Struttura, funzione e specificità tessutale dei geni delle mucine

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Struttura, funzione e specificità tessutale dei geni delle mucine"

Transcript

1 Struttura, funzione e specificità tessutale dei geni delle mucine c. BOTIP, E. SEREGNP, S. MASSARON', A.MARTINETIP, A. BONANATE', D. CANTARELLAI, A. CAPOBIANC02, E. BOMBARDIERI' 'Divisione di Medicina Nucleare, Istituto Nazionale per lo Studio e la Cura dei Tumori, MILANO 2 Laboratorio Analisi Cliniche, Ospedale S. Carlo, POTENZA INTRODUZIONE Le differenti molecole della famiglia delle mucine possiedono precise caratteristiche biochimiche in comune (1). Innanzitutto, le mucine sono costituite da un core proteico (apomucina) che presenta un peso molecolare variable da 40kD a 600kD. Tale scheletro proteico contiene un elevato numero di residui di treonina e serina cui sono legate preferenzialmente le catene glucidiche mediante legame 1-3 O-glicosidico (2). I carboidrati costituiscono più de1l'80% della molecola e la lunghezza delle catene glucidiche laterali varia da uno a più di 20 residui; i principali glucidi sono l'n-acetilgalattosammina, l'n-acetilglucosammina, il galattosio, il fucosio ed infine l'acido sialico (3, 4). Differenti geni apomucinici sono stati recentementi identificati ed è stato possibile evidenziare la loro struttura comune costituita da una porzione centrale affiancata da sequenze 5'-3' (5). Il dominio centrale dello scheletro proteico costituisce più dell'80% dell'intera sequenza aminoacidica codificata, ed è composta da sequenze ripetute ("tandem repeats") variabili per numero e composizione caratterizzate da un elevato numero di residui di serina, treonina e prolina. L'omologia di sequenza del dominio centrale fra i differenti membri della famiglia delle mucine è limitata e ciò significa che la sequenza e le dimensioni del dominio interno sono uniche per ogni tipo di mucina. Omologie di sequenza parziali sono invece presenti fra le differenti mucine nei domini delle regioni N e C- terminali. Molecole mucino-simili sembrano essere largamente diffuse in natura, ma la nostra conoscenza a riguardo è decisamente limitata a causa delle scarse informazioni presenti in letteratura per le specie non appartenenti alla classe dei mammiferi. Ad esempio, geni codificanti per molecole affini alle mucine negli eucarioti inferiori sono stati descritti in Leishmania major e Trypanosoma cruzi (6-8); in particolare in quest'ultimo organismo, che rappresenta l'agente eziologico della malattia di Chagas, è stato osservato che glicoproteine simili alle mucine svolgono un ruolo importante nell'interazione con la superficie delle cellule di mammifero durante il processo di invasione. Molto recentemente una glicoproteina mucino-simile con un peso molecolare apparente di 90kD, denominata mucina D, è stata descritta e parzialmente caratterizzata in cellule embrionali di Drosophila melanogaster (9). In questa s~e cie la mucina D sembra essere coinvolta nel processo di muta poichè la sua sintesi è regolata dall'ormone della muta degli insetti. Nei mammiferi le mucine sono largamente rappresentate, essendo riscontrabili nella maggior parte delle cellule epiteliali secretorie polarizzate (1, 2). Molecole simili alle mucine sono state anche osservate sulla superficie di cellule non-epiteliali, in particolare di origine ematica (10-14). Studi immunoistochimici e biochimici hanno consentito di ottenere interessanti informazioni riguardo alla struttura della componente carboidratica delle mucine epiteliali, ma fino a poco tempo fa molto poco si sapeva sulla struttura e composizione delle apomucine. Infatti l'approccio biochimico si è dimostrato inadeguato in quanto la maggior parte delle procedure di studio si basavano sulla deglicosilazione delle mucine che causava una degradazione massiva dello scheletro apomucinico (4, 15-18). Successivamente, l'avvento delle tecniche di biologia molecolare ha consentito finalmente di fare luce sulla componente apomucinica e i geni che la codificano. Questi studi hanno rivelato l'esistenza di differenti geni mucinici che codificano per almeno 8 apomucine (denominate rispettivamente MUC1, MUC2, MUC3, MUC4, MUC5, MUC5AC, MUC5B, MUC6 e MUC7). Grazie ai risultati ottenuti da studi genetici, immunologici e biochimici, è oggi possibile classificare le mucine in due gruppi principali : mucine associate alle membrane cellulari e mucine secretorie. A loro volta le mucine secretorie possono essere suddivise in due altri sottogruppi in base alla loro funzione fisiologica, cioè che vadano o meno a costituire il gel viscoso ch e ricopre la superficie dei tratti respiratorio, gastrointestinale e genitourinario. Questo gel mucinoso svolge importanti funzioni che includono il mantenimento della viscosità e la protezione contro insulti meccanici, chimici, fisici, biologici e contro l'azione di enzimi proteolitici e di variazione di ph (19-21). Di seguito verranno analizzate e discusse le principali caratteristiche delle differenti mucine, con particolare enfasi nei riguardi delle loro rispettive strutture, funzioni ed epressione dei geni che le codoficano. MUC1 MUC1 è tra le mucine associate alla membrana la più conosciuta, ed è chiamata anche "polymorphic epithelial mucin" (PEM) o "episialina". Il gene, che è stato il primo gene mucinico ad essere clonato e sequenziato nell'uomo e nei topi, è localizzato sul cromosoma 1 q21-24 e codifica per una glicoproteina ad elevato PM ( kd) di tran- LlGAN D ASSAY VOL. 1 NUMERO 4 ANNO 1996

2 smembrana altamente glicosilata (22-26). La mucina MUC1 risulta espressa in molti tessuti epiteliali normali (mammella, pancreas, polmone) ed in modo aberrante nei carcinomi di questi distretti (23-25, 27, 28). Il dominio centrale è caratteristico dei geni mucinici ed è costitutito da un numero variabile di tandem repeats (VNTR). L'analisi genica di MUC1 utilizzando un cdna ha rivelato la presenza di 7 esoni. Nel gene possono essere identificate 4 regioni: una regione N-terminale contenente una sequenza segnale idrofobica; un dominio centrale costitutito dalle tandem repeats; una regione C-terminale che codifica sequenze transmembrana e una porzione citoplasmatica di 69 aminoacidi. Il dominio centrale VNTR è localizzato nel secondo esone e consiste di 60 paia di basi ripetute che codificano per tandem repeats costituite da 20 aminoacidi (tabella 2). In ogni tandem repeat esistono 5 potenziali siti di O-glicosilazione, rappresentati dagli aminoacidi serina e treonina. MUC1 presenta un elevato grado di eterogeneità individuale sia a livello genico che di apomucina nel numero di tandem repeats, pertanto questo gene è altamente polimorfico nella popolazione (29-31). Questo polimorfismo suggerisce che la lunghezza del dominio VNTR è essenziale solo per il legame degli O-glicani ma non per la funzione della mucina stessa. In Fig. 1 è riportata la struttura del gene MUC1 e di altri due geni mucinici MUC2 e MUC5AC. Nella tabella 1 sono invece riportate le principali caratteristiche delle mucine epiteliali fino ad ora identificate. Riguardo alla biosintesi, è stato osservato che la molecola è inizialmente sintetizzata come un precursore ad alto peso molecolare nel reticolo endoplasmico; poi il precursore subisce un taglio proteolitico a carico della regione C-terminale della molecola con la conseguente formazione di due prodotti che rimangono associati, sebbene non siano legati da legami covalenti. Il primo prodotto, derivato dalla regione N-terminale, comprende la maggior parte del dominio extracellulare, mentre il secondo, più piccolo, è composto da soli 65 aminoacidi del dominio extracellulare (2, 32-35). E' probabile che tagli enzimatici addizionali siano necessari per il rilascio di MUC1 dalla superficie cellulare e che avvengano sulla superficie cellulare stessa o durante il processo di riciclaggio di proteine di membrana. E' stato dimostrato che le regioni transmembrana e citoplasmatica dell'apomucina MUC1 sono altamente conservate nella specie umana e in altre specie di mammifero, e ciò suggerisce un ruolo funzionale importante di queste regioni. In particolare è stato osservato che il dominio intracellulare C-terminale interagisce con i filamenti di actina del citoscheletro. Inoltre il dominio citoplasmatico di MUC1 è fortemente fosfori lato in serina e tale fosforilazione può essere aumentata mediante trattamento con vari fattori; questa evidenza suggerisce che la molecola può essere coinvolta nel trasferimento di segnali dall'ambiente esterno al citoplasma; questi segnali potrebbero essere di non-adesione e portare quindi alla perdita dei contatti cellula-cellula (36). Tuttavia su questo punto esistono delle controversie. Alcuni Autori ritengono infatti che MUC1 abbia funzioni antiadesive mediate tramite l'ingombro sterico e una carica globale negativa per la presenza dei residui di acidi sialici (36, 37). Tuttavia l'evidenza che il dominio extracellulare protru- de nm sopra la membrana plasmatica estendendosi maggiormente verso lo spazio pericellulare rispetto ad altre componenti, induce a pensare che la molecola possieda proprietà adesive favorendo l'adesione con quelle cellule che possiedono appropriati controrecettori. Questa ipotesi sembra essere confermata da un lavoro molto recente di Regimbald (38), in cui è stato dimostrato che MUC1 nelle cellule di carcinoma mammario rappresenterebbe il ligando per la molecola di adesione intercellulare endoteliale ICAM-1; quindi la mucina di membrana MUC1 medierebbe l'adesione delle cellule tumorali alle cellule endoteliali attraverso ICAM-1 e tale interazione può essere il momento critico nel processo di diffusione metastatica sistemica nel carcinoma mammario. Una esaltata espressione della mucina MUC1 d'altro canto può permettere alle cellule tumorali di eludere il sistema immunitario sia creando un possibile stato immunosoppressivo mediante induzione di un'anergia delle cellule-t, sia bloccando stericamente l'accesso delle cellule immunitarie effettrici verso altre componenti della membrana plasmatica delle cellule neoplastiche (39-41). Questa ipotesi spiegherebbe la prognosi sfavorevole associata ad una overespressione di MUC1 osservata in certi tumori umani. Vari studi sono attualmente in corso con l'obiettivo di identificare i meccanismi ed i fattori coinvolti nella regolazione dell' espressione genica di MUC1. Nella regione non codificante 5'(promotore) di questo gene sono state identificate numerose sequenze regolatorie. Inoltre nel gene sono stati descritti differenti siti di legame potenziale per fattori di trascrizione (es. SP1) e possibili sequenze consenso per il legame dei complessi recettoriali estrogenici e progestinici (42-44). Queste evidenze suggeriscono che l'espressione del gene MUC1 possa essere regolata dagli ormoni sessuali. Tale ipotesi ha trovato conferma in studi condotti sull'endometrio umano e di topo. Nell'endometrio umano i livelli di mrna specifico sono risultati bassi nella fase proliferativa e aumentano significativamente durante la fase secretoria, con una massima concentrazione nella fase d'impianto (45). Questo depone per una stimolazione della espressione del gene MUC1 da parte del progesterone esercitata in maniera diretta od indiretta. Nell'endometrio del topo la situazione è esattamente opposta, dove i più elevati livelli di MUC1 mrna si riscontrano nella fase estrogenica e pre-estrogenica, cioè quando i livelli ematici di estrogeni sono al loro massimo. I livelli più bassi di mrna si osservano invece nella fase d'impianto e durante questa fase l'espressione di MUC1 sembra modulata in senso negativo dal progesterone (46). Quindi è probabile che nel topo MUC1 agisca da barriera contro l'impianto dell'ovulo e che una diminuzione di espressione sia necessaria per generare una mucosa uterina recettiva. Anche il nostro gruppo, utilizzando come modello di studio cellule di carcinoma mammario ormone-dipendenti MCF7, si è dedicato allo studio in vitro della regolazione della espressione genica di MUC1 da parte di ormoni steroidei (estradiolo e progesterone) e di siero fetale privato della componente steroidea (47). I risultati nelle nostre mani indicano che i livelli di MUC1 mrna, determinati con la tecnica di northern-blot, sono maggiormente elevati in cellule coltivate in un medium contenente una concentra- LlGAND AS SAY VOL. 1 NUMERO 4 ANNO 1996

