificare in: Energie di legame associate alle principali interazioni non covalenti: Interazioni fra atomi che non sono legati da legami covalenti. Le interazioni non covalenti sono molto meno intense rispetto alle interazioni covalenti (poche kcal/mol rispetto ad esempio a 83 kcal/mol

Dettagli

CENNI SUL TIPO DI FORZE

CENNI SUL TIPO DI FORZE CENNI SUL TIPO DI FORZE Forze deboli che influenzano la struttura delle proteine: le interazioni di van der Waals repulsione attrazione Forze attrattive dovute a interazioni istantanee che si generano

Dettagli

Le interazioni deboli:

Le interazioni deboli: Le interazioni deboli: sono legami non covalenti sono da 1 a 3 ordini di grandezza più deboli dei legami covalenti sono alcune volte maggiori della tendenza a dissociare dovuta all agitazione termica delle

Dettagli

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU)

UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) UNIVERSITÀ DEGLI STUDI DI TERAMO CORSO DI LAUREA IN BIOTECNOLOGIE CORSO MONODISCIPLINARE: BIOCHIMICA (6CFU) Roberto Giacominelli Stuffler IL C.M. BIOCHIMICA È SUDDIVISO IN DUE UNITÀ DIDATTICHE: A) BIOCHIMICA

Dettagli

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti:

Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: Le interazioni reversibili tra le macromolecole sono mediate da 3 specie di legami non covalenti: 1) Legami elettrostatici 2) Legami idrogeno 3) Forze di van der Waals Le interazioni deboli tra biomolecole

Dettagli

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole

Introduzione alla chimica organica. 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole Introduzione alla chimica organica 1. Regola ottetto 2. Teoria del legame 3. Geometria delle molecole La chimica organica tratta di pochissimi atomi che si possono combinare in moltissimi modi Grande importanza

Dettagli

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti

MOLECOLE. 2 - i legami chimici. Prof. Vittoria Patti MOLECOLE 2 - i legami chimici Prof. Vittoria Patti Gli stati di aggregazione della materia STATO SOLIDO molecole ravvicinate, struttura ordinata, volume proprio, forma propria STATO LIQUIDO molecole

Dettagli

FORZE INTERMOLECOLARI

FORZE INTERMOLECOLARI FORZE INTERMOLECOLARI Le forze intermolecolari sono forze di attrazione che si stabiliscono tra le molecole che costituiscono una sostanza Determinano la tendenza delle molecole ad avvicinarsi. Per ogni

Dettagli

IL LEGAME A IDROGENO

IL LEGAME A IDROGENO IL LEGAME A IDROGENO Il legame idrogeno è un particolare tipo di interazione fra molecole che si forma ogni volta che un atomo di idrogeno, legato ad un atomo fortemente elettronegativo (cioè capace di

Dettagli

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame.

Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Il legame dativo o coordinativo: lo stesso atomo fornisce i due elettroni di legame. Non necessariamente i due elettroni che concorrono alla formazione del legame devono provenire da entrambi gli atomi

Dettagli

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-)

IN UN ATOMO SI DISTINGUE UN NUCLEO CARICO POSITIVAMENTE ATTORNO AL QUALE RUOTANO PARTICELLE CARICHE NEGATIVAMENTE: GLI ELETTRONI (e - ) (-) LA VITA, LA CHIMICA E L ACQUA PER INIZIARE QUALCHE CENNO DI CHIMICA LA MATERIA E FATTA DI COMBINAZIONI DI ELEMENTI. GLI ELEMENTI SONO COMPOSTI DA SINGOLI ATOMI, LE PIU PICCOLE UNITA CHE MANTENGONO LE PROPRIETA

Dettagli

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI

Corso di BIOCHIMICA. Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Corso di BIOCHIMICA Libro di testo: Nelson DL e Cox MM I PRINCIPI DI BIOCHIMICA DI LEHNINGER QUINTA EDIZIONE - ZANICHELLI Materiale didattico e esercizi su: http://moodle2.units.it/ Password: BioFarma

