LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI

Save this PDF as:
 WORD  PNG  TXT  JPG

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "LE PROTEINE: POLIMERI COSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOACIDI"

Transcript

1 LE PROTEINE: POLIMERI OSTITUITI DA 20 TIPI DI MONOMERI, I 20 AMINOAIDI OGNI PROTEINA PUO ESSERE FORMATA DA MOLTE DEINE O ENTINAIA DI AMINOAIDI E SI LEGANO A FORMARE UNA ATENA NON RAMIFIATA La catena di amminoacidi presenta un buon grado di flessibilità GLI AMINOAIDI Parte comune a tutti gli aminoacidi arbonio α Gruppo aminico 2 N R α atena laterale OO Gruppo carbossilico Parte variabile 1

2 In relazione al p dell ambiente, il gruppo OO o il gruppo N 2 possono essere in forma dissociata o indissociata cedendo o accettando protoni + 3 N OO - 2 N R α OO GLIINA IL PIU SEMPLIE DEGLI AMINOAIDI R = 2 N α OO Gly G 2

3 UN AMINOAIDO: IL TRIPTOFANO R può essere un gruppo chimico complesso 2 N α OO Trp W 3

4 AMINOAIDI POLARI AMINOAIDO ATENA LATERALE (R) acido aspartico Asp negativa acido glutammico Glu negativa arginina Arg positiva lisina Lys positiva istidina is positiva Asparagina Asn non carica, polare Glutammina Gln non carica, polare serina Ser non carica, polare treonina Thr non carica, polare tirosina Tyr non carica, polare 4

5 AMINOAIDI NON POLARI AMINOAIDO ATENA LATERALE alanina Ala non polare glicina Gly non polare valina Val non polare leucina Leu non polare Isoleucina Ile non polare prolina Pro non polare Fenilalanina Phe non polare Metionina Met non polare Triptofano Trp non polare cisteina ys non polare 5

6 GLI AMINOAIDI ESSENZIALI ATTENZIONE, ESSENZIALE NON VUOL DIRE AMMINOAIDI PIÙ IMPORTANTI DI ALTRI SI DEFINISONO AMINOAIDI ESSENZIALI QUELLI E UN DATO ORGANISMO NON E IN GRADO DI SINTETIZZARE AUTONOMAMENTE MA E DEVE INTRODURRE ON LA ALIMENTAZIONE PER L UOMO GLI AMINOAIDI ESSENZIALI SONO: TREONINA METIONINA LISINA VALINA LEUINA ISOLEUINA ISTIDINA FENILALANINA TRIPTOFANO PER ALTRE SPEIE L ELENO POTRA ESSERE DIVERSO Gli aminoacidi si uniscono a formare una catena grazie al LEGAME PEPTIDIO N α O + N α O R O R O 2 O N α O N α O R R O 6

7 Struttura primaria di una proteina: è la sequenza degli aminoacidi che la compongono: quanti aminoacidi, quali e un quale ordine. Nota: in questa immagine, che descrive la struttura primaria di una proteina, la sequenza è stata disegnata ripiegata soltanto per motivi di spazio. La struttura primaria non descrive i ripiegamenti della catena polipeptidica. 7

8 Quanti tipi di proteine in un organismo? In un essere umano alcune decine di migliaia, ciascuna con una sua specifica sequenza di amminoacidi e una sua specifica funzione Nella stessa specie la maggior parte delle proteine può esistere in più di una variante, in genere con funzione identica o simile ma con piccole differenze nella sequenza di amminoacidi. Le differenze nella sequenza di amminoacidi sono conseguenza di mutazioni avvenute nel DNA In specie diverse possono esistere proteine con funzioni identiche o simili e con differenze nella sequenza di amminoacidi proporzionali alla distanza evolutiva Nella figura la lunghezza dei segmenti è proporzionale alle differenze 8

9 MetAspLeuTyrGlyGlyPheysProTrp.. SI DEFINISE STRUTTURA PRIMARIA DI UNA PROTEINA LA SUA SEQUENZA IN AMINOAIDI La catena polipeptidica si ripiega per assumere la sua conformazione tridimensionale grazie alla sua flessibilita e in seguito alle interazioni degli aminoacidi tra di loro e con l ambiente circostante Questi ripiegamenti vengono descritti da ciò che si definisce struttura secondaria e terziaria di una proteina (o eventualmente quaternaria per le proteine formate da più subunità) Il ripiegamento (FOLDING) delle proteine è dovuto alle interazioni degli aminoacidi tra di loro e con l ambiente 9

10 Piano β 10

11 Alcune proteine multimeriche possono essere costituite dai copie multiple di una stessa subunità o di subunità diverse NELLA SUA STRUTTURA TERZIARIA (O QUATERNARIA), UNA PROTEINA SI PRESENTA OME UN OGGETTO DI FORMA OMPLESSA, E POTRÀ PRESENTARE SOLI E AVITÀ ED E RIOPERTA DI GRUPPI IMII APAI DI FORMARE LEGAMI DEBOLI ON ALTRE MOLEOLE PERE UNA PROTEINA POSSA LEGARSI ON UN ALTRA MOLEOLA (LIGANDO), DOVRA ESISTERE UNA OMPLEMENTARIETA DI FORMA E DI APAITA DI FORMARE LEGAMI IL LEGAME SARA TANTO PIU STABILE QUANTO MAGGIORE E IL NUMERO DI INTERAZIONI SIMULTANEE 11