3 Tabella i Principali caratteristiche delle mucine e dei loro prodotti Gene Localizzazione cromosomica Lunghezza tandem repeats (n. aa) Mucina codificata MUCI Iq21 20 Secretoria; di membrana MUC2 llpl5 233 Secretoria; costitutiva del gel MUC3 7q22 17 Secretoria; costitutiva del gel MUC4 3q29 16 Secretoria MUC5AC llpls 8 Secretoria; costitutiva del gel MUC5B IlplS variabile Secretoria; costituti va del gel MUC6 llpls 169 Secretoria; non costitutiva del gel MUC Secretoria; non costitutiva del gel Tabella 2 Sequenze aminoacidiche delle unità tandem repeats Gene MUCI MUC2 MUC3 MUC4 MUCSC MUC5B MUC6 MUC7 Sequenza GSTAPPAHGVTSAPDTRPAP PTTTPITTTTTDTPPPTPTGTQT HSTPSFTSSITTTETTS TSSASTGHATPLPVTD TTSTTSAP VARIABILE SPFSSTGPNTA TSFQTTTTYPTPSHPQTTLPTHVPPFSTSL VTPSTGTVITPTHA WM A TSAS IHSTPT GTIPPPTTLKA TGSTHTAPPMTPTTSGTSQAHSSFST AKTSTSLHSHTSSTHHPEVTPTSTTTITPNP TSTGTSTPVHATTSATSSRLPTPFTTHSPPTGS TTAAPPTPSATTPAPPSSSAPPG zione 10% di siero fetale privo di steroidi, rispetto ai livelli di mrna riscontrabili in cellule coltivate in medium contenente solo il 2% di siero. Non è chiaro quale sostanza presente nel siero eserciti un effetto stimolatorio su MUC1, ma è altamente probabile che sia coinvolto l'lnsulin-like growth factor-1 (IG F-1), dal momento che recettori per l'igf sono stati identificati nelle cellule MCF7 e che questo fattore di crescita risulta estremamente importante per la proliferazione delle cellule di carcinoma mammario e per il loro comportamento biologico. Per quanto riguarda l'estradiolo ed il progesterone, noi non abbiamo osservato alcuna variazione dei livelli di mrna specifico in cellule trattate a differenti concentrazioni di tali steroidi. Tuttavia la mancanza di una "up-regulation" osservabile può essere correlata al fatto che i tempi utilizzati nel nostro studio siano stati troppo lunghi (dal momento che una possibile stimolazione della espressione genica può verificarsi per tempi limitati solo nelle prime fasi del trattamento), oppure la concentrazione di siero usata (2%) che non è ottimale e non ha consentito una apprezzabile regolazione genica. tandem repeat è composto da 23 aminoacici con 14 siti potenziali di glicosilazione (tabella 2). Oltre al dominio centrale che codifica per i tandem repeats, è presente anche un altro dominio di 347 aminoacidi che codifica tandem repeats ad elevato contenuto di serina, treonina e ( MUC1 ) ( MUC2 ) ( MUC5AC ) MUC2 Il gene MUC2 codifica per una tipica mucina costitutiva del gel viscoso. Il cdna di MUC2 è stato isolato da una libreria genomica ottenuta da tessuto intestinale umano (48, 49). Analizzando la organizzazione del gene MUC2, si riscontrano sia omologie sia differenze rispetto al gene MUC1. Analogamente a MUC1, MUC2 presenta un dominio centrale VNTR ricco in serina, treonina e prolina. Ogni FiGURA i Organizzazione schematica dei geni mucinici MUCi, MUC2 e MUC5AC. VNTR: numero variabile di tandem repeats; TMD: dominio tram-membrana; CTD: dominio citoplasmatico; TSRD: dominio ad alto contenuto di treonina/cisteina; CRD: dominio ad alto contenuto di cisteina. ligand ASSAY VOL. 1 NUMERO 4 ANNO 1996

4 prolina. La caratteristica più importante del gene MUC2 comunque è rappresentata dalla presenza di quattro domini ad elevato contenuto di cisteina. Questi domini (3 nella regione N-terminale e 1 nella regione C-terminale) sono costitutiti da elementi ripetitivi che presentano un elevato grado di omologia col dominio codificante il fattore di pre-pro von Willebrand (vwf) (dominio D). I domini D sono coinvolti nella oligomerizzazione del vwf e del suo immagazzinamento negli organelli di accumulo (corpi di Weibel-Palade). E' molto probabile che i domini D nel gene MUC2 svolgano un ruolo analogo dei domini D del pre-pro vwf: in particolare i residui nella regione D sono coinvolti nella formazione di ponti disolfuro intra- ed extra molecolari. Di particolare rilievo è il fatto che il gene MUC2 è localizzato in un locus sul cromosoma 11p15, vicino ai geni che codificano le mucine MUC5AC, MUC5B e MUC6. Tutti questi geni risultano espressi nelle cellule in cui immunoistochimicamente è riscontrabile del muco. Pertanto qj.leste evidenze suggeriscono che questi geni mucinici sul cromosoma 11 p15 farebbero parte di una famiglia poligenica i cui membri codificano per mucine secretorie costitutive il gel di rivestimento. MUC2 è la mucina predominante nel tessuto intestinale dove viene prodotta dalle cellule caliciformi mucipare. Alcuni dettagli sono stati ottenuti riguardo alla sintesi della glicoproteina (50-52). Innanzitutto, MUC2 è sintetizzata dapprima a livello del reticolo endoplasmico ruvido (RER) come precursore proteico con un peso molecolare apparente di 600 kd e con un elevato contenuto di mannosio; molto probabilmente anche il processo di oligomerizazione avviene nel RER. Successivamente MUC2 è poi trasportata nell'apparato di Golgi dove avvengono le O-glicosilazioni e l'aggiunta di residui di acido sialico, di fucosio e solfati. La molecola neosintetizzata viene quindi immagazzinata in vescicole che poi matureranno in granuli definitivi di accumulo durante il trasporto verso la porzione apicale della cellula. Il contenuto dei granuli verrà alla fine riversato nel lume intestinale per esocitosi. Alcuni studi recenti, in cui come modello è stata utilizzata una linea cellulare di adenocarcinoma del colon umano, hanno dimostrato come la secrezione di MUC2 possa avvenire sia in condizioni basali e regolate, che in condizioni stimolate e non regolate. Varie sostanze hanno la capacità di stimolare la secrezione della mucina, tra le quali quelle colinergiche sembrano rivestire il ruolo più importante (53, 54). MUC3 Il gene che codifica per la mucina MUC3 è molto grande ed è localizzato sul cromosoma 7q22 (55, 56). Ogni tandem repeat del dominio centrale è composto da 51 nucleotidi che codificano un peptide ripetitivo di 17 aminoacidi con 12 siti potenziali di glicosilazione (tabella 2). Molto poco si sa riguardo alla sintesi ed epressione di MUC3. L'apomucina MUC3 è prodotta dalle cellule caliciformi mucipare e, in quantità maggiori, dalle cellule intestinali assorbenti (57, 58). A differenza di MUC2, la mucina MUC3 non viene immagazzinata in granuli, ma probabilmente in microvescicole che rilasciano il contenuto nel glicocalice o direttamente nel lume intestinale. Studi di immunoistochimica e di ibridizzazione in situ indicano che nelle cellule intestinali assorbenti l'espressione di MUC3 è regolata spazialmente (59) ; infatti le cellule epiteliali cominciano ad esprimere MUC3 durante la migrazione dagli strati inferiori delle cripte del Lieberkuhn verso la superficie del colon. MUC4 Il gene MUC4 è stato isolato da una libreria di cdna estratto da tessuto bronchiale (60-62). Il gene è localizzato sul cromosoma 3q29 e anch'esso presenta la regione VNTR. Ogni tandem repeat è composta da 16 aminoacidi con 8 siti potenziali di glicosilazione (tabella 2). Anche per il gene MUC4 le informazioni riguardo la struttura e la biologia di questa mucina non sono molte. I dati disponibili indicano comunque che MUC4 è una mucina secretoria sintetizzata dalla maggior parte delle cellule epiteliali e ghiandolari dei tratti respiratorio, digestivo e genito-urinario. MUC5 Oltre a MUC4 altri 3 cdna sono stati ottenuti dalla mucosa umana tracheobronchiale e mappati sul cromosoma 11 p15 (60,63). Questi tre geni sono stati chiamati, per la loro origine comune, MUC5A, MUC5B e MUC5C, rispettivamente. Ulteriori studi hanno dimostrato che MUC5A e MUC5C fanno parte di uno stesso gene, denominato MUC5AC e che questo gene è differente da MUC5B. Il gene MUC5AC è preferenzialmente espresso nel tratto respiratorio e nelle mucose gastrica (antro e fondo) e riproduttiva; per contro il gene MUC5B è fortemente espresso nelle ghiandole bronchiali. Nel gene MUC5AC è possibile distinguere un dominio VNTR composto di sequenze ripetute di 24 paia di basi che codificano per la sequenza aminoacidica TTVTIAP (64, 65) (tabella 2). Oltre al dominio VNTR, nella proteina MUC5AC sono presenti vari domini ricchi in cisteina. E' probabile che questi domini ad alto contenuto cisteinico svolgano un ruolo nel processo di polimerizzazione, analogamente a quanto descritto per il gene MUC2. In ogni caso comunque, a differenza di MUC2, i domini ricchi in cisteina sono inseriti nel dominio VNTR o in un dominio non-ripetitivo ricco in treonina/serina, per cui nella struttura dell'apomucina MUC5AC è possibile riconoscere un grande dominio altamente glicosilato che contiene dei subdomini ricchi in cisteina ma scarsamente glicosilati. Il gene MUC5B presenta una caratteristica unica rispetto agli altri geni mucinici; infatti è l'unico gene mucinico umano ad esibire lunghezze variabili delle unità nucleotidiche ripetute nel dominio VNTR. Il significato biologico di questo peptide degenerato è tuttora ignoto. MUC6 Il gene MUC6 è stato isolato e caratterizzato usando una libreria di cdna da tessuto gastrico umano (66). Oltre ai geni MUC2, MUCAC e MUC5B, MUC6 è il quarto gene ad essere localizzato nel locus 11 p15. La sequenza del cdna è caratterizzata dalla presenza di un dominio VNTR di cui la singola unità ripetuta è lunga 507 nucleotidi (169 aminoacidi) (tabella 2). La lunghezza della singola unità ripetuta rende MUC6 abbastanza peculiare fra le mucine. L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