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

IL LEGAME CHIMICO. Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI IL LEGAME CIMICO Come dagli atomi si costruiscono le molecole 02/19/08 0959 PM 1 Per descrivere come gli elettroni si distribuiscono nell atomo attorno al nucleo si può far riferimento al MODELLO A GUSCI

Dettagli

FORZE INTERMOLECOLARI o LEGAMI DEBOLI

FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E

Dettagli

Legame Chimico. Legame Chimico

Legame Chimico. Legame Chimico Legame Chimico Fra due atomi o gruppi di atomi esiste un legame chimico se le forze agenti tra essi danno luogo alla formazione di un aggregato di atomi sufficientemente stabile da consentire di svelarne

Dettagli

FORZE INTERMOLECOLARI o LEGAMI DEBOLI

FORZE INTERMOLECOLARI o LEGAMI DEBOLI FRZE INTERMLECLARI o LEGAMI DEBLI 1 Le forze intermolecolari sono forze attrattive tra entità discrete come atomi o molecole, dette anche legami o interazioni deboli (E

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Chimica generale e inorganica Studia gli elementi e i composti inorganici

Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica generale e inorganica Studia gli elementi e i composti inorganici Chimica organica Studia i composti organici, cioè composti che contengono atomi di carbonio Biochimica È lo studio della chimica

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni

I LEGAMI CHIMICI. Configurazione elettronica stabile: è quella in cui tutti i livelli energetici dell atomo sono pieni di elettroni I LEGAMI CIMICI In natura sono pochi gli elementi che presentano atomi allo stato libero. Gli unici elementi che sono costituiti da atomi isolati si chiamano gas nobili o inerti, formano il gruppo VIII

Dettagli

Elettronegatività Elettronegatività

Elettronegatività Elettronegatività Elettronegatività Nel legame covalente tra atomi uguali, la nuvola elettronica è simmetrica rispetto ai due nuclei (es. H 2, Cl 2, F 2 ) legame covalente apolare. Nel legame covalente tra atomi con Z eff

Dettagli

Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico

Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico I LEGAMI CHIMICI Legami atomici o forti Legami molecolari o deboli Legame covalente Puro Polare Legame dativo o di coordinazione Legame ionico Legame metallico Legame dipolo-dipolo Legame idrogeno Legame

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara

ATOMI E MOLECOLE. Psicobiologia Lezione nr. 1. Prof. Lasaponara ATOMI E MOLECOLE Psicobiologia Lezione nr. 1 Prof. Lasaponara La struttura dell atomo I legami chimici e le molecole I componenti elementari della materia vivente 20 miliardi di anni fa Caratteristiche

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli

Interazioni deboli. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012

Interazioni deboli. Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Interazioni deboli 1 Sylvia S. Mader Immagini e concetti della biologia Zanichelli editore, 2012 Legami deboli o interazioni deboli La forza di un legame chimico viene stabilita in base alla energia del

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Chimotripsina Una proteina globulare. Glicina Un amminoacido

Chimotripsina Una proteina globulare. Glicina Un amminoacido Chimotripsina Una proteina globulare Glicina Un amminoacido - In teoria un numero enorme di differenti catene polipeptidiche potrebbe essere sintetizzato con i 20 amminoacidi standard. 20 4 = 160.000 differenti

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α

Aminoacidi. Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α Aminoacidi Gli α-aminoacidi sono molecole con almeno due gruppi funzionali legati al carbonio α 1 Isomeria ottica Tutti gli AA, esclusa la glicina, presentano almeno un atomo di carbonio asimmetrico, il

Dettagli

L acqua. Ci devono essere delle forze che tengono saldamente insieme le molecole d acqua

L acqua. Ci devono essere delle forze che tengono saldamente insieme le molecole d acqua L acqua Comparata a molecole con caratteristiche atomiche simili e di grandezza comparabile, l acqua presenta alcune caratteristiche peculiari Comparando l idruro dell ossigeno con gli idruri degli elementi