12 Pochi legami: la agitazione termica facilmente determina il distacco Molti legami: la agitazione termica difficilmente determina il distacco La precisione della complementarietà, e soprattutto il numero di legami non covalenti che si possono formare, determina la maggiore o minore affinità tra due molecole e la stabilità del legame, che è comunque sempre reversibile. Le stesse forze che determinano il ripiegamento delle proteine determinano anche le interazioni tra una proteina ed altre molecole, come ad esempio tra un enzima e il suo substrato o tra un recettore ed il suo ligando 12

13 MOLTE ARATTERISTIE FUNZIONALI DI UNA PROTEINA DIPENDONO DALLA SUA APAITA DI INTERAGIRE ON ALTRE MOLEOLE LEGANDOLE QUESTE INTERAZIONI RIIEDONO UN RIONOSIMENTO REIPROO, LEGATO ALLA FORMA DELLE MOLEOLE ED ALLE APAITA DI FORMARE LEGAMI LIGANDO Perchè una proteina possa interagire correttamente con il suo ligando è necessario che il suo ripiegamento sia avvenuto correttamente 13

14 LA STRUTTURA TRIDIMENSIONALE DI UNA PROTEINA NON E RIGIDA, MA DINAMIA IL AMBIAMENTO DELLE ONDIZIONI AMBIENTALI O L INTERAZIONE ON ALTRE MOLEOLE POTRA MODIFIARE REVERSIBILMENTE LA ONFORMAZIONE DELLA PROTEINA Ricordiamo infatti che quando una proteina si lega con un altra molecola (proteica o meno), viene a contatto con gruppi chimici che potranno essere carichi positivamente o negativamente, polari o non polari. Questa nuova situazione potrà modificare reversibilmente il ripiegamento della proteina 14

15 15

16 ome si ripiegano le proteine. Il ripiegamento delle proteine è dovuto alle proprietà dei suoi amminoacidi, quindi è una conseguenza della struttura primaria e delle sue interazioni con l ambiente. Alcune proteine, se artificialmente svolte (denaturate), si ripiegano correttamente in modo spontaneo Ripiegamenti non corretti contagiosi possono essere causa di malattie: il caso dei prioni (la mucca pazza ) 16

17 Una proteina prionica ripiegata in modo anomalo induce il ripiegamento anomalo di altri esemplari 17

MACROMOLECOLE. Polimeri (lipidi a parte)

MACROMOLECOLE. Polimeri (lipidi a parte) MACROMOLECOLE Monomeri Polimeri (lipidi a parte) Le caratteristiche strutturali e funzionali di una cellula o di un organismo sono determinate principalmente dalle sue proteine. Ad esempio: Le proteine

Dettagli

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento

Proteine strutturali Sostegno meccanico Cheratina: costituisce i capelli Collagene: costituisce le cartilagini Proteine di immagazzinamento Tipo Funzione Esempi Enzimi Accelerano le reazioni chimiche Saccarasi: posiziona il saccarosio in modo che possa essere scisso nelle due unità di glucosio e fruttosio che lo formano Ormoni Messaggeri chimici

Dettagli

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente

amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente Gli amminoacidi naturali sono α-amminoacidi : il gruppo amminico è legato all atomo di carbonio immediatamente adiacente al gruppo carbonilico e hanno la seguente formula generale: gruppo funzionale carbossilico

Dettagli

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà)

α-amminoacidi O α O α R CH C O - NH 3 forma ionizzata sale interno (zwitterione) OH NH 2 forma non ionizzata (non esistente in realtà) Amminoacidi 2 forma non ionizzata (non esistente in realtà) 3 forma ionizzata sale interno (zwitterione) In soluzione acquosa c'è equilibrio tra tre forme 3 forma cationica p molto acidi 3 forma zwitterionica

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

Struttura degli amminoacidi

Struttura degli amminoacidi AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE AMMINOACIDI, PEPTIDI E PROTEINE Le proteine sono macromolecole costituite dall unione di un grande numero di unità elementari: gli amminoacidi

Dettagli

Struttura delle Proteine

Struttura delle Proteine Chimica Biologica A.A. 2010-2011 Struttura delle Proteine Marco Nardini Dipartimento di Scienze Biomolecolari e Biotecnologie Università di Milano Macromolecole Biologiche Struttura Proteine Proteine:

Dettagli

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà

AMINOACIDI Struttura. Funzione. Classificazione. Proprietà AMINOACIDI Struttura Funzione Classificazione Proprietà 1 STRUTTURA Composti caratterizzati dalla presenza di un gruppo aminico (NH 2 ) e di un gruppo acido (COOH) legati al medesimo carbonio (C). In soluzione

Dettagli

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine

Vittoria Patti MACROMOLECOLE BIOLOGICHE. 4. proteine Vittoria Patti MACROMOLECOLE BIOLOGICHE 4. proteine 1 Funzioni principali delle proteine funzione cosa significa esempi ENZIMATICA STRUTTURALE TRASPORTO MOVIMENTO DIFESA IMMUNITARIA ORMONALE catalizzare