5 Infatti, la lunghezza del tandem repeat risulta 5 volte superiore rispetto alle unità ripetute nelle altre mucine umane. Inoltre, il dominio VNTR è costituito da varie unità, con la conseguenza che l'apomucina MUC6 è molto grande. Osservazioni biochimiche suggeriscono che lo scheletro proteico di MUC6 abbia un PM superiore a 600kO, che, fra quelli riportati fino ad ora per le apomucine, è il più elevato. MUC6 e MUC5AC sono le due specie maggiormente rappresentate nello stomaco. Studi di immunoistochimica, comunque, hanno dimostrato che la distribuzione tessutale di queste due mucine è differente e rispettivamente esclusiva (67). Infatti, MUC5AC è sintetizzata dalla superficie delle cellule mucose dell'antro e del fondo, mentre MUC6 è prevalentemente espressa nelle cellule mucose delle ghiandole gastriche e nelle cellule delle ghiandole piloriche. Poichè le cellule epiteliali mucose gastriche producono una mucina neutra e le ghiandole mucose gastriche producono una mucina acida, è molto probabile che MUC5AC e MUC6 rappresentino i rispettivi scheletri proteici. MUC7 Il gene MUC7, demoninato anche MG2, è stato recentemente clonato e sequenziato usando una libreria genomica di cona da ghiandola salivare (68). MUC7 è localizzato sul cromosoma 4 e contiene tandem repeats di 23 residui aminoacidici (tabella 2). Inoltre due residui di cisteina precedono i tandem repeats. La più vistosa caratteristica di MUC7 è il suo basso peso molecolare. La regione trascritta infatti, comprendente 1131 nucleotidi, codifica una proteina di soli 377 aminoacidi, con un peso molecolare apparente di 39 ko. I primi 20 residui costituisco il pepetide principale, mentre i rimanenti aminoacidi costituiscon la proteina secretoria. La molecola è secreta come monomero e pertanto i due residui di cisteina, localizzati prima del dominio delle tandem repeats, sono probabilmente coinvolti nei ponti disolfuro intramolecolari. La espressione di MUC7 è tessuto e cellulo-specifica. Studi di ibridizzazione in situ hanno rivelato che questo gene è espresso nei tessuti della ghiandola salivare umana ed esclusivamente in quelli contenenti cellule acinari mucose (68, 69). MUC7 è presente, per esempio, nelle ghiandole sottolinguali e sottomandibolari ma non nelle ghiandole paratiroidee in cui sono presenti cellule acinari sierose. Recentemente, una nuova mucina ad alto PM (MG 1) è stata clonata e parzialmente sequenziata utiliz- zando una libreria di cona di ghiandola sottolinguale umana (70). La regione C-terminale contiene sequenze ricche in cisteina, e ciò suggerisce che anche questa mucina è secreta come polimero. Dati preliminari indicano che MG1 risulta fortemente espressa solo nelle ghiandole sottolinguali. ESPRESSIONE DEI GENI MUCINICI NEI TESSUTI TUMORALI Una delle caratteristiche più importanti della espressione dei geni mucinici è il loro grado di specificità cellulare e tessutale. Come abbiamo già affermato in precedenza, alcune mucine, come ad es. MUC1 e MUC4, sono espresse in differenti tessuti, mentre altre, come ad es. MUC2, MUC3 e MUC7 presentano una espressione cellulare più ristretta. Nella tabella 3 sono riportati i siti preferenziali di espressione relativi ad ogni gene apomucinico. Una problematica importante è se questa specificità di espressione è mantenuta anche in condizioni patologiche differenti, tra cui la trasformazione neoplastica. Studi di immunoistochimica con anticorpi specifici per ogni apomucina e di ibridizzazione in situ con sonde nucleotidiche specifiche hanno dato alcuni chiarimenti iniziali riguardo a questi aspetti. Attualmente sono disponibili dati sulla espressione dei geni mucinici nei tessuti pancreatici, gastrici ed intestinali normali e nelle controparti trasformate. Per quanto riguarda i tessuti di altri distretti le conoscenze nelle nostre mani sono ancora limitate. Studi di ibridazione in situ hanno dimostrato che le cellule degli acici pancreatici esprimono solamente MUC1, mentre i dotti pancreatici normali mostrano reattività anche per sonde anti-muc3 e MUC5B (57, 71, 72). Per contro, MUC2, MUC4 e MUC5AC generalmente non sono espressi in cellule pancreatiche normali. La trasformazione neo plastica del pancreas esocrino è accompagnata da modificazione del pannello di espressione dei geni mucinici. Infatti, in seguito alla trasformazione neoplastica si verifica un sovvertimento della espressione di tali geni, per cui spesso si può riscontrare nel tessuto tumorale la presenza di MUC2, MUC4, MUC5AC. Il significato di questa alterazione di espressione è tuttora oscuro. Tuttavia è possibile che l'espressione di MUC2 e MUC5AC derivi da una differenziazione gastrointestinale spesso osservata nei tessuti tumorali pancreatici. Un altro esempio interessante è costituito dall'epitelio gastrico (73). Come descritto precedentemente, tre geni mucinici, cioè MUC1, MUC5AC e MUC6 so no fortemente Tabella 3 Siti preferenziali di espressione delle mucine Gene MUCI MUC2 MUC3 MUC4 MUC5AC MUC5B MUC6 MUC7 Locali zzazione tessutale Superficie apicale della maggior parte delle cellule epiteliali polarizzate dei tratti respiratorio, diges ti vo e genitourinario, incluso il tessuto mammario Intestino tenue e colon (cellule caliciformi mucipare), epitelio bronchiale (cellule calicoformi mu cipare) Intestino tenue (cellule assorbenti) Cellule epiteliali e ghiandolari dei tratti respiratorio, diges ti vo e genitourinario Stomaco (superficie delle cellule mucipare); tratti res piratori e genitourinari Epitelio bronchiale; dotti pancreatici Stomaco (cellule mucipare e ghiandolari); piloro (ghiandole del Brunner) Ghiandole sali vari (cellule mu cipare) LlGAND ASSAY VOlo 1 NUMERO 4 ANNO 1996

6 Tabella 4 Positività di espressione del gene MUC4 nel tessuto polmonare normale e tumorale Espressione elevata (++) Espressione intermedia (+) Espressione debole (±) Espressione assente Tessuto normale Tessuto tumora[e 0/10 3/18 3/10 9/ [11 8 espressi nello stomaco in condizioni normali. Il carcinoma gastrico, ed in particolare il tipo intestinale, è associato ad una diminuzione dell'espressione di queste mucine e alla comparsa ectopica di mucine tipiche dell'intestino quali MUC2, MUC3 e MUC4. Come avviene nel carcinoma pancreatico, anche nel caso del carcinoma gastrico la spiegazione per questa aberrante espressione può essere ricercata nella capacità delle cellule tumorali di acquisire caratteristiche intestinali e coloniche, attivando le vie metaboliche silenti. Inoltre, è stato osservato che l'espressione multipla delle apomucine è più frequente nel carcinoma gastrico avanzato che non in quello ai primi stadi. Attualmente, non è ancora chiaro se l'espressione multipla dei core peptidici di tali mucine rappresenti un indicatore di aggressività biologica o sia solo un evento secondario all'alterazione genetica spesso osservata nei tumori a stadio avanzato. Vari geni mucinici sono espressi nei tessuti intestinali e del colon normali. Come accennato prima, MUC1 è largamente espresso nelle cellule epiteliali, MUC2 è presente limitatamente alle cellule di globet, mentre MUC3 è distribuito uniformemente in tutto l'epitelio assorbente. La trasformazione neoplastica generalmente determina una riduzione dell'espressione di MUC2 e MUC3, accompagnata da un incremento della sintesi di MUC1 e MUC4 (74-76). Quest'ultima alterazione metabolica è stata descritta anche nel cancro polmonare. In un lavoro recente condotto dal nostro gruppo (28) è stata evidenziato come il gene MUC4 sia fortemente associato al cancro polmonare: infatti la espressione di MUC4, insieme a quella del gene MUC1, è risultata decisamente superiore nel tessuto polmonare tu morale rispetto alla controparte normale (tabella 4); in particolare, i più elevati livelli di RNA specifico sono stati osservati nell'istotipo adenocarcinoma che, come noto, è un tumore producente mucine. Ulteriori studi sono comunque necessari allo scopo di valutare il ruolo del gene MUC4 gene nel cancro polmonare e di correlare la sua espressione con altri parametri biologici, quali il grado istologico e lo stadio clinico. Nel carcinoma colo-rettale la diminuzione dell'espressione del gene MUC1 sembra avere un significato prognostico in quanto è associata alla progressione tumorale e agli stadi avanzati di malattia (77). Un significato prognostico della aumentata espressione di MUC1 è stato anche attribuito nel cancro della mammella (78-80). Molti autori, hanno dimostrato che pazienti con tumori ad elevata espressione di MUC1 spesso presentano una prognosi più sfavorevole, (cioè intervalli liberi da malattia più brevi e una sopravvivenza media generalmente ridotta). Risultati analoghi sono stati ottenuti in relazione alla espressione ectopica di MUC2, gene normalmente non espresso nei tessuti mammari (81). Tuttavia, va sottolineato che il peso dell'espressione aberrante di questi geni mucinici come indicatore prognostico nel cancro della mammella deve essere validato da ulteriori e più estesi studi clinici. RINGRAZIAMENTI Questo lavoro è stato in parte eseguito con il supporto finanziario del CNR-Prog. Finalizzato ACRO. Si ringrazia la Sig.ra Françoise Bonetti per la assistenza redazionale. BIBLIOGRAFIA 1. Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Jentoft N. Why are proteins O-glycosilated? Trends Biochem Sci, 1990; 15 : Ho SB, Kim YS. Carbohydrates antigens on cancer-associated mucin-like molecules. Semin Cancer Biol, 1992; 2: Carraway KL, Hull SR. Celi surface mucin type glycoproteins and mucin like domains. Glycobiol, 1991; 1 (2): Van K1inken BJ, Dekker J, Buller HA, Einerhand A W. Mucin gene structllre and expression: protection vs. adehsion. Am J Physiol, 1995 ; 269 (5): G Murray PJ, Spithill TW. Variants of Leishmania surface antigen derived from a mliltigenic family. J Biol Chem, 1991; 266: Di Noia 1M, Sanehes DO, Frase ACe. The protozoan Trypanosoma cruzi has a famili y of genes resembling the mucin genes of mammalian cells. J Biol Chem, 1995; 270 (41): Serrano AA, Sehenkman S, Yoshida N, Mehlert A, Richardson JM, Ferguson MA. The lipid structure of the glycosylphosphatidyliinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. J Biol Chem, 1995; 270 (45): Kramero AA, Arbatsky NP, Rozovsky YM, Mikhakeva EA, Polasskaya 00, Gvodev VA, Shibaev VN. MlIcin-type glycoprotein ti'om Drosohila Melanogaster embryonic cells: characterization of carbohydrate component. FEBS Lett, 1996; 378: Baumhueter S, Singer MS, Henzel W, Hemmerich S, Renz M, Rosen SD, Lasky LA. Bincling of L-selectin to the vasclilar sialomllcin CD34. Science, 1993; 262: Imai Y, Singer MS, Fennie e. lclentification of a carbohydrate-basecl enclothelial li gand for a lymphocyte homing receptor. J Cell Biol, 1996; I 13: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