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

Chimica. Lezione 2 Parte II Composti ionici e molecolari

Chimica. Lezione 2 Parte II Composti ionici e molecolari Chimica Lezione 2 Parte II Composti ionici e molecolari Composti molecolari Gli ELEMENTI chimici (ad eccezione dei gas nobili) vivono in aggregati più o meno complessi Sono aggregati discreti (hanno un

Dettagli

Diagramma di Ramachandran

Diagramma di Ramachandran Chimica Biologica A.A. 2010-2011 Diagramma di Ramachandran Diagramma di Ramachandran Catena polipeptidica La formazione in successione di legami peptidici genera la cosiddetta catena principale o scheletro

Dettagli

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto

1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1.La forma delle molecole 2.La teoria VSEPR 3.Molecole polari e apolari 4.Le forze intermolecolari 5.Legami a confronto 1 1. La forma delle molecole Molte proprietà delle sostanze dipendono dalla forma

Dettagli

PROPRIETA DEI MATERIALI

PROPRIETA DEI MATERIALI PROPRIETA DEI MATERIALI Una proprietà è la risposta di un materiale ad una sollecitazione esterna. Per i materiali solidi le proprietà possono raggrupparsi in sei differenti categorie: 1. Meccaniche 2.

Dettagli

Il Legame Chimico e la Struttura Molecolare

Il Legame Chimico e la Struttura Molecolare A.A.2016 2017 CCS-Biologia CCS-Scienze Geologiche 1 Il Legame Chimico e la Struttura Molecolare Energia di interazione di due atomi di idrogeno Cap 8. 1-7, 9, 10(a/b), 17-20, 27-28, 31-33, 37-40, 52, 93-96

Dettagli

LE PROTEINE -struttura tridimensionale-

LE PROTEINE -struttura tridimensionale- LE PROTEINE -struttura tridimensionale- Struttura generale di una proteina Ceruloplasmina Cosa sono??? Sono biopolimeri con forme ben definite. composti da molteplici amminoacidi, legati con legami peptidici

Dettagli

Legame chimico: covalente polare Legame covalente polare

Legame chimico: covalente polare Legame covalente polare Legame chimico: covalente polare Legame covalente polare Il passaggio dal legame covalente al legame ionico è il risultato di una distribuzione elettronica non simmetrica. Il simbolo δ (lettera greca delta

Dettagli

1. L energia di legame. 2. I gas nobili e a regola dell ottetto. 3. Il legame covalente. 4. Il legame covalente dativo. 5. Il legame covalente polare

1. L energia di legame. 2. I gas nobili e a regola dell ottetto. 3. Il legame covalente. 4. Il legame covalente dativo. 5. Il legame covalente polare Capitolo 10 I legami chimici 1. L energia di legame 2. I gas nobili e a regola dell ottetto 3. Il legame covalente 4. Il legame covalente dativo 5. Il legame covalente polare 6. Il legame ionico 7. I composti

Dettagli

1. L energia di legame

1. L energia di legame legami chimici 1. L energia di legame Nonostante l enorme numero di combinazioni possibili fra gli atomi, non tutte sono realizzabili: un composto si forma solo se la sua energia potenziale è minore dei

Dettagli

Legame chimico: covalente polare Legame covalente polare

Legame chimico: covalente polare Legame covalente polare Legame chimico: covalente polare Legame covalente polare Il passaggio dal legame covalente al legame ionico è il risultato di una distribuzione elettronica non simmetrica. Il simbolo δ (lettera greca delta

Dettagli

Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame

Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame IL LEGAME CHIMICO Regola dell'ottetto e suo superamento Legame ionico Covalenza e ordine di legame Carica formale Risonanza ElettronegativitÄ e polaritä del legame 1 IL LEGAME CHIMICO Il legame chimico

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

Legame covalente polare

Legame covalente polare Legame chimico: covalente polare Legame covalente polare Il passaggio dal legame covalente al legame ionico è il risultato di una distribuzione elettronica non simmetrica. Il simbolo δ (lettera greca delta