Dettagli

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune

sono le unità monomeriche che costituiscono le proteine hanno tutti una struttura comune AMINO ACIDI sono le unità monomeriche che costituiscono le proteine sono 20 hanno tutti una struttura comune sono asimmetrici La carica di un amino acido dipende dal ph Classificazione amino acidi Glicina

Dettagli

PROTIDI: LE PROTEINE E GLI AMMINOACIDI

PROTIDI: LE PROTEINE E GLI AMMINOACIDI PROTIDI: LE PROTEINE E GLI AMMINOACIDI GLI AMMINOACIDI Struttura generica di un amminoacido. R rappresenta un gruppo laterale specifico di ogni amminoacido. In chimica, gli amminoacidi (impropriamente

Dettagli

Amminoacidi. Struttura base di un a-amminoacido

Amminoacidi. Struttura base di un a-amminoacido Amminoacidi Struttura base di un a-amminoacido Forma non ionizzata Forma ionizzata, sale interno (zwitterione) Il carbonio α di tutti gli α-amminoacidi (tranne la glicina) è asimmetrico (=chirale) D-alanina

Dettagli

AMINOACIDI - 1 AMINOACIDI - 2

AMINOACIDI - 1 AMINOACIDI - 2 AMINOAIDI - 1 Proteine (gr. pròtos = primo) 50-80% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida o alcalina α-aminoacidi proteasi Struttura generale degli α-aminoacidi primari

Dettagli

REPLICAZIONE DEL DNA

REPLICAZIONE DEL DNA REPLICAZIONE DEL DNA La replicazione (o anche duplicazione) è il meccanismo molecolare attraverso cui il DNA produce una copia di sé stesso. Ogni volta che una cellula si divide, infatti, l'intero genoma

Dettagli

moli OH - /mole amminoacido

moli OH - /mole amminoacido ) ) Di seguito è riportata la curva di titolazione di un amminoacido. Osservando il grafico: a) stabilire il valore dei pka dell aminoacido b) calcolare il valore del pi e individuarlo sul grafico. c)

Dettagli

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali):

AMINOACIDI. GENE PROTEINA EFFETTO. calore. idrolisi acida (o alcalina) Struttura generale degli α-aminoacidi primari (standard, normali): AMINOAIDI. Proteine (gr. pròtos = primo) > 50% peso secco cellulare GENE POTEINA EFFETTO proteine calore idrolisi acida (o alcalina) α-aminoacidi Struttura generale degli α-aminoacidi primari (standard,

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( OO) nella stessa molecola 3 N 2 α * OO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-himica Organica 1 Amminoacidi

Dettagli

Percorsi di chimica organica - Soluzioni degli esercizi del testo

Percorsi di chimica organica - Soluzioni degli esercizi del testo ercorsi di chimica organica - Soluzioni degli esercizi del testo AITL 14 1. Il prefisso α negli α-amminoacidi sta ad indicare che il gruppo amminico, - 2, si trova sul carbonio alfa (carbonio legato al

Dettagli

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO

LE PROTEINE. SONO Polimeri formati dall unione di AMMINOACIDI (AA) Rende diversi i 20 AA l uno dall altro UN ATOMO DI C AL CENTRO LE PROTEINE SONO Polimeri formati dall unione di ATOMI DI C, H, N, O CHE SONO AMMINOACIDI (AA) Uniti tra loro dal Legame peptidico 20 TIPI DIVERSI MA HANNO STESSA STRUTTURA GENERALE CON Catene peptidiche

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE Vengono chiamate amminoacidi quelle molecole organiche in cui sono contemporaneamente presenti sia un gruppo acido carbossilico -COO che un gruppo amminico -N2. Una molecola appartenente

Dettagli

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria Corso di Laurea Magistrale in Ingegneria Biomedica Complementi di Chimica e Biochimica per le Tecnologie Biomediche Amminoacidi e proteine Dagli amminoacidi come building-blocks alla struttura quaternaria

Dettagli

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi

PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi POTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (,, O, N) macromolecole organiche, molecole informazionali, polimeri

Dettagli

E. Giordano 16/09/2010

E. Giordano 16/09/2010 GRUPPO NAZIONALE DI BIOINGEGNERIA XXIX Scuola Annuale BIOLOGIA SINTETICA Bressanone 13-17 settembre 2010 1/41 COSTITUENTI MOLECOLARI DELLO CHASSIS CELLULARE Emanuele GIORDANO II Facoltà di Ingegneria Dipartimento

Dettagli

Le proteine. Polimeri composto da 20 diversi aminoacidi

Le proteine. Polimeri composto da 20 diversi aminoacidi Le proteine Polimeri composto da 20 diversi aminoacidi (D. Voet, J.G. Voet, Biochemistry, 3 ed., John Wiley & Sons, 2004) PROTEINE come ATTUATORI nella cellula Trasporto elettronico Trasporto di ioni e

Dettagli

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche

CHIMICA BIOLOGICA. Seconda Università degli Studi di Napoli. DiSTABiF. Antimo Di Maro. Lezione 3. Corso di Laurea in Scienze Biologiche Seconda Università degli Studi di Napoli DiSTABiF Corso di Laurea in Scienze Biologiche Insegnamento di CHIMICA BIOLOGICA Antimo Di Maro Anno Accademico 2016-2017 Lezione 3 GLI AMMINOACIDI PROTEICI Le

Dettagli

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel.

Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, Padova. Tel. Prof. Fulvio Ursini Dipartimento di Chimica Biologica (Vallisneri IV piano Nord) Viale G. Colombo, 3-35121 Padova. Tel.:+39-049-8276104 Fax.:+39-049-8073310 E-mail: fulvio.ursini@unipd.it Funzioni delle

Dettagli

BIOMOLECOLE (PROTEINE)

BIOMOLECOLE (PROTEINE) BIOMOLECOLE (PROTEINE) Proteine: funzioni Strutturale (muscoli, scheletro, legamenti ) Contrattile (actina e miosina) Di riserva (ovoalbumina) Di difesa (anticorpi) Di trasporto (emoglobina, di membrana)

Dettagli

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche:

LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: LEZIONE n 1 LE MACROMOLECOLE BIOLOGICHE Le cellule contengono 4 famiglie principali di molecole organiche: macromolecole Macromolecole macromolecole I componenti chimici di una cellula -Le macromolecole

Dettagli

20/12/ tipi di amino acidi: parecchie combinazioni

20/12/ tipi di amino acidi: parecchie combinazioni 20 tipi di amino acidi: parecchie combinazioni Le proteine sono polimeri di amino acidi 1 SEMPLICI : costituite solo da amino acidi PROTEINE CONIUGATE Apoproteina = parte proteica Gruppo prostetico = parte

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH. ) ed un gruppo carbossilico ( COOH) nella stessa molecola Amminoacidi (1) Presentano un gruppo amminico ( NH 2 ) ed un gruppo carbossilico ( COOH) nella stessa molecola CH 3 NH 2 C H α * COOH Acido 2-ammino propanoico (acido α-ammino propionico) 1 Amminoacidi

Dettagli

Schemi delle lezioni 1

Schemi delle lezioni 1 Schemi delle lezioni 1 Detti anche proteine sono i composti organici maggiormente presenti nelle cellule, dato che costituiscono circa il 50% del loro peso secco. Nell uomo adulto rappresentano circa

Dettagli

SOLUZIONI DEGLI ESERCIZI

SOLUZIONI DEGLI ESERCIZI Niccolò Taddei - Biochimica apitolo 3 GLI AMMINAOIDI E LE PROTEINE DEGLI ESERIZI 1 Le proteine costituiscono una grande famiglia di biomolecole molto diffuse in natura; sono costituite da unità strutturali

Dettagli

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico.

Le proteine. Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Le proteine Sono polimeri di amminoacidi dispos$ in sequenza. Due amminoacidi si legano tra loro formando un legame pep-dico. Cur$s et al. Invito alla biologia.blu Zanichelli editore 2011 1 Struttura e

Dettagli

Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina

Sequenze nucleotidiche del DNA definite loci costituiscono i geni. Ogni gene codifica per una specifica proteina sintesi proteica La sintesi proteica è il processo che porta alla formazione delle proteine da sequenze del DN definite geni. Si tratta di un processo a più fasi Nelle sue linee fondamentali questo processo

Dettagli

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4).

9) Scrivere un disaccaride formato dal β-d-galattosio e dall α-d-n-acetil-glucosammina legati da un legame glicosidico β(1-4). CARBOIDRATI - AMMINOACIDI - PROTEINE 1) Scrivere la proiezione di Fisher del D-ribosio e del D-glucosio. La lettera D a cosa si riferisce? Disegnare inoltre il disaccaride ottenuto dalla condensazione

Dettagli

Struttura degli Amminoacidi

Struttura degli Amminoacidi Amminoacidi Struttura degli Amminoacidi Amminoacido (o α-amminoacido): molecola che possiede un gruppo amminico primario (-NH 2 ) come sostituente dell atomo di carbonio α, e un gruppo carbossilico acido

Dettagli

Nome e cognome: [Totale: 80 punti]

Nome e cognome: [Totale: 80 punti] Nome e cognome: ruppo / candidato No. SIENZE SPERIMENTLI: BIOLOI [Totale: 80 punti] Raccomandazioni: Rispondere direttamente sui fogli Non separare i fogli Rispondere in modo sintetico e chiaro, usando

Dettagli

Metabolismo degli amminoacidi

Metabolismo degli amminoacidi Metabolismo degli amminoacidi Bilancio azotato Differenza fra l azoto introdotto e quello eliminato Positivo (gravidanza) Negativo In equilibrio ghiandole salivari bocca amilasi gastrina l (p 1) pepsinogeno

Dettagli

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica

I gruppi R differenziano i 20 amminoacidi standard. Tratto da D. Voet, G. Voet e C.W. Pratt Fondamenti di biochimica Gli aminoacidi NOMENCLATURA Aminoacido Abbr. tre lettere Abbr. una lettera Aminoacido Abbr. tre lettere Abbr. una lettera Alanina ALA A Lisina LYS K Arginina ARG R Metionina MET M Asparagina ASN N Fenilalanina

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare quattro legami covalenti. Questi

Dettagli

Caratteristiche generali

Caratteristiche generali AMMINOACIDI Gli amminoacidi sono le unità costruttive (building blocks) delle proteine. Come dice il termine, gli amminoacidi naturali sono costituiti da un gruppo amminico (-NH 2 ) e da un gruppo carbossilico

Dettagli

Capitolo 3 Le biomolecole

Capitolo 3 Le biomolecole apitolo 3 Le biomolecole opyright 2006 Zanichelli editore I composti organici e i loro polimeri 3.1 La diversità molecolare della vita è basata sulle proprietà del carbonio Un atomo di carbonio può formare

Dettagli

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa.

