Struttura, funzione e specificità tessutale dei geni delle mucine

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Struttura, funzione e specificità tessutale dei geni delle mucine"


1 Struttura, funzione e specificità tessutale dei geni delle mucine c. BOTIP, E. SEREGNP, S. MASSARON', A.MARTINETIP, A. BONANATE', D. CANTARELLAI, A. CAPOBIANC02, E. BOMBARDIERI' 'Divisione di Medicina Nucleare, Istituto Nazionale per lo Studio e la Cura dei Tumori, MILANO 2 Laboratorio Analisi Cliniche, Ospedale S. Carlo, POTENZA INTRODUZIONE Le differenti molecole della famiglia delle mucine possiedono precise caratteristiche biochimiche in comune (1). Innanzitutto, le mucine sono costituite da un core proteico (apomucina) che presenta un peso molecolare variable da 40kD a 600kD. Tale scheletro proteico contiene un elevato numero di residui di treonina e serina cui sono legate preferenzialmente le catene glucidiche mediante legame 1-3 O-glicosidico (2). I carboidrati costituiscono più de1l'80% della molecola e la lunghezza delle catene glucidiche laterali varia da uno a più di 20 residui; i principali glucidi sono l'n-acetilgalattosammina, l'n-acetilglucosammina, il galattosio, il fucosio ed infine l'acido sialico (3, 4). Differenti geni apomucinici sono stati recentementi identificati ed è stato possibile evidenziare la loro struttura comune costituita da una porzione centrale affiancata da sequenze 5'-3' (5). Il dominio centrale dello scheletro proteico costituisce più dell'80% dell'intera sequenza aminoacidica codificata, ed è composta da sequenze ripetute ("tandem repeats") variabili per numero e composizione caratterizzate da un elevato numero di residui di serina, treonina e prolina. L'omologia di sequenza del dominio centrale fra i differenti membri della famiglia delle mucine è limitata e ciò significa che la sequenza e le dimensioni del dominio interno sono uniche per ogni tipo di mucina. Omologie di sequenza parziali sono invece presenti fra le differenti mucine nei domini delle regioni N e C- terminali. Molecole mucino-simili sembrano essere largamente diffuse in natura, ma la nostra conoscenza a riguardo è decisamente limitata a causa delle scarse informazioni presenti in letteratura per le specie non appartenenti alla classe dei mammiferi. Ad esempio, geni codificanti per molecole affini alle mucine negli eucarioti inferiori sono stati descritti in Leishmania major e Trypanosoma cruzi (6-8); in particolare in quest'ultimo organismo, che rappresenta l'agente eziologico della malattia di Chagas, è stato osservato che glicoproteine simili alle mucine svolgono un ruolo importante nell'interazione con la superficie delle cellule di mammifero durante il processo di invasione. Molto recentemente una glicoproteina mucino-simile con un peso molecolare apparente di 90kD, denominata mucina D, è stata descritta e parzialmente caratterizzata in cellule embrionali di Drosophila melanogaster (9). In questa s~e cie la mucina D sembra essere coinvolta nel processo di muta poichè la sua sintesi è regolata dall'ormone della muta degli insetti. Nei mammiferi le mucine sono largamente rappresentate, essendo riscontrabili nella maggior parte delle cellule epiteliali secretorie polarizzate (1, 2). Molecole simili alle mucine sono state anche osservate sulla superficie di cellule non-epiteliali, in particolare di origine ematica (10-14). Studi immunoistochimici e biochimici hanno consentito di ottenere interessanti informazioni riguardo alla struttura della componente carboidratica delle mucine epiteliali, ma fino a poco tempo fa molto poco si sapeva sulla struttura e composizione delle apomucine. Infatti l'approccio biochimico si è dimostrato inadeguato in quanto la maggior parte delle procedure di studio si basavano sulla deglicosilazione delle mucine che causava una degradazione massiva dello scheletro apomucinico (4, 15-18). Successivamente, l'avvento delle tecniche di biologia molecolare ha consentito finalmente di fare luce sulla componente apomucinica e i geni che