Dettagli

Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi

Idrogeno (H) Azoto (N) La materia è costituita da elementi chimici. In natura sono presenti 92 elementi Gli organismi sono fatti da MATERIA*. (*qualsiasi cosa che occupa uno spazio e ha una massa) Gli antichi filosofi greci dicevano che la materia deriva da 4 ingredienti di base o ELEMENTI (ARIA, ACQUA,

Dettagli

I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo

I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo La polarità I legami covalenti eteronucleari spostano la carica del legame sull atomo più elettronegativo L elettronegatività è il parametro di riferimento utilizzato per valutare il trasferimento di carica

Dettagli

Il legame chimico. Lezioni 17-20

Il legame chimico. Lezioni 17-20 Il legame chimico Lezioni 17-20 1 Il legame chimico Le forze attrattive di natura elettrica che tengono uniti gli atomi in molecole o in composti ionici sono dette legami chimici. Legami atomici: covalente

Dettagli

Forze intermolecolari

Forze intermolecolari Forze intermolecolari Le forze intermolecolari sono forze attrattive tra molecole, tra ioni o tra ioni e molecole. In assenza di tali forze tutte le molecole sarebbero gas le molecole possono stabilire

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

Tensione di vapore evaporazione

Tensione di vapore evaporazione Transizioni di fase Una sostanza può esistere in tre stati fisici: solido liquido gassoso Il processo in cui una sostanza passa da uno stato fisico ad un altro è noto come transizione di fase o cambiamento

Dettagli

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente)

Elementi sistemati nella TAVOLA PERIODICA DEGLI ELEMENTI in base al numero atomico crescente O, H, N, C (+ del 96% della materia vivente) OVERVIEW Atomo: più piccola porzione di un elemento che mantiene le proprietà chimiche dello stesso Teoria atomica e tavola periodica Legami e interazioni degli atomi Acqua e le sue proprietà Acidi e basi

Dettagli

28 Ni. 27 Co. 29 Cu. 26 Fe. 45 Rh. 46 Pd. 47 Ag. 44 Ru

28 Ni. 27 Co. 29 Cu. 26 Fe. 45 Rh. 46 Pd. 47 Ag. 44 Ru Il legame chimico 1 2 3 4 5 6 7 8 1 1s 2 e 1s 2 3 Li 2s 4 Be 2s 2 5 B 2s 2 p 6 C 2s 2 p 2 7 N 2s 2 p 3 8 O 2s 2 p 4 9 F 2s 2 p 5 10 Ne 2s 2 p 6 11 Na 3s 12 Mg 3s 2 13 Al 3s 2 p 14 Si 3s 2 p 2 15 P 3s 2

Dettagli

La struttura delle proteine

La struttura delle proteine La struttura delle proteine Funzioni delle proteine Strutturali Contrattili Trasporto Riserva Ormonali Enzimatiche Protezione Struttura della proteina Struttura secondaria: ripiegamento locale della catena

Dettagli

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto

1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno 5. Legami a confronto Unità n 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

I LEGAMI CHIMICI E LA REGOLA DELL OTTETTO

I LEGAMI CHIMICI E LA REGOLA DELL OTTETTO I LEGAMI CHIMICI E LA REGOLA DELL OTTETTO REGOLA DELL OTTETTO: Tutti gli atomi si legano, cedono, acquistano o condividono elettroni per raggiungere un livello esterno pieno di otto (o due) elettroni.

Dettagli

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia

Capitolo 12 Le forze intermolecolari e gli stati condensati della materia Capitolo 12 Le forze intermolecolari e gli stati condensati della materia 1. Le forze intermolecolari 2. Molecole polari e apolari 3. Le forze dipolo-dipolo e le forze di London 4. Il legame a idrogeno

Dettagli

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä

L'energia media V di interazione fra uno ione avente carica q e un dipolo permanente ad una distanza r Ä Interazioni intermolecolari Interazioni ione-dipolo Interazioni dipolo-dipolo Interazione dipolo permanente-dipolo indotto Interazione dipolo istantaneo-dipolo indotto Forze di Van der Waals Legame idrogeno

Dettagli

Acidi e basi sono sostanze note da molto tempo e diverse classificazioni sono state fatte nel corso del tempo in base alle loro proprietà.