La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. La chimica della vita si basa sui composti del carbonio e dipende da reazioni chimiche che avvengono in soluzione acquosa. Le cellule contengono 4 famiglie principali di piccole molecole organiche: Amminoacidi

Dettagli

Biochimica. studio della vita a livello molecolare

Biochimica. studio della vita a livello molecolare Biochimica studio della vita a livello molecolare studio della composizione molecolare dei sistemi viventi studio delle reazioni chimiche cui vanno incontro i sistemi viventi ALCUNI QUESITI DELLA BIOCHIMICA

Dettagli

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH

Amminoacidi (1) Acido 2-ammino propanoico (acido α-ammino propionico) α * NH 2 CH 3 COOH Amminoacidi (1) Presentano un gruppo amminico ( N 2 ) ed un gruppo carbossilico ( COO) nella stessa molecola C 3 N 2 C α * COO Acido 2-ammino propanoico (acido α-ammino propionico) STPA-Chimica Organica

Dettagli

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA

PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE: STRUTTURA, ESEMPI E FUNZIONAMENTO TUTORATO 1 GIULIANO F. PATANÈ COLLEGIO A. VOLTA PROTEINE Una proteina è basilarmente una catena polipeptidica (che in termini chimici può anche essere definita

Dettagli

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione

Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi. Possono assumere forme diverse a seconda della funzione Le proteine sono polimeri lineari costituiti da unità base formate da oltre 40 amminoacidi Hanno elevato PM Possono assumere forme diverse a seconda della funzione svolgono molteplici funzioni Tra le proteine

Dettagli

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo

LE PROTEINE SINTESI PROTEICA. funzione delle proteine nel nostro organismo LE PTEIE Le proteine sono sostanze organiche presenti in tutte le cellule di tutti gli organismi viventi Le proteine sono costituite da,,,, (S) Struttura delle proteine Le proteine sono macromolecole (

Dettagli

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni

lezione Prof. Spina miliardi di anni fa l universo comparve sotto forma di eruzioni Biochimica Matricole dispari 1 1^ lezione Prof. Spina LA BIOCHIMICA 15 20 miliardi di anni fa l universo comparve sotto forma di eruzioni d l f d inimmaginabili di particele subatomiche ricche di energia

Dettagli

Nome e cognome: [Totale: 80 punti]

Nome e cognome: [Totale: 80 punti] Nome e cognome: ruppo / candidato No. SIENZE SPERIMENTLI: BIOLOI [Totale: 80 punti] Raccomandazioni: Rispondere direttamente sui fogli Non separare i fogli Rispondere in modo sintetico e chiaro, usando

Dettagli

Proteine: struttura e funzione

Proteine: struttura e funzione Proteine: struttura e funzione Prof.ssa Flavia Frabetti PROTEINE dal greco al 1 posto costituiscono il 50% circa del peso secco della maggior parte degli organismi viventi composti quaternari (C, H, O,

Dettagli

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure

3.3.2. ALIMENTI DI ORIGINE VEGETALE. 3.3.2.1. Verdure 3.3.2. ALIMENTI DI ORIGINE VEGETALE 3.3.2.1. Verdure Nella Tabella 9 sono riportati i valori degli aminoacidi liberi presenti in alcune fra le più diffuse verdure in commercio. In un passato recente era

Dettagli

Biochimica. studio della vita a livello molecolare

Biochimica. studio della vita a livello molecolare Biochimica studio della vita a livello molecolare studio della composizione molecolare dei sistemi viventi studio delle reazioni chimiche cui vanno incontro i sistemi viventi ALCUNI QUESITI DELLA BIOCHIMICA

Dettagli

ammoniaca ammina primaria ammina terziaria ammina secondaria R N H 2

ammoniaca ammina primaria ammina terziaria ammina secondaria R N H 2 gruppo funzionale amminico N ammoniaca R N R N R R N R R ammina primaria ammina secondaria ammina terziaria R N 2 Le ammine, come l ammoniaca, hanno carattere basico ed in soluzione acquosa accettano un

Dettagli

Università Telematica Pegaso. Indice

Università Telematica Pegaso. Indice LE PROTEINE PROF.SSA AUSILIA ELCE Indice 1 INTRODUZIONE -------------------------------------------------------------------------------------------------------------- 3 2 TRASCRIZIONE--------------------------------------------------------------------------------------------------------------

Dettagli

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE:

LEZIONE 2 COMPOSTI DEL CARBONIO: MACROMOLECOLE: LEZIONE 2 COMPONENTI CHIMICI DELLA CELLULA ACQUA COMPOSTI DEL CARBONIO: MACROMOLECOLE: ZUCCHERI ACIDI GRASSI PROTEINE NUCLEOTIDI percentuale di abbondanza relativa I componenti chimici di una cellula organismi

Dettagli

Compartime nto aminoacidi. 0,08 g (0,06 g) 0,36 g (0,32 g)