la codificano. Questi studi hanno rivelato l'esistenza di differenti geni mucinici che codificano per almeno 8 apomucine (denominate rispettivamente MUC1, MUC2, MUC3, MUC4, MUC5, MUC5AC, MUC5B, MUC6 e MUC7). Grazie ai risultati ottenuti da studi genetici, immunologici e biochimici, è oggi possibile classificare le mucine in due gruppi principali : mucine associate alle membrane cellulari e mucine secretorie. A loro volta le mucine secretorie possono essere suddivise in due altri sottogruppi in base alla loro funzione fisiologica, cioè che vadano o meno a costituire il gel viscoso ch e ricopre la superficie dei tratti respiratorio, gastrointestinale e genitourinario. Questo gel mucinoso svolge importanti funzioni che includono il mantenimento della viscosità e la protezione contro insulti meccanici, chimici, fisici, biologici e contro l'azione di enzimi proteolitici e di variazione di ph (19-21). Di seguito verranno analizzate e discusse le principali caratteristiche delle differenti mucine, con particolare enfasi nei riguardi delle loro rispettive strutture, funzioni ed epressione dei geni che le codoficano. MUC1 MUC1 è tra le mucine associate alla membrana la più conosciuta, ed è chiamata anche "polymorphic epithelial mucin" (PEM) o "episialina". Il gene, che è stato il primo gene mucinico ad essere clonato e sequenziato nell'uomo e nei topi, è localizzato sul cromosoma 1 q21-24 e codifica per una glicoproteina ad elevato PM ( kd) di tran- LlGAN D ASSAY VOL. 1 NUMERO 4 ANNO 1996

2 smembrana altamente glicosilata (22-26). La mucina MUC1 risulta espressa in molti tessuti epiteliali normali (mammella, pancreas, polmone) ed in modo aberrante nei carcinomi di questi distretti (23-25, 27, 28). Il dominio centrale è caratteristico dei geni mucinici ed è costitutito da un numero variabile di tandem repeats (VNTR). L'analisi genica di MUC1 utilizzando un cdna ha rivelato la presenza di 7 esoni. Nel gene possono essere identificate 4 regioni: una regione N-terminale contenente una sequenza segnale idrofobica; un dominio centrale costitutito dalle tandem repeats; una regione C-terminale che codifica sequenze transmembrana e una porzione citoplasmatica di 69 aminoacidi. Il dominio centrale VNTR è localizzato nel secondo esone e consiste di 60 paia di basi ripetute che codificano per tandem repeats costituite da 20 aminoacidi (tabella 2). In ogni tandem repeat esistono 5 potenziali siti di O-glicosilazione, rappresentati dagli aminoacidi serina e treonina. MUC1 presenta un elevato grado di eterogeneità individuale sia a livello genico che di apomucina nel numero di tandem repeats, pertanto questo gene è altamente polimorfico nella popolazione (29-31). Questo polimorfismo suggerisce che la lunghezza del dominio VNTR è essenziale solo per il legame degli O-glicani ma non per la funzione della mucina stessa. In Fig. 1 è riportata la struttura del gene MUC1 e di altri due geni mucinici MUC2 e MUC5AC. Nella tabella 1 sono invece riportate le principali caratteristiche delle mucine epiteliali fino ad ora identificate. Riguardo alla biosintesi, è stato osservato che la molecola è inizialmente sintetizzata come un precursore ad alto peso molecolare nel reticolo endoplasmico; poi il precursore subisce un taglio proteolitico a carico della regione C-terminale della molecola con la conseguente formazione di due prodotti che rimangono associati, sebbene non siano legati da legami covalenti. Il primo prodotto, derivato dalla regione N-terminale, comprende la maggior parte del dominio extracellulare, mentre il secondo, più piccolo, è composto da soli 65 aminoacidi del dominio extracellulare (2, 32-35). E' probabile che tagli enzimatici addizionali siano necessari per il rilascio di MUC1 dalla superficie cellulare e che avvengano sulla superficie cellulare stessa o durante il processo di riciclaggio di proteine di membrana. E' stato dimostrato che le regioni transmembrana e citoplasmatica dell'apomucina MUC1 sono altamente conservate nella specie umana e in altre specie di