7 12. Crommie D, Rosen SD. Biosynthesis of GlyCAM-l, a mucin-like ligand for L-selectin. J Bio1 Chem, 1995; 270 (8): Cheng J, Baurnhueter S, Cacalano G, Carver-Moore K, Thibodeaux H, Thomas R, Broxmeyer HE, Cooper S, Hague N, Moore M, Lasky LA. Hematopoietic defects in mice lacking the sialomucin CD34. Blood, 1996; 87(2): Hemmerich S, Leffler H, Rose SD. Structure of the O-glycans in GlyCAM-l, an endothelial-derived ligand for L-selectin. J Biol Chem, 1995; 270 (20): Sheehan JK, Thornton DJ, Somerville M, Carlstedt I. Mucin structure. The structure and heterogeneity of respiratory mucus glycoproteins. Am Rev Respir Dis, 1991; 144: S Davies JR, Hovenbers HW, Linden CJ, Howard R, Richardson PS, Shehan JK, Carlstedt I. Mucins in airway secretions from healthy and chronic bronchitic subjects. BiochemJ, 1996; 313: Reid L, Champ JR. Biochemical and histochemical nomenc1ature of mucus. Br Med Bull, 1978; 34: Bolshcer J, Veerman E, Van Niew Amerongen A, Tulp A, Verwperd D. Distinct populations of high-mr mucins secreted by different human sa1ivary glands discriminated by density-gradient electrophoresis. Biochem J, 1995; 309: Neutra MR, Forstner JF. Gastrointestinal mucus: synthesis, secretion, and function. In: Physiology of the gastrointestinal tract, edited by Johnson LR, pp , Raven press, New York, Allen A. Mucus: a protective secretion of complexity. Trends Biochem Sci, 1983; 8: Carlstedt I, Sheehan JK, Corfiels AP, Gallagher JT. Mucous glycoprotein: a gel of a problem. Essays Biochem, 1985; 20: Price MR, Tendler JB. Polymorphic epithelial mucins (PEM): molecular characteristics and association with breast cancer. The Breast, 1993; 2: Gendler SJ, Spicer AP, Lalani EN, Duhig T, Peat N, Burchell J, Pemberton L, Boshell M, Taylor-Papadimitriou J. Structure and biology of a carcinoma-associated mucin, MUCI. Am Rev Respir Dis, 1991; 144: S Swallow DM, Gendler S, Griffiths B, Kearney A, Povey S, Sheer D, Palmer RW, Taylor-Papadimitriou J. The hypervariable gene locus PUM, which encodes for the tumor-associated epithelial mucins, is located on chromosome I within the region Ig Ann Hum Genet, 1987; 51: Siddiqui J, Abe M, Hayes D, Shari E, Yunis E, Kufe D. Isolation and sequencing of a cdna coding for the human DF3 breast carcinoma-associated antigen. Proc NatI Acad Sci USA, 1988; 85: Peat N, Gendler SJ, Lalani EN, Duhig T, Taylor-Papadimitriou J. Tissue-specific expression of a human polymorphic epithelial mucin (MUCl) in transgenic mice. Cancer Res, 1992; 52: Girling A, Bartkova J, Burchell J, Gendler S, Gillet C, Taylor-Papadimitriou J. A core protein epitope of the polymorphic epithelial mucin detected by the monoc1onal antibody SM3 is selectively exposed in a range of primary carcinomas. Int J Cancer, 1989; 43: Seregni E, Botti C, Lombardo C, Cantoni A, Bogni A, Cataldo I, Bombardieri E. Pattern oi' mucin gene expression in normal and neoplastic lung tissues. Anticancer Res, 1996; 16: Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J, Gendler SJ. Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit. Biochem Bioph Res Comm, 1990; 173 (3) : IO Swallow DM, Gendler S, Griffiths B, Corney G, Taylor-Papadimitriou J, Bramwell ME. The human tumor-associated epithelial mucins are coded for by an expressed hypervariable gene locus PUM. Nature, 1987; 328: Gendler SJ, Burchell JM, Duhig T et al. Cloning of partial cdna encoding differentiation and tumour-associated mucin glycoproteins expressed by human mammary epithelium. Proc Nati Acad Sci USA, 1987; 84: Linsley PS, Kallestad JC, Horn D. Biosynthesis of high molecular weight breast carcinoma associated mucin glycoproteins. J Biol Chem, 1988; 263: Hilkens J, Buijs F. Biosynthesis of MAM-6, an epithelial sialomucin. J Biol Chem, 1988; 263: Hilkens J, Wesseling J, Vos HL. Episialin/MUCI: structure, modulation of cellular adhesion, promotion of invasion in vitro and cleft formation in vivo, and inhibition of immune cytolysis. Pl'Oceedings of the third International Workshop on Carcinoma-Assoeiated Mucin, 1994 Aug 7-11, Cambridge (UK). 35. Ligtenberg MJ, Kruijshaar L, Buijs F, van Meijer M, Litvinov SV, Hilkens.I. Cell-assoeiated episialin is a eomplex eontaining two pl'oteins derived from a eommon precurson. J Biol Chem, 1992; 267: Hilkens J, Ligtenberg MJL, Vos HL, Litvinov SV. Cell membrane assoeiated mucins and their adhesion modulating pl'operty. Trends Biochem Sci, 1992; 17: Ligtenberg MJL, Buijs F, Vos HL, Hilkens J. Suppression of cellular aggregation by high 1eve1s of episialin. Cancer Res, 1992; 52: Regimbald LH, Pilarski LM, Longeneker M, Reddish MA, Zimmermann G, Hugh Je. The breast mucin MUCI as a novel adhesion ligand for endothelial intercellular adhesion molecule I in breast cancer. Caneer Res, 1996; 56: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

8 39. Reddish MA, MacLean GD, Poppema S, Berg A, Longeneker BM. Pre-immunotherapy serum MUC-1 mucin level and CD69+ lymphocytes correlate with effects of synthetic sialyl-tn vaccine in active specific immunotherapy. Cancer Immunol Immunother: in presso 40. Hayes DF, Silberstein DS, Rodrique SW. DF3 antigen, a human epithelial celi mucin, inhibits adhesion of eosinophils to antibody-coated targets. J Immunol, 1990; 145: Ogata S, Maimonis PJ, Itzkowitz SH. Mucin bearing the cancer-associated sialosyl-tn antigen mediate inhibition of natural killer celi cytotoxicity. Cancer Res, 1992;52: Abe M, Kufe D. Characterization of cis-acting elements regulating transcripti on of the human DF3 breast carcinoma- associated antigen (MUC l) gene. Proc NatI Acad Sci USA, 1993; 90: Kovarik A, Peat N, Wilson D, Gendler SJ, Taylor-Papadimitriou J. Analysis of the tissue-specific promoter of the MUC I gene. J Biol Chem, 1993 ; 268 (13): Gollub EG, Waksman H, Goswami S, Marom Z. Mucin genes are reglliated by estrogen and dexamethasone. Biochem Bioph Res Commun, 1995; 217 (3): Hey NA, Graham RA, Seif MW, Aplin ID. The polymorphic epithelial mucin MUCI in human endometrium is regulated with maximal expression in the implantation phase. J Clin Endocrinol Metab, 1994; 78: Surveyor GA, Gendler SJ, Pemberton L, Das SK, Chakraborty I, Julian J, Pimental RA, Wegner CC, Dey SK, Carson DD. Expression and steroid hormonal control of MUC-l in the mouse uterus. Endocrinology, 1995; 136: Botti C, Seregni E, Lombardo C, Massaron S, Bombardieri E. Effects of steroid-free fetal serum and steroid supplementation on MUCI gene expression in human breast cancer celliine MCF7. Anticancer Res: in presso 48. Gum JR, Byrd JC, Hicks JW, Toribara NW, Lamport DT, Kim VS. Molecular cloning of human intestinal mucin cdnas. J Biol Chem, 1989; 264: Gum JR, Hicks.TV, Toribara NW, Siddiqlli B, Kim VS. Molecular cloning of human intestinal mucin (MUC2) cdna. ldentification of the amino terminus and overal! sequence similarity to prepro-von Willebrand factor. J Biol Chem, 1994; 269: Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Tytgat KMAJ, Buller HA, Opdam FJM, Kim YS, Einerhand A W, Dekker J. Biosynthesis of human coloni c mucin: MUC2 is the prominent secretory mucin. Gastroenterology, 1994; 107: McCool DJ, Forstner F, Forstner GG. Regulated and unregulated pathways for MUC2 mucin secretion in human colonic LS 180 adenocarcinoma cel!s are distinct. Biochem J, 1995; 312: Specian RD, Neutra MR. Mechanism of rapid mucus secretion in Gob1et cells stimulateel by acetylcholine. J Celi Biol, 1980; 85 : Phillips TE, Phillips TH, Neutra MR. Regulation of intestinal Goblet cell secretion. III. Isolated intestinal epithelium. Am J Physiol, 1984; 247: G674-G Fox MF, Lahbib F, Pratt W, Attwood J, Gum J, Kim YS, Swallow DM. Regiona1 loca li zation of the intestinal mucin gene MUC3 to chromosome 7q22. Ann Hum Genet, 1992; 56: Gum JR, Hicks JW, Swallow DM, Lagace RL, Byrd JC, Lamport DT, Siddiqui B, Kim VS. Molecular cloning of cdnas derived from a novel human intestinal mucin gene. Biochem Biophys Res Commlln, 1990; 171 : Ho SB, Niehans GA, Lyftogt C, Yan PS, Cherwitz DL, Gum ET, Dahiya R, Kim VS. Heterogeneity of mucin gene expression in normal and neoplastic tissues. CancerRes, 1993; 53: Niv Y, Bird JC, Ho SB, Dahiya R, Kim VS. Mucin synthesis and secretion in relation to spontaneous differentiation of colon cancer cells in vitro. Int J Cancer, 1992; 50: Chang SK, Dohrman AF, Basbaum CB, Ho SB, Tsuda T, Toribara NW, Gum.TR, Kim VS. Localization of mucin (MUC2 anel MUC3) messenger RNA anel peptiele expression in hllman normal intestine and colon cancer. Gastroenterology, 1994; 107: Aubert JP, Porchet N, Crepin M, Duterque-Coqullard M, Vergnes G, Mazzucca M, Debuire B, Peptiprez D, Degand P. Evidence for different hllman tracheo-bronchial mucin peptides deduced from nucleotide cdna sequences. Am J Respir Cel! Mol Bi ol, 1991;5: Gross MS, Guyonnet DV, Porchet N, Bernheim A, Aubert JP, Nguyen VC. Mucin 4 (MUC4) gene: regional assignment (3q29) ami RFLP analysis. Ann Genet, 1992; 35: Porchet N, Van Cong N, Dufosse J, Audie JP, Guyonnet-Duperat V, Gross MS, Denis C, Degand P, Bernheim A, Aubert JP. Moleclliar cloning and chromosomal localization of a novel hllman tracheobronchial mucin cdna containing tandemly repeated sequences of 48 base pairs. Biochem Biophys Res Commun, 1991; 175: Nguyen VC, Aubert JP, Gross MS, Porchet N, Degand P, Frezal J. Assignment of hllman tracheobronchial mucin gene(s) to II P 15 and a tracheobronchial mllcin-re1ated sequence to chromosome 13. HlIm Genet, 1990; 86: Guyonnet Duperat V, Audie.TP, Debailleul V, Laine A, Buisine MP, Galiegue-Zowitina S, Pigny P, Degnad P, Aubert JP, Porchet N. Characterization of the human mucin gene MUCAC: a consensus L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