Acidi e basi sono sostanze note da molto tempo e diverse classificazioni sono state fatte nel corso del tempo in base alle loro proprietà. TEORIE ACIDO-BASE Acidi e basi sono sostanze note da molto tempo e diverse classificazioni sono state fatte nel corso del tempo in base alle loro proprietà. Teoria di Arrhenius Arrhenius fu il primo a

Dettagli

Il legame ionico legame ionico

Il legame ionico legame ionico Il legame ionico Il legame ionico è il legame che si realizza quando un atomo d un elemento fortemente elettropositivo (e quindi caratterizzato da bassa energia di ionizzazione) si combina con un atomo

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti

20/10/2015. Importanza dei legami non covalenti in Biologia. Legami covalenti Legami covalenti Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise tra coppie di atomi. La formazione del legame covalente si basa

Dettagli

Il legame chimico ATOMI MOLECOLE

Il legame chimico ATOMI MOLECOLE Il legame chimico Gli atomi tendono a combinarsi con altri atomi per dare un sistema finale più stabile di quello iniziale (a minor contenuto di energia). ATOMI MOLECOLE 1 Stati repulsivi di non legame

Dettagli

LA STRUTTURA DELLE MOLECOLE. Orbitali molecolari e legame chimico

LA STRUTTURA DELLE MOLECOLE. Orbitali molecolari e legame chimico LA STRUTTURA DELLE MOLECOLE Orbitali molecolari e legame chimico GLI ORBITALI MOLECOLARI Quando degli atomi collidono tra di loro i loro nuclei ed elettroni vengono a trovarsi in prossimità influenzandosi

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 13 I legami chimici 3 Sommario (I) 1. L energia di legame 2. I gas nobili e la regola dell ottetto 3. Il legame covalente 4.

Dettagli

Molecole e legami. Chimica generale

Molecole e legami. Chimica generale Molecole e legami Chimica generale Atomi e molecole È estremamente difficile trovare in natura una sostanza formata solamente da atomi semplici Solo i gas inerti dell ottavo gruppo sono presenti in natura

Dettagli

METALLI: bassa energia di ionizzazione bassa affinità elettronica. NON METALLI: elevata energia di ionizzazione elevata affinità elettronica

METALLI: bassa energia di ionizzazione bassa affinità elettronica. NON METALLI: elevata energia di ionizzazione elevata affinità elettronica METALLI: bassa energia di ionizzazione bassa affinità elettronica NON METALLI: elevata energia di ionizzazione elevata affinità elettronica LEGAME CHIMICO La formazione di legami tra atomi per formare

Dettagli

Esploriamo la chimica

Esploriamo la chimica 1 Valitutti, Tifi, Gentile Esploriamo la chimica Seconda edizione di Chimica: molecole in movimento Capitolo 10 Il sistema periodico 1. L energia di legame 2. I gas nobili e le regole dell ottetto 3. Il

Dettagli

ESERCIZI ESERCIZI. il basso d. aumenta lungo un periodo da sinistra verso

ESERCIZI ESERCIZI. il basso d. aumenta lungo un periodo da sinistra verso ESERCIZI 1) L elettronegatività di un elemento: a è l energia che esso libera acquistando un elettrone e trasformandosi in ione negativo b è l energia necessaria per trasformarlo in ione positivo c indica

Dettagli

Macromolecole Biologiche. La struttura secondaria (II)

Macromolecole Biologiche. La struttura secondaria (II) La struttura secondaria (II) Nello stesso anno (1951) in cui proposero l α elica, Pauling e Corey postularono anche l esistenza di un altra struttura secondaria: il foglietto β (β-sheet). Dopo l α elica,