mammifero, e ciò suggerisce un ruolo funzionale importante di queste regioni. In particolare è stato osservato che il dominio intracellulare C-terminale interagisce con i filamenti di actina del citoscheletro. Inoltre il dominio citoplasmatico di MUC1 è fortemente fosfori lato in serina e tale fosforilazione può essere aumentata mediante trattamento con vari fattori; questa evidenza suggerisce che la molecola può essere coinvolta nel trasferimento di segnali dall'ambiente esterno al citoplasma; questi segnali potrebbero essere di non-adesione e portare quindi alla perdita dei contatti cellula-cellula (36). Tuttavia su questo punto esistono delle controversie. Alcuni Autori ritengono infatti che MUC1 abbia funzioni antiadesive mediate tramite l'ingombro sterico e una carica globale negativa per la presenza dei residui di acidi sialici (36, 37). Tuttavia l'evidenza che il dominio extracellulare protru- de nm sopra la membrana plasmatica estendendosi maggiormente verso lo spazio pericellulare rispetto ad altre componenti, induce a pensare che la molecola possieda proprietà adesive favorendo l'adesione con quelle cellule che possiedono appropriati controrecettori. Questa ipotesi sembra essere confermata da un lavoro molto recente di Regimbald (38), in cui è stato dimostrato che MUC1 nelle cellule di carcinoma mammario rappresenterebbe il ligando per la molecola di adesione intercellulare endoteliale ICAM-1; quindi la mucina di membrana MUC1 medierebbe l'adesione delle cellule tumorali alle cellule endoteliali attraverso ICAM-1 e tale interazione può essere il momento critico nel processo di diffusione metastatica sistemica nel carcinoma mammario. Una esaltata espressione della mucina MUC1 d'altro canto può permettere alle cellule tumorali di eludere il sistema immunitario sia creando un possibile stato immunosoppressivo mediante induzione di un'anergia delle cellule-t, sia bloccando stericamente l'accesso delle cellule immunitarie effettrici verso altre componenti della membrana plasmatica delle cellule neoplastiche (39-41). Questa ipotesi spiegherebbe la prognosi sfavorevole associata ad una overespressione di MUC1 osservata in certi tumori umani. Vari studi sono attualmente in corso con l'obiettivo di identificare i meccanismi ed i fattori coinvolti nella regolazione dell' espressione genica di MUC1. Nella regione non codificante 5'(promotore) di questo gene sono state identificate numerose sequenze regolatorie. Inoltre nel gene sono stati descritti differenti siti di legame potenziale per fattori di trascrizione (es. SP1) e possibili sequenze consenso per il legame dei complessi recettoriali estrogenici e progestinici (42-44). Queste evidenze suggeriscono che l'espressione del gene MUC1 possa essere regolata dagli ormoni sessuali. Tale ipotesi ha trovato conferma in studi condotti sull'endometrio umano e di topo. Nell'endometrio umano i livelli di mrna specifico sono risultati bassi nella fase proliferativa e aumentano significativamente durante la fase secretoria, con una massima concentrazione nella fase d'impianto (45). Questo depone per una stimolazione della espressione del gene MUC1 da parte del progesterone esercitata in maniera diretta od indiretta. Nell'endometrio del topo la situazione è esattamente opposta, dove i più elevati livelli di MUC1 mrna si riscontrano nella fase estrogenica e pre-estrogenica, cioè quando i livelli ematici di estrogeni sono al loro massimo. I livelli più bassi di mrna si osservano invece nella fase d'impianto e durante questa fase l'espressione di MUC1 sembra modulata in senso negativo dal progesterone (46). Quindi è probabile che nel topo MUC1 agisca da barriera contro l'impianto dell'ovulo e che una diminuzione di espressione sia necessaria per generare una mucosa uterina recettiva. Anche il nostro gruppo, utilizzando come modello di studio cellule di carcinoma mammario ormone-dipendenti MCF7, si è dedicato allo studio in vitro della regolazione della espressione genica di MUC1 da parte di ormoni steroidei (estradiolo e progesterone) e di siero fetale privato della componente steroidea (47). I risultati nelle nostre mani indicano che i livelli di MUC1 mrna, determinati con la tecnica di northern-blot, sono maggiormente elevati in cellule coltivate in un medium contenente una concentra- LlGAND AS SAY VOL. 1 NUMERO 4 ANNO 1996