9 cysteine-rich domain for I Ip15 mucin genes? Biochem J, 1995; 305 : Buisine MP, Janin A, Maunoury V, Audie JP, Delescaut MP, Copin MC, Colombel JF, Degand P, Aubert JP, Porchet N. Aberrant expression of a human mucin gene (MUC5AC) in rectosigmoid villous adenoma. Gastroenterology, 1996; l IO: Toribara NW, Roberton AM, Ho SB, Kuo WL, Gum E, Hicks JW, Gum JR, Byrd JC, Siddiqui B, Kim YS. Human gastric mucin. Identification 01' a unique species by expression cloning. J Biol Chem, 1993; 268: Ho SB, Roberton AM, Shekels LL, Lyftog CT, Niehans GA, Toribara NW. Expression cloning 01' gastric mucin complementary DNA and localization of mucin gene expression. Gastroenterology, 1995; 109: Bobek LA, Tsai H, Biesbrock AR, Levine MJ. Molecular cloning, sequence, and specificity of expression of the gene encoding the low molecular weight human salivary mucin (MUC7). J Biol Chem, 1993; 268 (27): Cohen RE, Arguirre A, Neiders A, Levine MJ, Jones PC, Reddy MS, Haar JG. Immunochemistry and immunogenicity oi' low molecular weight human. salivary mucin. Arch Oral Biol, 1991; 36: Troxler RF, Offner GD, Zhang F, Iontcheva I, Oppenheim FG. Molecular cjoning of a novel high molecular weight mucin (MG l) from human sublingual gland. Biochem Biophys Res Commun, 1995; 217 (3): Balague C, Gambus G, Carrato C, Porchet N, Aubert JP, Kim YS, Real FX. Altered expression of MUC2, MUC4, and MUC5 mucin genes in pancreas tissues and cancer celi lines. Gastroenterology, 1994; 106: Balague C, Audie JP, Porchet N, Real FX. In situ hybridization shows distinct patterns of mucin gene expression in normal, benign, and malignant pancreas tissues. Gastroenterology, 1995; 109: Ho SB, Shekels LL, Toribara NW, Kim YS, Lyftog C, Cherwitz DL, Niehans GA. Mlicin gene expression in normal, preneoplastic, and neopl astic hllman gastric epithelium. Cancer Res, 1995; 55: 268 I Audie JP, Janin A, Porchet N, Copin MC, Gosselin B, Aubert JP. Expression of hllman mucin genes in respiratory, digestive, and reprodllctive tracts ascertained by in situ hybridization. J Hi stochem Cytochem, 1993; 41: Ogata S, Uehara H, Chen A, Itzkowitz SH. Mucin gene expression in colonic ti ssues and ce li lines. Cancer Res, 1992; 52: Velcich A, Palumbo L, Jarry A, Laboisse C, Racevskis J, Augentlich L. Patterns or expression 01' lineage-specific markers dllring the in vitro-induced differentiation 01' HT29 colon carcinoma celis. Celi Growth &Differentiation, 1993; 6: Nakamori S, Ota DM, Cleary KR, Shirotani K, Irimura T. MUCI mllcin expression as a marker 01' progression and metastasis of human colorectal carcinoma. Gastroenterology, 1994; 106: Ellis IO, BelI J, Todd.IM, WilIiams M, Dowle C, Robins AR, Eison CW, Blamey RW, Baldwin RW. Evaluation of immunoreactivity with the monoclonal antibody NCRC-II in breast cancer. Br J Cancer, 1987; 56: Muir 1M, Reed RG, Stacker SA, Alexander AI, McKenzie IF, Bennet RC. The prognostic value of immunoperoxidase staining with monoclonal antibodies NCRC-l I and 3E1.2. Br J Cancer, 1991; 64: McGuckin MA, Walsh MD, Hohn BG, Ward BG, Wright RG. Prognostic significance of MUCI epithelial mucin expression in breast cancer. Hum Pathol, 1995; 26 (4): Walsh MD, McGuckin MA, Devine PL, Hohn BG, Wright RG. Expression of MUC2 epithelial mucin in breast carcinoma. J Clin Pathol, 1993; 46: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma.

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna è caratteristico degli eucarioti: Sequenze codificanti 1.5% del genoma umano Introni in media 95-97%

Dettagli

Citochine dell immunità specifica

Citochine dell immunità specifica Citochine dell immunità specifica Proprietà biologiche delle citochine Sono proteine prodotte e secrete dalle cellule in risposta agli antigeni Attivano le risposte difensive: - infiammazione (immunità

Dettagli

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA)

SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) SUPERAVVOLGIMENTO DEL DNA (ORGANIZZAZIONE TERZIARIA DEL DNA) ORGANIZZAZIONE TERZIARIA DEL DNA Il DNA cellulare contiene porzioni geniche e intergeniche, entrambe necessarie per le funzioni vitali della

Dettagli

DI REGOLAZIONE A DUE COMPONENTI

DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac

Dettagli

La biopsia del linfonodo sentinella nel carcinoma. Dott. S.Folli S.C. Senologia AUSL Forlì s.folli@ausl.fo.it

La biopsia del linfonodo sentinella nel carcinoma. Dott. S.Folli S.C. Senologia AUSL Forlì s.folli@ausl.fo.it La biopsia del linfonodo sentinella nel carcinoma duttale in situ: : si,no, forse Dott. S.Folli S.C. Senologia AUSL Forlì s.folli@ausl.fo.it Definizione Il carcinoma duttale in situ della mammella è una

Dettagli

Un aiuto per prendere decisioni più informate 1-5

Un aiuto per prendere decisioni più informate 1-5 Un aiuto per prendere decisioni più informate 1-5 L'unico test che fornisce una valutazione accurata dell aggressività del cancro alla prostata Un prodotto di medicina prognostica per il cancro della prostata.

Dettagli

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per

Dettagli

LA MEMBRANA PLASMATICA

LA MEMBRANA PLASMATICA LA MEMBRANA PLASMATICA 1. LE FUNZIONI DELLA MEMBRANA PLASMATICA La membrana plasmatica svolge le seguenti funzioni: 1. tenere concentrate tutte le sostanze indispensabili alla vita: è proprio la membrana

Dettagli

1. Manifestano la loro azione negativa solo in età adulta avanzata

1. Manifestano la loro azione negativa solo in età adulta avanzata Perché invecchiamo? La selezione naturale opera in maniera da consentire agli organismi con i migliori assetti genotipici di tramandare i propri geni alla prole attraverso la riproduzione. Come si intuisce

Dettagli

Fenomeni di trasporto. Fenomeni di trasporto

Fenomeni di trasporto. Fenomeni di trasporto La comprensione dei processi fisici, chimici e biologici che governano il trasporto di materia e la trasmissione delle forze è di fondamentale importanza per lo studio della fisiologia cellulare e l ingegnerizzazione

Dettagli

Vitamina D, PTH ed omeostasi del calcio

Vitamina D, PTH ed omeostasi del calcio Vitamina D, PTH ed omeostasi del calcio Funzioni principali della vit D Stimolazione dell'assorbimento del calcio e del fosforo a livello intestinale; Regolazione, in sinergia con l'ormone paratiroideo,

Dettagli

1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici

1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici 1 Capitolo 8. Sviluppo linfocitario e riarrangiamento ed espressione dei geni dei recettori antigenici La maturazione consiste in una serie di eventi che avvengono negli organi linfoidi generativi o primari:

Dettagli

La DIGESTIONE. I principi nutritivi sono: le proteine, i glucidi, i lipidi, le vitamine, i sali minerali e l acqua.

La DIGESTIONE. I principi nutritivi sono: le proteine, i glucidi, i lipidi, le vitamine, i sali minerali e l acqua. La DIGESTIONE Perché è necessario nutrirsi? Il corpo umano consuma energia per muoversi, pensare, mantenere la temperatura costante, ma anche solo per riposarsi. Il consumo minimo di energia è detto metabolismo

Dettagli

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione nei procarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione nei procarioti Concetti base Nucleoside base purinica o pirimidinica legata alla posizione 1 dell anello pentoso Nucleotide base azotata-pentoso-fosfato Concetti base La trascrizione comporta

Dettagli

Introduzione ai Microarray

Introduzione ai Microarray Introduzione ai Microarray Anastasios Koutsos Alexandra Manaia Julia Willingale-Theune Versione 2.3 Versione italiana ELLS European Learning Laboratory for the Life Sciences Anastasios Koutsos, Alexandra

Dettagli

Le pr p in i c n ip i ali ali st s rategie ie i d regola zio i n o e n d e d ll esp s re p ss s ion ion g ni n c i a n e n i i pr p oc o ariot i i

Le pr p in i c n ip i ali ali st s rategie ie i d regola zio i n o e n d e d ll esp s re p ss s ion ion g ni n c i a n e n i i pr p oc o ariot i i Le principali strategie di regolazione dell espressione genica nei procarioti Regolazione metabolica Nel genoma di un microorganismo sono presenti migliaia di geni (3000-6000). Alcuni geni vengono espressi

Dettagli

Corso di Laurea Specialistica in Biotecnologie Biomolecolari. Corso di Immunologia Molecolare

Corso di Laurea Specialistica in Biotecnologie Biomolecolari. Corso di Immunologia Molecolare Corso di Laurea Specialistica in Biotecnologie Biomolecolari ANTONELLA GROSSO Corso di Immunologia Molecolare ILAN RIESS LA MOLECOLA Interleukin 4 From Wikipedia, the free encyclopedia Interleukin-4, abbreviated

Dettagli

Elettroforesi su gel. L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico.