Dettagli

ORBITALI E CARATTERISTICHE CHIMICHE DEGLI ELEMENTI

ORBITALI E CARATTERISTICHE CHIMICHE DEGLI ELEMENTI ORBITALI E CARATTERISTICHE CHIMICHE DEGLI ELEMENTI Nelle reazioni chimiche gli atomi reagenti non cambiano mai la loro natura ( nucleo ) ma la loro configurazione elettronica. Nello specifico ad interagire

Dettagli

Formazione del legame peptidico:

Formazione del legame peptidico: Formazione del legame peptidico: Planare, ha una forza intermedia tra il legame semplice ed il legame doppio. 2^ lezione N R C C O O O + R N R C O C O O N R C C N C C O Ogni piano delle unità peptidiche

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 15 Le forze intermolecolari e gli stati condensati della materia 3 Sommario 1. Le forze intermolecolari 2. Molecole polari e

Dettagli

Legame chimico e proprietà delle sostanze

Legame chimico e proprietà delle sostanze I solidi hanno volume e forma propria. Stati di aggregazione della materia stato solido stato liquido stato gassoso Il loro volume dipende da temperatura e pressione e in generale aumenta leggermente all

Dettagli

Atomi e molecole. Gli atomi degli elementi si trovano in natura generalmente combinati tra loro in molecole o composti ionici

Atomi e molecole. Gli atomi degli elementi si trovano in natura generalmente combinati tra loro in molecole o composti ionici IL LEGAME CHIMICO Atomi e molecole È estremamente difficile trovare in natura una sostanza formata da singoli atomi isolati Solo i gas nobili sono presenti in natura come gas monoatomici Gli atomi degli

Dettagli

ELETTRONEGATIVITA CAPACITA DI UN ATOMO DI ATTIRARE UNA COPPIA DI ELETTRONI DI LEGAME DETERMINANDO COSI IL TIPO DI LEGAME CHE SI VIENE A FORMARE. DERIVA DA ALTRE DUE GRANDEZZE I. Energia di ionizzazione:

Dettagli

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico

gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico gruppo amminico Gli aminoacidi polimerizzano durante la sintesi delle proteine mediante la formazione di legami peptidici. gruppo carbossilico Il legame peptidico si ha quando il gruppo carbossilico (-

Dettagli

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici.

IL GRUPPO EME. PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. IL GRUPPO EME PROTOPORFIRINA IX: struttura organica ad anello costituita da 4 anelli pirrolici uniti da ponti metinici. L inserimento di un atomo di ferro nello stato di ossidazione ferroso (Fe 2+ ) determina

Dettagli

CAPITOLO II. Photonics and Biophotonics Organics Synthesis - PhoBOS. Dept. Materials Science, Univ. Milano-Bicocca

CAPITOLO II. Photonics and Biophotonics Organics Synthesis - PhoBOS. Dept. Materials Science, Univ. Milano-Bicocca CAPITOLO II Introduzione alle forze intermolecolari e ai solidi molecolari. Interazioni deboli in materiali organici (interazioni dipolo-dipolo, ione-dipolo, legame a idrogeno, legame ad alogeno, legame

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri

Composti organici. I composti organici. Atomi e molecole di carbonio. Atomi e molecole di carbonio. Gruppi funzionali. Isomeri I composti organici Atomi e molecole di carbonio Carboidrati Lipidi Proteine Acidi nucleici Composti organici Materiale composto da biomolecole - Formate in buona parte da legami ed anelli di carbonio.