3 Tabella i Principali caratteristiche delle mucine e dei loro prodotti Gene Localizzazione cromosomica Lunghezza tandem repeats (n. aa) Mucina codificata MUCI Iq21 20 Secretoria; di membrana MUC2 llpl5 233 Secretoria; costitutiva del gel MUC3 7q22 17 Secretoria; costitutiva del gel MUC4 3q29 16 Secretoria MUC5AC llpls 8 Secretoria; costitutiva del gel MUC5B IlplS variabile Secretoria; costituti va del gel MUC6 llpls 169 Secretoria; non costitutiva del gel MUC Secretoria; non costitutiva del gel Tabella 2 Sequenze aminoacidiche delle unità tandem repeats Gene MUCI MUC2 MUC3 MUC4 MUCSC MUC5B MUC6 MUC7 Sequenza GSTAPPAHGVTSAPDTRPAP PTTTPITTTTTDTPPPTPTGTQT HSTPSFTSSITTTETTS TSSASTGHATPLPVTD TTSTTSAP VARIABILE SPFSSTGPNTA TSFQTTTTYPTPSHPQTTLPTHVPPFSTSL VTPSTGTVITPTHA WM A TSAS IHSTPT GTIPPPTTLKA TGSTHTAPPMTPTTSGTSQAHSSFST AKTSTSLHSHTSSTHHPEVTPTSTTTITPNP TSTGTSTPVHATTSATSSRLPTPFTTHSPPTGS TTAAPPTPSATTPAPPSSSAPPG zione 10% di siero fetale privo di steroidi, rispetto ai livelli di mrna riscontrabili in cellule coltivate in medium contenente solo il 2% di siero. Non è chiaro quale sostanza presente nel siero eserciti un effetto stimolatorio su MUC1, ma è altamente probabile che sia coinvolto l'lnsulin-like growth factor-1 (IG F-1), dal momento che recettori per l'igf sono stati identificati nelle cellule MCF7 e che questo fattore di crescita risulta estremamente importante per la proliferazione delle cellule di carcinoma mammario e per il loro comportamento biologico. Per quanto riguarda l'estradiolo ed il progesterone, noi non abbiamo osservato alcuna variazione dei livelli di mrna specifico in cellule trattate a differenti concentrazioni di tali steroidi. Tuttavia la mancanza di una "up-regulation" osservabile può essere correlata al fatto che i tempi utilizzati nel nostro studio siano stati troppo lunghi (dal momento che una possibile stimolazione della espressione genica può verificarsi per tempi limitati solo nelle prime fasi del trattamento), oppure la concentrazione di siero usata (2%) che non è ottimale e non ha consentito una apprezzabile regolazione genica. tandem repeat è composto da 23 aminoacici con 14 siti potenziali di glicosilazione (tabella 2). Oltre al dominio centrale che codifica per i tandem repeats, è presente anche un altro dominio di 347 aminoacidi che codifica tandem repeats ad elevato contenuto di serina, treonina e ( MUC1 ) ( MUC2 ) ( MUC5AC ) MUC2 Il gene MUC2 codifica per una tipica mucina costitutiva del gel viscoso. Il cdna di MUC2 è stato isolato da una libreria genomica ottenuta da tessuto intestinale umano (48, 49). Analizzando la organizzazione del gene MUC2, si riscontrano sia omologie sia differenze rispetto al gene MUC1. Analogamente a MUC1, MUC2 presenta un dominio centrale VNTR ricco in serina, treonina e prolina. Ogni FiGURA i Organizzazione schematica dei geni mucinici MUCi, MUC2 e MUC5AC. VNTR: numero variabile di tandem repeats; TMD: dominio tram-membrana; CTD: dominio citoplasmatico; TSRD: dominio ad alto contenuto di treonina/cisteina; CRD: dominio ad alto contenuto di cisteina. ligand ASSAY VOL. 1 NUMERO 4 ANNO 1996