Elettroforesi su gel. L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico. Elettroforesi su gel L elettroforesi è definita come la migrazione di particelle sotto l influenza di un campo elettrico. La mobilità della particella dipende dalla forza elettrostatica netta che agisce

Dettagli

Il ciclo cellulare e la sua regolazione

Il ciclo cellulare e la sua regolazione Il ciclo cellulare e la sua regolazione Le cellule possono essere classificate in base alla loro capacità di crescere e di dividersi: Cellule che hanno perso la capacità di dividersi (cellule neuronali,

Dettagli

VADEMECUM PER MISURA DELLA VITAMINA D (25-idrossivitamina D e 1,25-diidrossivitamina D)

VADEMECUM PER MISURA DELLA VITAMINA D (25-idrossivitamina D e 1,25-diidrossivitamina D) DAI Diagnostica di Laboratorio - Laboratorio Generale - Direttore Dr. Gianni Messeri Gentile Collega, negli ultimi anni abbiamo assistito ad un incremento delle richieste di dosaggio di vitamina D (25-

Dettagli

13. Anticorpi. (vedi singoli sottocapitoli) I edizione. 13. Anticorpi...1

13. Anticorpi. (vedi singoli sottocapitoli) I edizione. 13. Anticorpi...1 1 13. Anticorpi I edizione (vedi singoli sottocapitoli) 13. Anticorpi...1 13.1. STRUTTURA DEGLI ANTICORPI ED I GENI DELLE IMMUNOGLOBULINE...3 13.1.1. Struttura/funzione degli anticorpi...4 13.1.2. Dominii

Dettagli

I I SEGNALI COSTIMOLATORI DEI LINFOCITI T FEDERICA COLLINO

I I SEGNALI COSTIMOLATORI DEI LINFOCITI T FEDERICA COLLINO I I SEGNALI COSTIMOLATORI DEI LINFOCITI T FEDERICA COLLINO ATTIVAZIONE DEI LINFOCITI T L attivazione dei linfociti T vergini richiede la presenza di una particolare regione di contatto tra le cellule T

Dettagli

Da dove prendono energia le cellule animali?

Da dove prendono energia le cellule animali? Da dove prendono energia le cellule animali? La cellula trae energia dai legami chimici contenuti nelle molecole nutritive Probabilmente le più importanti sono gli zuccheri, che le piante sintetizzano

Dettagli

INFIAMMAZIONE. L infiammazione è strettamente connessa con i processi riparativi! l agente di malattia e pone le basi per la

INFIAMMAZIONE. L infiammazione è strettamente connessa con i processi riparativi! l agente di malattia e pone le basi per la INFIAMMAZIONE Risposta protettiva che ha lo scopo di eliminare sia la causa iniziale del danno cellulare (es. microbi, tossine etc), sia i detriti cellulari e le cellule necrotiche che compaiono a seguito

Dettagli

COMUNICAZIONE TRA CELLULE E AMBIENTE

COMUNICAZIONE TRA CELLULE E AMBIENTE COMUNICAZIONE TRA CELLULE E AMBIENTE 1. LE CELLULE COMUNICANO TRA LORO Le cellule vegetali comunicano attraverso i plasmodesmi. Dato lo spessore della parete cellulare, come possono interagire tra loro

Dettagli

Gli enzimi. L azione degli enzimi è caratterizzata da alcune proprietà fondamentali:

Gli enzimi. L azione degli enzimi è caratterizzata da alcune proprietà fondamentali: Gli enzimi Nel metabolismo energetico le cellule producono notevoli quantità di CO 2 che deve essere eliminata con l apparato respiratorio. Il trasferimento della CO 2 dalle cellule al sangue e da esso

Dettagli

Gli enzimi. Proprietà generali Classificazione e nomenclatura Catalisi enzimatica

Gli enzimi. Proprietà generali Classificazione e nomenclatura Catalisi enzimatica Gli enzimi Proprietà generali Classificazione e nomenclatura Catalisi enzimatica En-zima εν ζυμη nel lievito Enzima termine generico per definire un catalizzatore biologico Tranne che diversamente indicato,

Dettagli

Il sistema endocrino Il sistema endocrino sistema ormonale ghiandole cellule proteiche lipidiche organismo umano sistema nervoso

Il sistema endocrino Il sistema endocrino sistema ormonale ghiandole cellule proteiche lipidiche organismo umano sistema nervoso Il sistema endocrino Il sistema endocrino o sistema ormonale è rappresentato da un insieme di ghiandole e cellule (dette ghiandole endocrine e cellule endocrine) le quali secernono delle sostanze proteiche

Dettagli

Attivazione dei linfociti T

Attivazione dei linfociti T Attivazione dei linfociti T Attivazione linfociti T: caratteristiche generali Eventi extracellulari - Riconoscimento dell antigene - Interazione dei recettori costimolatori Eventi intracellulari - Trasduzione

Dettagli

DA PORTO A., NANINO E., DEL TORRE M., SECHI L.A., CAVARAPE A. CLINICA MEDICA - Azienda Ospedaliero-Universitaria S.Maria Misericordia di Udine

DA PORTO A., NANINO E., DEL TORRE M., SECHI L.A., CAVARAPE A. CLINICA MEDICA - Azienda Ospedaliero-Universitaria S.Maria Misericordia di Udine DA PORTO A., NANINO E., DEL TORRE M., SECHI L.A., CAVARAPE A. CLINICA MEDICA - Azienda Ospedaliero-Universitaria S.Maria Misericordia di Udine VITAMINA D: SINTESI, METABOLISMO E CARENZA Il 40-50% della

Dettagli

Date da 10/2003 a 01/2004 Lavoro o posizione ricoperti Dirigente medico ex I livello, a tempo determinato, Disciplina di Medicina Interna

Date da 10/2003 a 01/2004 Lavoro o posizione ricoperti Dirigente medico ex I livello, a tempo determinato, Disciplina di Medicina Interna Principali attività e medico presso la Medicina e Chirurgia di Accettazione ed Urgenza (MCAU) del Pronto Soccorso Generale P.O. Garibaldi Centro. Attività svolta presso gli ambulatori di Medicina del Pronto

Dettagli

Le cellule staminali pluripotenti (embrionali) Prof. Fulvio Gandolfi Università degli Studi di Milano

Le cellule staminali pluripotenti (embrionali) Prof. Fulvio Gandolfi Università degli Studi di Milano Le cellule staminali pluripotenti (embrionali) Prof. Fulvio Gandolfi Università degli Studi di Milano Facoltà di Medicina Veterinaria Embriologia e Terapia Genica e Cellulare Le cellule staminali adulte:

Dettagli

Alimentazione e salute dell intestino: siamo quello che mangiamo

Alimentazione e salute dell intestino: siamo quello che mangiamo Alimentazione e salute dell intestino: siamo quello che mangiamo La dieta, il microbiota intestinale e la salute digestiva sono intrecciati fra loro. Questi legami e il potenziale benefico dei probiotici

Dettagli

I TUMORI COLORETTALI GIOVANILI ( 40 ANNI) IN 25 ANNI DI UN REGISTRO SPECIALIZZATO

I TUMORI COLORETTALI GIOVANILI ( 40 ANNI) IN 25 ANNI DI UN REGISTRO SPECIALIZZATO Università degli studi di Modena e Reggio Emilia I TUMORI COLORETTALI GIOVANILI ( 40 ANNI) IN 25 ANNI DI UN REGISTRO SPECIALIZZATO Domati F., Maffei S., Kaleci S., Di Gregorio C., Pedroni M., Roncucci

Dettagli

Cosa succede in un laboratorio di genetica?

Cosa succede in un laboratorio di genetica? 12 laboratori potrebbero utilizzare campioni anonimi di DNA per lo sviluppo di nuovi test, o condividerli con altri in quanto parte dei programmi di Controllo di Qualità, a meno che si chieda specificatamente

Dettagli

Finalmente chiarezza sull'originale fermentato da Carica papaya studiato da Luc Montagnier

Finalmente chiarezza sull'originale fermentato da Carica papaya studiato da Luc Montagnier RICERCA APPLICATA / Stress ossidativo, invecchiamento e malattie degenerative Finalmente chiarezza sull'originale fermentato da Carica papaya studiato da Luc Montagnier A cura del Dipartimento Scientifico

Dettagli

Deceduti Regione LOMBARDIA

Deceduti Regione LOMBARDIA Tumore della vescica Di maggior rilievo nei maschi (più di 3/4 dei casi), presenta variazioni geografiche di entità modestissima, minori di ogni altro tipo di carcinoma. Il 9-95% circa è costituito da

Dettagli

PREVENZIONE E SALUTE GLOBALE

PREVENZIONE E SALUTE GLOBALE PREVENZIONE E SALUTE GLOBALE SI PARTE DALLA VITAMINA D Relatore dr Donata Soppelsa Medico di medicina generale Associato alla Società Italiana di Nutriceutica Quali domande? E sufficiente l integrazione

Dettagli

FONDAMENTI DI BIOLOGIA DELLO SVILUPPO

FONDAMENTI DI BIOLOGIA DELLO SVILUPPO FONDAMENTI DI BIOLOGIA DELLO SVILUPPO Grazyna Ptak, PhD, DSc Dipartimento di Scienze Biomediche Comparate Università degli Studi di Teramo Il ciclo della vita: gli stadi dello sviluppo animale 1. specificazione

Dettagli

ORGAN ON A CHIP. Un promettente sostituto alla sperimentazione animale

ORGAN ON A CHIP. Un promettente sostituto alla sperimentazione animale ORGAN ON A CHIP Un promettente sostituto alla sperimentazione animale 1 1.Fasi di sviluppo di un farmaco La ricerca e lo sviluppo di un farmaco sono indirizzate al processo dell identificazione di molecole

Dettagli

OMEOSTASI DEL Ca 2+ e FOSFORO

OMEOSTASI DEL Ca 2+ e FOSFORO OMEOSTASI DEL Ca 2+ e FOSFORO Metabolismo del calcio Il calcio è il minerale più rappresentato nell organismo umano (1000-1200 gr) Il 99% del Ca corporeo si trova nello scheletro e nei denti, per lo più

Dettagli

unità C3. Le cellule crescono e si riproducono

unità C3. Le cellule crescono e si riproducono unità 3. Le cellule crescono e si riproducono Durante l interfase la cellula aumenta di dimensioni sintetizza nuove proteine e nuovi organuli duplica il DN al termine di questi processi la cellula compie

Dettagli

Il fabbisogno alimentare e il ruolo dei nutrienti

Il fabbisogno alimentare e il ruolo dei nutrienti Il fabbisogno alimentare e il ruolo dei nutrienti Le necessità del nostro corpo Cibo e bevande sono i mezzi con cui il nostro organismo si procura le sostanze di cui ha bisogno per le sue attività vitali.