Compartime nto aminoacidi. 0,08 g (0,06 g) 0,36 g (0,32 g) G10% SENZA POTASSIO soluzione per infusione Principi attivi Compartime nto Compartime nto pronta all uso 125 ml 125 ml 250 ml 1000 ml Alanina 0,36 g 0,36 g 1,44 g Arginina 0,24 g 0,24 g 0,96 g Acido aspartico

Dettagli

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI

BIOCHIMICA e BIOTECNOLOGIE degli ALIMENTI Seconda Università degli Studi di Napoli DiSTABiF Anno Accademico 2016-17 Corso di Laurea Magistrale in SCIENZE DEGLI ALIMENTI E DELLA NUTRIZIONE UMANA Insegnamento di BIOCHIMICA e BIOTECNOLOGIE degli

Dettagli

AMMINOACIDI E PROTEINE

AMMINOACIDI E PROTEINE AMMINOACIDI E PROTEINE 1 AMMINOACIDI Gli amminoacidi sono composti organici composti da atomi di carbonio, idrogeno, ossigeno e azoto e in alcuni casi anche da altri elementi come lo zolfo. Gli amminoacidi

Dettagli

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA

le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. STRUTTURA TERZIARIA STRUTTURA TERZIARIA le porzioni con strutture secondarie sono avvicinate e impaccate mediante anse e curve della catena. Le proteine globulari dopo aver organizzato il proprio scheletro polipeptidico con

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

Nutrizione umana. Prof. Edgardo Canducci aa 2017/18

Nutrizione umana. Prof. Edgardo Canducci aa 2017/18 Nutrizione umana Prof. Edgardo Canducci aa 2017/18 1 Le proteine aa 2017/18 2 Proteine. Generalità Le proteine (dal greco protos) sono i costituenti principali della materia vivente. Le proteine sono molecole

Dettagli

Nutrizione umana. Prof. Edgardo Canducci aa 2018/19

Nutrizione umana. Prof. Edgardo Canducci aa 2018/19 Nutrizione umana Prof. Edgardo Canducci aa 2018/19 1 Le proteine aa 2018/19 2 Proteine. Generalità Le proteine (dal greco protos) sono i costituenti principali della materia vivente. Le proteine sono molecole

Dettagli

Visualizzazioni 3D. Informatica. Matrice di voxel. Tipi di dato. Dati vettoriali. Tecniche di rappresentazione

Visualizzazioni 3D. Informatica. Matrice di voxel. Tipi di dato. Dati vettoriali. Tecniche di rappresentazione Informatica Lezione VIII Visualizzazione 3D di proteine Visualizzazioni 3D Rappresentazione di strutture/oggetti tridimensionali Risultato di un esperimento modello teorico dati fisici astrazione 1 Lezione

Dettagli

Le macromolecole dei tessuti - 1

Le macromolecole dei tessuti - 1 Le macromolecole dei tessuti - 1 Che cosa sono le proteine? Sono macromolecole complesse ad alta informazione Sono costituite da una o più catene polipeptidiche Ogni catena peptidica è composta da centinaia

Dettagli

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata

2011 - G. Licini, Università di Padova. La riproduzione a fini commerciali è vietata Ammino acidi Composto che contiene una funziome acida e amminica. Usualmente però con amminoacidi si intendono gli alfa- amminoacidi. Tra questi composti ve ne sono 20 che vengono definiti geneticamente

Dettagli

Chimica Biologica A.A α-elica foglietto β reverse turn

Chimica Biologica A.A α-elica foglietto β reverse turn Chimica Biologica A.A. 2010-2011 α-elica foglietto β reverse turn Str. Secondaria sperimentalmente osservata: Si distinguono fondamentalmente tre tipi di strutture secondarie: α elica foglietto β reverse

Dettagli

Macromolecole Biologiche. La struttura secondaria (III)

Macromolecole Biologiche. La struttura secondaria (III) La struttura secondaria (III) Reverse turn Le proteine globulari hanno una forma compatta, dovuta a numerose inversioni della direzione della catena polipeptidica che le compone. Molte di queste inversioni

Dettagli

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi

scaricato da www.sunhope.it Proteine semplici costituite dai soli amminoacidi Proteine semplici costituite dai soli amminoacidi Proteine coniugate costituite dagli amminoacidi + porzioni di natura non amminoacidica dette GRUPPI PROSTETICI Le Proteine coniugate prive del gruppo prostetico

Dettagli

3.3. UMAMI NEGLI ALIMENTI

3.3. UMAMI NEGLI ALIMENTI 3.3. UMAMI NEGLI ALIMENTI In questo capitolo saranno esaminati i vari cibi, ad esclusione di quelli ittici che verranno presi in considerazione successivamente, allo scopo di scoprire se in essi è presente,

Dettagli

Struttura delle proteine

Struttura delle proteine Struttura delle proteine I II III Copyright 2001-2018 by Giorgio Sartor. All rights reserved. Versione 1.3 24/09/2018 15:58 Proteine Biomolecole, macromolecole Più del 50% del peso secco di una cellula

Dettagli

STRUTTURAZIONE DELLE PROTEINE

STRUTTURAZIONE DELLE PROTEINE STRUTTURAZIONE DELLE PROTEINE Molti diversi tipi di struttura non avvolta (unfolded states) Un solo tipo di struttura avvolta (folded state) Proteina NATIVA Principi della strutturazione proteica: 1) La