4 prolina. La caratteristica più importante del gene MUC2 comunque è rappresentata dalla presenza di quattro domini ad elevato contenuto di cisteina. Questi domini (3 nella regione N-terminale e 1 nella regione C-terminale) sono costitutiti da elementi ripetitivi che presentano un elevato grado di omologia col dominio codificante il fattore di pre-pro von Willebrand (vwf) (dominio D). I domini D sono coinvolti nella oligomerizzazione del vwf e del suo immagazzinamento negli organelli di accumulo (corpi di Weibel-Palade). E' molto probabile che i domini D nel gene MUC2 svolgano un ruolo analogo dei domini D del pre-pro vwf: in particolare i residui nella regione D sono coinvolti nella formazione di ponti disolfuro intra- ed extra molecolari. Di particolare rilievo è il fatto che il gene MUC2 è localizzato in un locus sul cromosoma 11p15, vicino ai geni che codificano le mucine MUC5AC, MUC5B e MUC6. Tutti questi geni risultano espressi nelle cellule in cui immunoistochimicamente è riscontrabile del muco. Pertanto qj.leste evidenze suggeriscono che questi geni mucinici sul cromosoma 11 p15 farebbero parte di una famiglia poligenica i cui membri codificano per mucine secretorie costitutive il gel di rivestimento. MUC2 è la mucina predominante nel tessuto intestinale dove viene prodotta dalle cellule caliciformi mucipare. Alcuni dettagli sono stati ottenuti riguardo alla sintesi della glicoproteina (50-52). Innanzitutto, MUC2 è sintetizzata dapprima a livello del reticolo endoplasmico ruvido (RER) come precursore proteico con un peso molecolare apparente di 600 kd e con un elevato contenuto di mannosio; molto probabilmente anche il processo di oligomerizazione avviene nel RER. Successivamente MUC2 è poi trasportata nell'apparato di Golgi dove avvengono le O-glicosilazioni e l'aggiunta di residui di acido sialico, di fucosio e solfati. La molecola neosintetizzata viene quindi immagazzinata in vescicole che poi matureranno in granuli definitivi di accumulo durante il trasporto verso la porzione apicale della cellula. Il contenuto dei granuli verrà alla fine riversato nel lume intestinale per esocitosi. Alcuni studi recenti, in cui come modello è stata utilizzata una linea cellulare di adenocarcinoma del colon umano, hanno dimostrato come la secrezione di MUC2 possa avvenire sia in condizioni basali e regolate, che in condizioni stimolate e non regolate. Varie sostanze hanno la capacità di stimolare la secrezione della mucina, tra le quali quelle colinergiche sembrano rivestire il ruolo più importante (53, 54). MUC3 Il gene che codifica per la mucina MUC3 è molto grande ed è localizzato sul cromosoma 7q22 (55, 56). Ogni tandem repeat del dominio centrale è composto da 51 nucleotidi che codificano un peptide ripetitivo di 17 aminoacidi con 12 siti potenziali di glicosilazione (tabella 2). Molto poco si sa riguardo alla sintesi ed epressione di MUC3. L'apomucina MUC3 è prodotta dalle cellule caliciformi mucipare e, in quantità maggiori, dalle cellule intestinali assorbenti (57, 58). A differenza di MUC2, la mucina MUC3 non viene immagazzinata in granuli, ma probabilmente in microvescicole che rilasciano il contenuto nel glicocalice o direttamente nel lume intestinale. Studi di immunoistochimica e di ibridizzazione in situ indicano che nelle cellule intestinali assorbenti l'espressione di MUC3 è regolata spazialmente (59) ; infatti le cellule epiteliali cominciano ad esprimere MUC3 durante la migrazione dagli strati inferiori delle cripte del Lieberkuhn verso la superficie del colon. MUC4 Il gene MUC4 è stato isolato da una libreria di cdna estratto da tessuto bronchiale (60-62). Il gene è localizzato sul cromosoma 3q29 e anch'esso presenta la regione VNTR. Ogni tandem repeat è composta da 16 aminoacidi con 8 siti potenziali di glicosilazione (tabella 2). Anche per il gene MUC4 le informazioni riguardo la struttura e la biologia di questa mucina non sono molte. I dati disponibili indicano comunque che MUC4 è una mucina secretoria sintetizzata dalla maggior parte delle cellule epiteliali e ghiandolari dei tratti respiratorio, digestivo e genito-urinario. MUC5 Oltre a MUC4 altri 3 cdna sono stati ottenuti dalla mucosa umana tracheobronchiale e mappati sul cromosoma 11 p15 (60,63). Questi tre geni sono stati chiamati, per la loro origine comune, MUC5A, MUC5B e MUC5C, rispettivamente. Ulteriori studi hanno dimostrato che MUC5A e MUC5C fanno parte di uno stesso gene, denominato MUC5AC e che questo gene è differente da MUC5B. Il gene MUC5AC è preferenzialmente espresso nel tratto respiratorio e nelle mucose gastrica (antro e fondo) e riproduttiva; per