Dettagli

Diversità tra i viventi

Diversità tra i viventi Diversità tra i viventi PROPRIETÀ della VITA La CELLULA CLASSIFICAZIONE dei VIVENTI Presentazione sintetica Alunni OIRM Torino Tutti i viventi possiedono delle caratteristiche comuni Ciascun vivente nasce,

Dettagli

Infatti il glucosio viene bruciato in presenza di ossigeno e l'energia liberata, immagazzinata sotto forma di ATP

Infatti il glucosio viene bruciato in presenza di ossigeno e l'energia liberata, immagazzinata sotto forma di ATP I mitocondri sono gli organuli responsabili della produzione di energia necessaria alla cellula per crescere e riprodursi. Queste reazioni, che nel loro insieme costituiscono il processo di "respirazione

Dettagli

La programmazione di uno studio clinico: dalla domanda al disegno

La programmazione di uno studio clinico: dalla domanda al disegno Metodo epidemiologici per la clinica _efficacia / 1 La programmazione di uno studio clinico: dalla domanda al disegno La buona ricerca clinica Non è etico ciò che non è rilevante scientificamente Non è

Dettagli

Monossido d azoto NO (Nitric Oxide) Messaggero del segnale cellulare. Molecola regolatoria nel sistema nervoso centrale e periferico

Monossido d azoto NO (Nitric Oxide) Messaggero del segnale cellulare. Molecola regolatoria nel sistema nervoso centrale e periferico Monossido d azoto NO (Nitric Oxide) Ruolo biologico: Messaggero del segnale cellulare Molecola regolatoria nel sistema cardiovascolare Molecola regolatoria nel sistema nervoso centrale e periferico Componente

Dettagli

RENATO TOZZOLI, GRAZIANO KODERMAZ SERVIZIO DI MEDICINA DI LABORATORIO OSPEDALE CIVILE, LATISANA (UD) SPOLETO, 08 MAGGIO 2009

RENATO TOZZOLI, GRAZIANO KODERMAZ SERVIZIO DI MEDICINA DI LABORATORIO OSPEDALE CIVILE, LATISANA (UD) SPOLETO, 08 MAGGIO 2009 RENATO TOZZOLI, GRAZIANO KODERMAZ SERVIZIO DI MEDICINA DI LABORATORIO OSPEDALE CIVILE, LATISANA (UD) SPOLETO, 08 MAGGIO 2009 Cisteina di 3 gruppo (176) Unità ripetute ricche di leucina Cisteine di 2 gruppo

Dettagli

Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000 L alta incidenza relativa di Emofilia A è

Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000 L alta incidenza relativa di Emofilia A è Emofilia Malattia ereditaria X cromosomica recessiva A deficit del fatt VIII B deficit del fatt IX Il deficit del fatt VIII prevale (5 volte in più rispetto al IX) Prevalenza nel mondo è di 1:10000-1:50000

Dettagli

VLT. Aminoacidi Caffeina Derivati botanici Vitamine idrosolubili.

VLT. Aminoacidi Caffeina Derivati botanici Vitamine idrosolubili. VLT VLT (leggi Volt) è un gel energizzante il cui effetto si fonda sulla combinazione e sinergia d azione propria dei componenti in esso contenuti. In VLT si ritrovano, difatti, molteplici principi attivi

Dettagli

1 LEZIONE CHE COS E L ALLENAMENTO

1 LEZIONE CHE COS E L ALLENAMENTO 1 LEZIONE CHE COS E L ALLENAMENTO Sono molte le definizioni di allenamento: Definizione generale: E un processo che produce nell organismo un cambiamento di stato che può essere fisico, motorio, psicologico.

Dettagli

Nuove acquisizioni patogenetiche nell osteodistrofia renale.

Nuove acquisizioni patogenetiche nell osteodistrofia renale. Nuove acquisizioni patogenetiche nell osteodistrofia renale. Sequenza di eventi patogenetici (seconda metà anni 70 seconda metà anni 90) IRC deficit di attivazione ridotta escrezione della vitamina D di

Dettagli

Antiossidanti endogeni. fotoprotezione

Antiossidanti endogeni. fotoprotezione Pietro Santoianni Professore Emerito di Dermatologia Docente nel Dottorato di Ricerca in Dermatologia Sperimentale Dipartimento di Patologia sistematica, Sezione di Dermatologia Università di Napoli Federico

Dettagli

I linfomi non-hodgkin

I linfomi non-hodgkin LINFOMA NON HODGKIN I linfomi non-hodgkin (LNH) sono un eterogeneo gruppo di malattie neoplastiche che tendono a riprodurre le caratteristiche morfologiche e immunofenotipiche di una o più tappe dei processi

Dettagli

Il cervello ha bisogno di zucchero. e il cuore pure, ma quale?

Il cervello ha bisogno di zucchero. e il cuore pure, ma quale? Il cervello ha bisogno di zucchero. e il cuore pure, ma quale? Questo vecchio slogan pubblicitario riconduce ad una parziale verità scientifica, oggi più che attuale. E risaputo che parlare di zucchero

Dettagli

L ACQUA : STRUTTURA E PROPRIETA

L ACQUA : STRUTTURA E PROPRIETA L ACQUA : STRUTTURA E PROPRIETA 1. Sostanza più abbondante in tutti gli esseri viventi 2. Più del 70% del peso di tutti gli esseri viventi 3. Influenza la struttura e la proprietà di tutte le molecole

Dettagli

CIN 2 3: CHE FARE? P Cattani. Centro Ginecologia Oncologica Preventiva ULSS 20 - Verona

CIN 2 3: CHE FARE? P Cattani. Centro Ginecologia Oncologica Preventiva ULSS 20 - Verona CIN 2 3: CHE FARE? P Cattani Centro Ginecologia Oncologica Preventiva ULSS 20 - Verona Istologia: diagnosi e gradi della CIN biopsia cervicale o escissione maturazione cell stratificazione cell anormalità

Dettagli

LINEE GUIDA PER LA REVISIONE SISTEMATICA DI LETTERATURA

LINEE GUIDA PER LA REVISIONE SISTEMATICA DI LETTERATURA LINEE GUIDA PER LA REVISIONE SISTEMATICA DI LETTERATURA report tecnico nr. 03/08 v. 1 indice dei contenuti 1. Utilità delle RSL Pag. 1 2. Principali metodi Pag. 2 3. Esempi di RSL Pag. 3 4. Protocollo

Dettagli

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della

La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della La struttura dell RNA Struttura dell RNA mediante analisi comparativa Predizione della struttura secondaria: L algoritmo di Nussinov Predizione della struttura secondaria: Minimizzazione dell energia Un

Dettagli

Cos è un analisi genetica (test genetico)?

Cos è un analisi genetica (test genetico)? 12 Cos è un analisi genetica (test genetico)? Testo modificato dagli opuscoli prodotti dall ospedale Guy s and St Thomas di Londra Luglio 2008 Questo lavoro è sponsorizzato dal Consorzio EU-FP6 EuroGentest,

Dettagli

Bilancia emostatica. Ipercoagulabilità. Ipocoagulabilità. Normale. Trombosi. Emorragie

Bilancia emostatica. Ipercoagulabilità. Ipocoagulabilità. Normale. Trombosi. Emorragie Coagulazione 1 Bilancia emostatica Ipercoagulabilità Ipocoagulabilità Normale Trombosi Emorragie 2 emostasi primaria emostasi secondaria Fattori coinvolti nell emostasi Vasi + endotelio Proteine della

Dettagli

banca dati stringa di ricerca risultati trovati risultati utili referenze Cochrane vitamin K 21 1 Prophylactic vitamin

banca dati stringa di ricerca risultati trovati risultati utili referenze Cochrane vitamin K 21 1 Prophylactic vitamin EVIDENCE REPORT: PROFILASSI CON VITAMINA K NEI NEONATI PER LA PREVENZIONE DELLA MALATTIA EMORRAGICA (a cura di Baiesi Pillastrini Francesca, Battistini Silvia, Parma Dila ) banca dati stringa di ricerca

Dettagli

VITAMINE. Composti organici eterogenei; indispensabili all organismo; non hanno valore energetico; agiscono in dosi minime (LARN: 1-200 mg/die);

VITAMINE. Composti organici eterogenei; indispensabili all organismo; non hanno valore energetico; agiscono in dosi minime (LARN: 1-200 mg/die); VITAMINE Composti organici eterogenei; indispensabili all organismo; non hanno valore energetico; agiscono in dosi minime (LARN: 1-200 mg/die); hanno funzioni specifiche e funzioni comuni, tra cui: - agiscono

Dettagli

Deficit di Mevalonato Chinasi (MKD) (o Sindrome da Iper-IgD)

Deficit di Mevalonato Chinasi (MKD) (o Sindrome da Iper-IgD) Pædiatric Rheumatology InterNational Trials Organisation Deficit di Mevalonato Chinasi (MKD) (o Sindrome da Iper-IgD) Che cos è? Il deficit di mevalonato chinasi è una malattia genetica. E un errore congenito

Dettagli

-uno o più IONI INORGANICI

-uno o più IONI INORGANICI Coenzimi e vitamine Alcuni enzimi, per svolgere la loro funzione, hanno bisogno di componenti chimici addizionali, i COFATTORI APOENZIMA + COFATTORE = OLOENZIMA = enzima cataliticamente attivo Il cofattore

Dettagli

IL SISTEMA NERVOSO. Organizzazione e struttura

IL SISTEMA NERVOSO. Organizzazione e struttura IL SISTEMA NERVOSO Organizzazione e struttura IL SISTEMA NERVOSO. è costituito due tipi cellulari: il neurone (cellula nervosa vera e propria) e le cellule gliali (di supporto, di riempimento: astrociti,

Dettagli

Castrazione e sterilizzazione

Castrazione e sterilizzazione Centro veterinario alla Ressiga Castrazione e sterilizzazione Indicazioni, controindicazioni, effetti collaterali ed alternative Dr. Roberto Mossi, medico veterinario 2 Castrazione e sterilizzazione Castrazione

Dettagli

Gli scambi tra cellula ed ambiente

Gli scambi tra cellula ed ambiente Gli scambi tra cellula ed ambiente Equilibrio osmotico Squilibrio chimico Squilibrio elettrico Equilibrio dinamico Lo scopo dell omeostasi è mantenere l equilibrio dinamico dei compartimenti corporei.

Dettagli

Gli indicatori socio-sanitari. sanitari

Gli indicatori socio-sanitari. sanitari Gli indicatori socio-sanitari sanitari 1 1 INDICATORI SOCIO-SANITARI Misurare: EFFICACIA (rispetto degli obiettivi prefissati) EFFICIENZA (rispetto delle azioni e risorse impegnate) del sistema ospedaliero

Dettagli

FATTORI DELLA COAGULAZIONE

FATTORI DELLA COAGULAZIONE FATTORI DELLA COAGULAZIONE I Fattori della Coagulazione sono un insieme eterogeneo di molecole che prende parte alla cascata coagulativa, in quella che viene chiamata FASE COAGULATIVA del processo emostatico.

Dettagli

MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.)

MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.) Diss. ETH Nr. 13793 MAP-BASED CLONING OF RESISTANCE GENE HOMOLOGUES IN THE Vf -REGION OF THE APPLE (Malus sp.) A dissertation submitted to the SWISS FEDERAL INSTITUTE OF TECHNOLOGY ZÜRICH For the degree

Dettagli

ATTREZZATURE A TEMPERATURA POSITIVA

ATTREZZATURE A TEMPERATURA POSITIVA ANUGA COLONIA 05-09 OTTOBRE 2013 Ragione Sociale Inviare a : all'attenzione di : Padiglione Koelnmesse Srl Giulia Falchetti/Alessandra Cola Viale Sarca 336 F tel. 02/86961336 Stand 20126 Milano fax 02/89095134

Dettagli

IMAGING BIO_MOLECOLARE con DaTSCAN

IMAGING BIO_MOLECOLARE con DaTSCAN IMAGING BIO_MOLECOLARE con DaTSCAN Stelvio Sestini, MD, PhD Unità di Medicina Nucleare - USL4 Prato Università degli Studi di Firenze Concetto 1. Le M. Neurodegenerative sono in aumento Concetto 2. Le

Dettagli

Pubertà e Deficit di Ormone della Crescita. Serie N. 3

Pubertà e Deficit di Ormone della Crescita. Serie N. 3 Pubertà e Deficit di Ormone della Crescita Serie N. 3 Guida per il paziente Livello: medio Pubertà e Deficit di Ormone della Crescita - Serie 3 (Revisionato Agosto 2006) Questo opuscolo è stato prodotto

Dettagli

5. Utilizzo e applicazioni attuali della genomica in Italia

5. Utilizzo e applicazioni attuali della genomica in Italia 5. Utilizzo e applicazioni attuali della genomica in Italia Attualmente in Italia la genomica per malattie complesse ha trovato un applicazione pratica in un numero molto ristretto di situazioni. I test

Dettagli

Salute intestinale in avicoltura Il mondo interiore

Salute intestinale in avicoltura Il mondo interiore Agosto 2013 Salute intestinale in avicoltura Il mondo interiore Dr. Richard A. Bailey, Poultry Health Scientist Sommario Introduzione Flora Intestinale Mantenere in equilibrio la salute intestinale Conclusioni

Dettagli

CORSO INTEGRATO DI GENETICA E BIOLOGIA MOLECOLARE ESERCIZI DI GENETICA

CORSO INTEGRATO DI GENETICA E BIOLOGIA MOLECOLARE ESERCIZI DI GENETICA CORSO INTEGRATO DI GENETICA E BIOLOGIA MOLECOLARE ESERCIZI DI GENETICA (1) Dato il genotipo AaBb: quali sono i geni e quali gli alleli? Disegnate schematicamente questo genotipo con i geni concatenati

Dettagli

Predire la struttura terziaria

Predire la struttura terziaria Predire la struttura terziaria E di gran lunga la predizione più complessa che si possa fare su una proteina. Esistono 3 metodi principali di predizione: 1 - Homology modelling: se si conoscono proteine

Dettagli

La nutrizione nei primi 1000 giorni. Contributo n 70

La nutrizione nei primi 1000 giorni. Contributo n 70 Mediterranean Nutrition Group La nutrizione nei primi 1000 giorni Contributo n 70 MeNu GROUP MediterraneanNutrition LA NUTRIZIONE NEI PRIMI 1000 GIORNI UN OPPORTUNITÀ PER PREVENIRE SOVRAPPESO E OBESITÀ

Dettagli

Il giardino nella macchina

Il giardino nella macchina Idee per una rilettura Il giardino nella macchina La nuova scienza della vita artificiale Claus Emmeche Bollati Boringhieri, 1996 È possibile la vita artificiale? In che modo gli strumenti offerti dalla

Dettagli

Conduzione di uno studio epidemiologico (osservazionale)

Conduzione di uno studio epidemiologico (osservazionale) Conduzione di uno studio epidemiologico (osservazionale) 1. Definisco l obiettivo e la relazione epidemiologica che voglio studiare 2. Definisco la base dello studio in modo che vi sia massimo contrasto

Dettagli

I FABBISOGNI NUTRIZIONALI NELL ANZIANO. Chivasso, Ciriè, Ivrea 2011

I FABBISOGNI NUTRIZIONALI NELL ANZIANO. Chivasso, Ciriè, Ivrea 2011 I FABBISOGNI NUTRIZIONALI NELL ANZIANO Chivasso, Ciriè, Ivrea 2011 FABBISOGNI NUTRIZIONALI NELL ANZIANO Proteine: 1-1,2 g/kg/die; Calorie: 20-30/kg/die Es.: anziano di 60 kg 60-72 g di proteine; 1200-1800

Dettagli

Ereditarietà legata al cromosoma X

Ereditarietà legata al cromosoma X 16 Ereditarietà legata al cromosoma X Testo modificato dagli opuscoli prodotti dall ospedale Guy s and St Thomas di Londra e dal Parco tecnologico di Londra IDEAS Genetic Knowledge Park in accordo alle

Dettagli

Sindrome di Blau/Sarcoidosi ad esordio precoce (EOS)

Sindrome di Blau/Sarcoidosi ad esordio precoce (EOS) Pædiatric Rheumatology InterNational Trials Organisation Che cos é? Sindrome di Blau/Sarcoidosi ad esordio precoce (EOS) La sindrome di Blau è una malattia genetica. I pazienti affetti presentano rash

Dettagli

Una proteina nella rete: Caccia al tesoro bioinformatica

Una proteina nella rete: Caccia al tesoro bioinformatica Una proteina nella rete: Caccia al tesoro bioinformatica Nel corso di questa attivita utilizzeremo alcune delle piu importanti banche dati disponibili in rete per cercare informazioni su una proteina.

Dettagli

Luc Montagnier IL DNA TRA FISICA E BIOLOGIA ONDE ELETTROMAGNETICHE DAL DNA E ACQUA

Luc Montagnier IL DNA TRA FISICA E BIOLOGIA ONDE ELETTROMAGNETICHE DAL DNA E ACQUA IL PRESENTE TESTO E UNA SINTESI DEL TESTO COMPLETO EDITO DA LA MEDICINA BIOLOGICA, n.4, 2010, WWW.MEDIBIO.IT Luc Montagnier IL DNA TRA FISICA E BIOLOGIA ONDE ELETTROMAGNETICHE DAL DNA E ACQUA Lo sviluppo

Dettagli

Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico

Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico Il valore dell analisi prenatale non invasiva (non-invasive prenatal testing, NIPT). Un supplemento per il flipbook del consulente genetico Le NIPT utilizzano DNA libero. Campione di sangue materno DNA

Dettagli

acqua Bevi ogni giorno in abbondanza

acqua Bevi ogni giorno in abbondanza 5. acqua Bevi ogni giorno in abbondanza 5. Bevi ogni giorno acqua in abbondanza Nell organismo umano l acqua rappresenta un costituente essenziale per il mantenimento della vita, ed è anche quello presente

Dettagli

ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico. Linea di ricerca. Via Gattamelata, 64 35128 Padova

ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico. Linea di ricerca. Via Gattamelata, 64 35128 Padova ISTITUTO ONCOLOGICO VENETO Istituto di ricovero e cura a carattere scientifico Linea di ricerca Via Gattamelata, 64 35128 Padova Linea di ricerca 8 Immunologia dei tumori e approcci terapeutici Innovativi

Dettagli

Fonti alimentari di Inositolo

Fonti alimentari di Inositolo Fonti alimentari di Inositolo Agrumi Cereali integrali Frutta secca(arachidi) Semi(germe di grano) Legumi(fagioli) Lievito di birra Gli alimenti freschi contengono molto più Inositolo rispetto ai prodotti

Dettagli

Dall inizio alla fine, un binomio inscindibile: Calcio piu vit. A e D

Dall inizio alla fine, un binomio inscindibile: Calcio piu vit. A e D Dall inizio alla fine, un binomio inscindibile: Calcio piu vit. A e D IL CALCIO La definizione classica per questo elemento e quella di essere un Metallo Alcalino Terroso. Non si trova libero in Natura,

Dettagli

Liponax Sol. Innovativa formulazione LIQUIDA. ad elevata biodisponibilità. Acido R (+) a-lipoico

Liponax Sol. Innovativa formulazione LIQUIDA. ad elevata biodisponibilità. Acido R (+) a-lipoico Innovativa formulazione LIQUIDA ad elevata biodisponibilità L acido a lipoico è una sostanza naturale che ricopre un ruolo chiave nel metabolismo energetico cellulare L acido a lipoico mostra un effetto

Dettagli

Differenziamento = Creazione cellule specializzate. Il tuo corpo ha bisogno delle cellule staminali

Differenziamento = Creazione cellule specializzate. Il tuo corpo ha bisogno delle cellule staminali Differenziamento = Creazione cellule specializzate Cos è una cellula staminale? Cosa mostra la foto Un pezzo di metallo e molti diversi tipi di viti. Dare origine a diversi tipi di cellule è un processo

Dettagli

PRINCIPI INTERPRETATIVI IN CITOLOGIA ONCOLOGICA

PRINCIPI INTERPRETATIVI IN CITOLOGIA ONCOLOGICA Quaderni di dermatologia, Anno 7, n. 1, Giugno 2002 7 PRINCIPI INTERPRETATIVI IN CITOLOGIA ONCOLOGICA DAVIDE DE LORENZI Medico Veterinario, Specialista in Clinica e Patologia degli Animali da Affezione

Dettagli

Presentando le cellule staminali

Presentando le cellule staminali Presentando le cellule staminali 1 Alcune note prima di iniziare Questa presentazione va considerata come uno strumento flessibile per scienziati, divulgatori scientifici ed insegnanti. Non tutte le diapositive

Dettagli

CARATTERIZZAZIONE DI DUE ANTICORPI MONOCLONALI UMANI CROSS-NEUTRALIZZANTI DIRETTI CONTRO LA GLICOPROTEINA E2 DEL VIRUS DELL EPATITE C

CARATTERIZZAZIONE DI DUE ANTICORPI MONOCLONALI UMANI CROSS-NEUTRALIZZANTI DIRETTI CONTRO LA GLICOPROTEINA E2 DEL VIRUS DELL EPATITE C UNIVERSITA POLITECNICA DELLE MARCHE FACOLTA DI MEDICINA E CHIRURGIA Dottorato di Ricerca in Patologie Immunometaboliche, degenerative e infettive CARATTERIZZAZIONE DI DUE ANTICORPI MONOCLONALI UMANI CROSS-NEUTRALIZZANTI

Dettagli

UNIVERSITA DEGLI STUDI MAGNA GRAECIA DI CATANZARO DIPARTIMENTO DI SCIENZE DELLA SALUTE. Programmazione didattica a.a. 2014/2015

UNIVERSITA DEGLI STUDI MAGNA GRAECIA DI CATANZARO DIPARTIMENTO DI SCIENZE DELLA SALUTE. Programmazione didattica a.a. 2014/2015 UNIVERSITA DEGLI STUDI MAGNA GRAECIA DI CATANZARO DIPARTIMENTO DI SCIENZE DELLA SALUTE CORSO DI LAUREA IN BIOTECNOLOGIE Classe L2 Programmazione didattica a.a. 2014/2015 Per l anno accademico 2014-2015

Dettagli

Il desiderio insoddisfatto di un figlio: le cause

Il desiderio insoddisfatto di un figlio: le cause Il desiderio insoddisfatto di un figlio: le cause Si parla di "sterilità" quando dopo un anno di rapporti sessuali regolari non è ancora intervenuta una gravidanza. Le cause di una mancanza di figli non

Dettagli

Scheda dei Dati di Sicurezza Secondo le Direttive 91/155/CEE

Scheda dei Dati di Sicurezza Secondo le Direttive 91/155/CEE 1. Identificazione della sostanza/preparato e della societá o ditta 1.1 Identificazione della sostanza o del preparato Denominazione: Mercurio II Solfato soluzione 200 g/lin acido solforico diluito 1.2

Dettagli