Dettagli

LA STRUTTURA DELLE PROTEINE È GERARCHICA

LA STRUTTURA DELLE PROTEINE È GERARCHICA LA STRUTTURA DELLE PROTEINE È GERARCHICA LA STRUTTURA DETERMINA LA FUNZIONE The Protein Folding Problem Cosa determina la struttura? Energia Cinetica Come si determina la struttura? Metodi Sperimentali

Dettagli

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE

COMPOSTI AZOTATI. derivanti dall ammoniaca AMMINE. desinenza -INA AMMIDE COMPOSTI AZOTATI derivanti dall ammoniaca AMMINE desinenza -INA AMMIDE ANCORA AMMIDI RISONANZA A M M I D I Il legame ammidico ha parziale carattere di doppio legame per la seguente risonanza: Ammidi H

Dettagli

Struttura secondaria

Struttura secondaria Struttura secondaria Struttura localmente ordinata Polimeri lineari ad unità monomeriche asimmetriche elica j = 0,1,2,..., N N = numero di residui z j = h z j + z 0 x j = r cos (j2p h z /P + d 0 ) y j

Dettagli

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita

MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine. Solo per uso didattico, vietata la riproduzione, la diffusione o la vendita MFN0366-A1 (I. Perroteau) -traduzione e indirizzamento delle proteine MFN0366-A1 (I. Perroteau) -traduzione delle proteine trna Traduzione: mrna -------> proteine mrna MFN0366-A1 (I. Perroteau) -traduzione

Dettagli

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia

a) un movimento contro gradiente di concentrazione che utilizza fonti primarie di energia 1. Quale considerazione sulla struttura primaria di una proteina è vera? a) è caratteristica delle proteine insolubili b) i ponti S-S la stabilizzano c) i ponti H la stabilizzano d) la proteina assume

Dettagli

Aminoacidi. Struttura generale Sono 20 e formano le

Aminoacidi. Struttura generale Sono 20 e formano le Aminoacidi Struttura generale Sono 20 e formano le proteine. Oltre a questi ne esistono altri meno comuni Alcuni subiscono modificazioni dopo essere stati inseriti nelle proteine Altri stanno nell organismo

Dettagli

4.2. PRESENZA DI UMAMI NEGLI ALIMENTI ITTICI E DERIVATI

4.2. PRESENZA DI UMAMI NEGLI ALIMENTI ITTICI E DERIVATI 4.2. PRESENZA DI UMAMI NEGLI ALIMENTI ITTICI E DERIVATI 4.2.1. PESCI, MOLLUSCHI E CROSTACEI Per la compilazione di questa parte, sono affiorati numerosi problemi di natura bibliografica che dimostrano

Dettagli

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa

Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa Gli amminoacidi Le proteine rappresentano gli elementi strutturali e funzionali più importanti nei sistemi viventi. Qualsiasi processo vitale dipende da questa classe di molecole: p. es. la catalisi delle

Dettagli

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5

Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA. Angela Chambery Lezione 5 Corso di Laurea in Farmacia Insegnamento di CHIMICA BIOLOGICA Angela Chambery Lezione 5 Il legame peptidico Concetti chiave: In un polipeptide gli amminoacidi sono uniti dai legami peptidici. Il legame

Dettagli

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE?

DNA E PROTEINE IL DNA E RACCHIUSO NEL NUCLEO, MENTRE LA SINTESI PROTEICA SI SVOLGE NEL CITOPLASMA: COME VIENE TRASPORTATA L INFORMAZIONE? DNA E PROTEINE NUMEROSI DATI SUGGERISCONO CHE IL DNA SVOLGA IL SUO RUOLO GENETICO CONTROLLANDO LA SINTESI DELLE PROTEINE, IN PARTICOLARE DETERMINANDONE LA SEQUENZA IN AMINOACIDI E NECESSARIO RISPONDERE

Dettagli

06_citologia_SER_golgi 1

06_citologia_SER_golgi 1 1 La sintesi proteica inizia sempre nello stesso modo: aggancio della piccola subunità ribosomale al estremità 5 dell mrna. si aggancio la grande subunità ribosomale In corrispondenza del codone di inizio

Dettagli

Formula generale di un amminoacido

Formula generale di un amminoacido Formula generale di un amminoacido Gruppo carbossilico Gruppo amminico Radicale variabile che caratterizza i singoli amminoacidi Le catene laterali R degli amminoacidi di distinguono in: Apolari o idrofobiche

Dettagli

Formazione. di un peptide.

Formazione. di un peptide. Formazione. di un peptide. Quando due aminoacidi si uniscono si forma un legame peptidico. In questo caso il dipeptide glicilalanina (Gly-Ala) viene mostrato come se si stesse formando in seguito a eliminazione

Dettagli

Parametri dell α-elica. residui/giro 3.6. passo dell elica

Parametri dell α-elica. residui/giro 3.6. passo dell elica GRAFICO DI RAMACHANDRAN Parametri dell α-elica residui/giro 3.6 spazio/residuo passo dell elica 1.5 Å 5.4 Å 1 L α-elica può essere destabilizzata da interazioni tra i gruppi R: repulsione/attrazione elettrostatica

Dettagli

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE

FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE FUNZIONE DELLE PROTEINE RAPPORTO STRUTTURA-FUNZIONE Principi basilari: 1.Le funzioni di molte proteine richiedono il legame reversibile con altre molecole (LIGANDO) Un ligando può essere di natura diversa,