contro il gene MUC5B è fortemente espresso nelle ghiandole bronchiali. Nel gene MUC5AC è possibile distinguere un dominio VNTR composto di sequenze ripetute di 24 paia di basi che codificano per la sequenza aminoacidica TTVTIAP (64, 65) (tabella 2). Oltre al dominio VNTR, nella proteina MUC5AC sono presenti vari domini ricchi in cisteina. E' probabile che questi domini ad alto contenuto cisteinico svolgano un ruolo nel processo di polimerizzazione, analogamente a quanto descritto per il gene MUC2. In ogni caso comunque, a differenza di MUC2, i domini ricchi in cisteina sono inseriti nel dominio VNTR o in un dominio non-ripetitivo ricco in treonina/serina, per cui nella struttura dell'apomucina MUC5AC è possibile riconoscere un grande dominio altamente glicosilato che contiene dei subdomini ricchi in cisteina ma scarsamente glicosilati. Il gene MUC5B presenta una caratteristica unica rispetto agli altri geni mucinici; infatti è l'unico gene mucinico umano ad esibire lunghezze variabili delle unità nucleotidiche ripetute nel dominio VNTR. Il significato biologico di questo peptide degenerato è tuttora ignoto. MUC6 Il gene MUC6 è stato isolato e caratterizzato usando una libreria di cdna da tessuto gastrico umano (66). Oltre ai geni MUC2, MUCAC e MUC5B, MUC6 è il quarto gene ad essere localizzato nel locus 11 p15. La sequenza del cdna è caratterizzata dalla presenza di un dominio VNTR di cui la singola unità ripetuta è lunga 507 nucleotidi (169 aminoacidi) (tabella 2). La lunghezza della singola unità ripetuta rende MUC6 abbastanza peculiare fra le mucine. L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

5 Infatti, la lunghezza del tandem repeat risulta 5 volte superiore rispetto alle unità ripetute nelle altre mucine umane. Inoltre, il dominio VNTR è costituito da varie unità, con la conseguenza che l'apomucina MUC6 è molto grande. Osservazioni biochimiche suggeriscono che lo scheletro proteico di MUC6 abbia un PM superiore a 600kO, che, fra quelli riportati fino ad ora per le apomucine, è il più elevato. MUC6 e MUC5AC sono le due specie maggiormente rappresentate nello stomaco. Studi di immunoistochimica, comunque, hanno dimostrato che la distribuzione tessutale di queste due mucine è differente e rispettivamente esclusiva (67). Infatti, MUC5AC è sintetizzata dalla superficie delle cellule mucose dell'antro e del fondo, mentre MUC6 è prevalentemente espressa nelle cellule mucose delle ghiandole gastriche e nelle cellule delle ghiandole piloriche. Poichè le cellule epiteliali mucose gastriche producono una mucina neutra e le ghiandole mucose gastriche producono una mucina acida, è molto probabile che MUC5AC e MUC6 rappresentino i rispettivi scheletri proteici. MUC7 Il gene MUC7, demoninato anche MG2, è stato recentemente clonato e sequenziato usando una libreria genomica di cona da ghiandola salivare (68). MUC7 è localizzato sul cromosoma 4 e contiene tandem repeats di 23 residui aminoacidici (tabella 2). Inoltre due residui di cisteina precedono i tandem repeats. La più vistosa caratteristica di MUC7 è il suo basso peso molecolare. La regione trascritta infatti, comprendente 1131 nucleotidi, codifica una proteina di soli 377 aminoacidi, con un peso molecolare apparente di 39 ko. I primi 20 residui costituisco il pepetide principale, mentre i rimanenti aminoacidi costituiscon la proteina secretoria. La molecola è secreta come monomero e pertanto i due residui di cisteina, localizzati prima del dominio delle tandem repeats, sono probabilmente coinvolti nei ponti disolfuro intramolecolari. La espressione di MUC7 è tessuto e cellulo-specifica. Studi di ibridizzazione in situ hanno rivelato che questo gene è espresso nei tessuti della ghiandola salivare umana ed esclusivamente in quelli contenenti cellule acinari mucose (68, 69). MUC7 è presente, per esempio, nelle ghiandole sottolinguali e sottomandibolari ma non nelle ghiandole paratiroidee in cui sono presenti cellule acinari sierose. Recentemente, una nuova mucina ad alto PM (MG 1) è