Dettagli

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu

Valitutti, Falasca, Tifi, Gentile. Chimica. concetti e modelli.blu Valitutti, Falasca, Tifi, Gentile Chimica concetti e modelli.blu 2 Capitolo 8 La chimica dell acqua 3 Sommario 1. Come si formano i legami chimici 2. I legami covalenti ionici 3. La molecola dell acqua

Dettagli

CRISTALLOGRAFIA AI RAGGI X E MODELLISTICA MOLECOLARE

CRISTALLOGRAFIA AI RAGGI X E MODELLISTICA MOLECOLARE CRISTALLOGRAFIA AI RAGGI X E MODELLISTICA MOLECOLARE LA STRUTTURA TRIDIMENSIONALE DEGLI ACIDI NUCLEICI, E PIU IN GENERALE DELLE MACROMOLECOLE BIOLOGICHE, PUO ESSERE STUDIATA CON LA METODICA DELLA CRISTALLOGRAFIA

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1)

12/10/2016. Biologia della Cellula Animale Legami covalenti. Importanza dei legami non covalenti in Biologia. Legami covalenti (1) Gli atomi che costituiscono le molecole sono tenuti insieme da legami covalenti in cui coppie di elettroni sono condivise da coppie di atomi. Legami covalenti Importanza dei legami non covalenti in Biologia

Dettagli

Cr Mn Fe Co Ni Cu Zn. Chimica Inorganica Biologica Vita ed Energia

Cr Mn Fe Co Ni Cu Zn. Chimica Inorganica Biologica Vita ed Energia Vita ed Energia I processi chimici alla base della chimica della vita sono due: Uso dell E solare per produrre materia e O 2 da CO 2 e H 2 O Produzione di E mediante ossidazione di materia con formazione

Dettagli

Il Legame Chimico. Prof.ssa Tiziana Bellini

Il Legame Chimico. Prof.ssa Tiziana Bellini Il Legame Chimico Per raggiungere configurazioni elettroniche stabili gli elementi tendono a reagire fra loro formando legami chimici. Configurazione stabile = situazione di minima energia Il legame chimico

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

Come si costruiscono le molecole in natura ed in laboratorio. Giuseppe Macino

Come si costruiscono le molecole in natura ed in laboratorio. Giuseppe Macino Come si costruiscono le molecole in natura ed in laboratorio Giuseppe Macino E Dio creo la luce Cosa tiene insieme tutta la materia che forma la terra? Tutto questo e costituito da ELEMENTI Gli elementi

Dettagli

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura

30/10/2015. Molte proteine sono. intrinsecamente disordinate. o destrutturate (IDP/IUP), cioè non hanno una struttura Molte proteine sono intrinsecamente disordinate o destrutturate (IDP/IUP), cioè non hanno una struttura terziaria e/o secondaria stabile. Le IUP sono caratterizzate da - scarso contenuto in aa apolari,

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

LEGAME COVALENTE. ( Elettronegatività tra gli atomi < 2)

LEGAME COVALENTE. ( Elettronegatività tra gli atomi < 2) LEGAME COVALENTE ( Elettronegatività tra gli atomi < 2) Le sostanze molecolari hanno un tipo di legame che non comporta l acquisto o la cessione di e - ma la condivisione diunacoppiadie - tragliatomi Non

Dettagli

L ACQUA E LE SUE PROPRIETÀ

L ACQUA E LE SUE PROPRIETÀ L ACQUA E LE SUE PROPRIETÀ L acqua è una sostanza indispensabile per tutte le forme di vita. Ogni molecola di acqua (H2O) è formata da due atomi di idrogeno e un atomo di ossigeno, uniti tramite due legami

Dettagli

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti

Le Biomolecole II parte. Lezioni d'autore di Giorgio Benedetti Le Biomolecole II parte Lezioni d'autore di Giorgio Benedetti LA STRUTTURA TERZIARIA DI UNA PROTEINA La struttura tridimensionale adottata da una proteina è detta struttura terziaria. Essa prende in considerazione

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

PROTEINE DEFINIZIONE:

PROTEINE DEFINIZIONE: Cap.4 Le PROTEINE DEFINIZIONE: Macromolecole formate di AA della serie L uniti tra loro da un legame peptidico. FUNZIONI DELLE PROTEINE Enzimi Proteine di riconoscimento Proteine di trasporto Proteine

Dettagli