Dettagli

Acqua: peso molecolare = 18 In un bicchiere circa ml, quindi 10 moli una mole 6x10 23 molecole, quindi in un bicchiere 6x10 24 molecole

Acqua: peso molecolare = 18 In un bicchiere circa ml, quindi 10 moli una mole 6x10 23 molecole, quindi in un bicchiere 6x10 24 molecole Acqua: peso molecolare = 18 In un bicchiere circa 180-200 ml, quindi 10 moli una mole 6x10 23 molecole, quindi in un bicchiere 6x10 24 molecole Volume degli oceani 1.3 miliardi di km 3 = 1.3 x 10 18 m

Dettagli

STRUTTURA E FUNZIONE DELLE PROTEINE

STRUTTURA E FUNZIONE DELLE PROTEINE STRUTTURA E FUNZIONE DELLE PROTEINE PROTEINE 50% DEL PESO SECCO DI UNA CELLULA STRUTTURA intelaiatura citoscheletrica strutture cellulari impalcatura di sostegno extracellulare FUNZIONE catalisi enzimatica

Dettagli

ARPAT Agenzia regionale per la protezione ambientale della Toscana

ARPAT Agenzia regionale per la protezione ambientale della Toscana ARPAT Agenzia regionale per la protezione ambientale della Toscana Dipartimento Provinciale di Livorno 114, Via Giovanni Marradi - 57126 LIVORNO Tel. 0586/263411 - Fax 0586/263477 E-mail: f.righini@arpat.toscana.it

Dettagli

Alimentazione. Ostetrica Paola Agnese Mauri

Alimentazione. Ostetrica Paola Agnese Mauri Alimentazione materna Ostetrica Paola Agnese Mauri Per alimentarsi correttamente mettiamoci la testa! Dieta in allattamento dopo gravidanza fisiologica Gli attori della scena Il lattante Il fruitore Il

Dettagli

scaricato da I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE

scaricato da  I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE Legame peptidico I peptidi risultano dall unione di due o più aminoacidi mediante un legame COVALENTE tra il gruppo amminico di un aminoacido ed il gruppo carbossilico di un altro. 1 Catene contenenti

Dettagli

Carboidra8, lipidi, aminoacidi e nucleo8di.

Carboidra8, lipidi, aminoacidi e nucleo8di. Elemen8 più abbondan8 nei organismi vivi: ossigeno (O), carbonio (C), idrogeno (H), azoto (N), zolfo (S), fosforo (P). Se l acqua è il medio per la vita, il carbonio è lo scheletro per la materia organica,

Dettagli

Macromolecole Biologiche. La struttura secondaria (I)

Macromolecole Biologiche. La struttura secondaria (I) La struttura secondaria (I) La struttura secondaria Struttura primaria PRPLVALLDGRDETVEMPILKDVATVAFCDAQSTQEIHE Struttura secondaria La struttura secondaria Le strutture secondarie sono disposizioni regolari

Dettagli

Amminoacidi Peptidi Proteine

Amminoacidi Peptidi Proteine Amminoacidi Peptidi Proteine Amminoacidi-Peptidi-Proteine Amminoacidi: Struttura generale COOH H NH 2 Centro chiralico Stereoisomeri: composti con la stessa connessione tra gli atomi, ma con una differente

Dettagli

COOH. Sono tutti α-amminoacidi possiedono un gruppo amminico e un carbossilico entrambi legati allo stesso atomo di carbonio (il carbonio α)

COOH. Sono tutti α-amminoacidi possiedono un gruppo amminico e un carbossilico entrambi legati allo stesso atomo di carbonio (il carbonio α) AMMINOACIDI Gi amminoacidi comuni o standard che tutti gi organismi viventi utiizzano per assembaggio dee PROTEINE sono 20 e sono codificati da codice genetico. Sono tutti α-amminoacidi possiedono un gruppo

Dettagli

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi

POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi POLITECNICO DI BARI Corso di Laurea Magistrale in Ingegneria Elettronica BIOINFORMATICA DNA COMPUTING Docente Prof. Giuseppe Mastronardi Sommario Introduzione Cenni di biologia Modello di Adleman Modello

Dettagli

4x4x4=4 3 =64 codoni. 20 aminoacidi

4x4x4=4 3 =64 codoni. 20 aminoacidi 4x4x4=4 3 =64 codoni 20 aminoacidi 1 Le 20 diverse catene laterali (gruppo R) che costituiscono gli aminoacidi si differenziano considerevolmente per dimensioni, volume e per le loro caratteristiche fisico-chimiche,

Dettagli

Cap. 1 Interazioni delle molecole con l acqua

Cap. 1 Interazioni delle molecole con l acqua Cap. 1 nterazioni delle molecole con l acqua Ci sono legami idrogeno nel metano liquido (CH 4 mantenuto a -165 C)? Perché? No, perché il legame C-H non è sufficientemente polare da avere una distribuzione

Dettagli

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici

Proprietà comuni. Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici Gli aminoacidi Proprietà comuni Il gruppo α-carbossilico b è un acido più forte del gruppo carbossilico degli acidi alifatici paragonabili Il gruppo α-aminico è un acido più forte (o una base più debole

Dettagli