stata clonata e parzialmente sequenziata utiliz- zando una libreria di cona di ghiandola sottolinguale umana (70). La regione C-terminale contiene sequenze ricche in cisteina, e ciò suggerisce che anche questa mucina è secreta come polimero. Dati preliminari indicano che MG1 risulta fortemente espressa solo nelle ghiandole sottolinguali. ESPRESSIONE DEI GENI MUCINICI NEI TESSUTI TUMORALI Una delle caratteristiche più importanti della espressione dei geni mucinici è il loro grado di specificità cellulare e tessutale. Come abbiamo già affermato in precedenza, alcune mucine, come ad es. MUC1 e MUC4, sono espresse in differenti tessuti, mentre altre, come ad es. MUC2, MUC3 e MUC7 presentano una espressione cellulare più ristretta. Nella tabella 3 sono riportati i siti preferenziali di espressione relativi ad ogni gene apomucinico. Una problematica importante è se questa specificità di espressione è mantenuta anche in condizioni patologiche differenti, tra cui la trasformazione neoplastica. Studi di immunoistochimica con anticorpi specifici per ogni apomucina e di ibridizzazione in situ con sonde nucleotidiche specifiche hanno dato alcuni chiarimenti iniziali riguardo a questi aspetti. Attualmente sono disponibili dati sulla espressione dei geni mucinici nei tessuti pancreatici, gastrici ed intestinali normali e nelle controparti trasformate. Per quanto riguarda i tessuti di altri distretti le conoscenze nelle nostre mani sono ancora limitate. Studi di ibridazione in situ hanno dimostrato che le cellule degli acici pancreatici esprimono solamente MUC1, mentre i dotti pancreatici normali mostrano reattività anche per sonde anti-muc3 e MUC5B (57, 71, 72). Per contro, MUC2, MUC4 e MUC5AC generalmente non sono espressi in cellule pancreatiche normali. La trasformazione neo plastica del pancreas esocrino è accompagnata da modificazione del pannello di espressione dei geni mucinici. Infatti, in seguito alla trasformazione neoplastica si verifica un sovvertimento della espressione di tali geni, per cui spesso si può riscontrare nel tessuto tumorale la presenza di MUC2, MUC4, MUC5AC. Il significato di questa alterazione di espressione è tuttora oscuro. Tuttavia è possibile che l'espressione di MUC2 e MUC5AC derivi da una differenziazione gastrointestinale spesso osservata nei tessuti tumorali pancreatici. Un altro esempio interessante è costituito dall'epitelio gastrico (73). Come descritto precedentemente, tre geni mucinici, cioè MUC1, MUC5AC e MUC6 so no fortemente Tabella 3 Siti preferenziali di espressione delle mucine Gene MUCI MUC2 MUC3 MUC4 MUC5AC MUC5B MUC6 MUC7 Locali zzazione tessutale Superficie apicale della maggior parte delle cellule epiteliali polarizzate dei tratti respiratorio, diges ti vo e genitourinario, incluso il tessuto mammario Intestino tenue e colon (cellule caliciformi mucipare), epitelio bronchiale (cellule calicoformi mu cipare) Intestino tenue (cellule assorbenti) Cellule epiteliali e ghiandolari dei tratti respiratorio, diges ti vo e genitourinario Stomaco (superficie delle cellule mucipare); tratti res piratori e genitourinari Epitelio bronchiale; dotti pancreatici Stomaco (cellule mucipare e ghiandolari); piloro (ghiandole del Brunner) Ghiandole sali vari (cellule mu cipare) LlGAND ASSAY VOlo 1 NUMERO 4 ANNO 1996

6 Tabella 4 Positività di espressione del gene MUC4 nel tessuto polmonare normale e tumorale Espressione elevata (++) Espressione intermedia (+) Espressione debole (±) Espressione assente Tessuto normale Tessuto tumora[e 0/10 3/18 3/10 9/ [11 8 espressi nello stomaco in condizioni normali. Il carcinoma gastrico, ed in particolare il tipo intestinale, è associato ad una diminuzione dell'espressione di queste mucine e alla comparsa ectopica di mucine tipiche dell'intestino quali MUC2, MUC3 e MUC4. Come avviene nel carcinoma pancreatico, anche nel caso del carcinoma gastrico la spiegazione per questa aberrante espressione può essere ricercata nella capacità delle cellule tumorali di acquisire caratteristiche intestinali e coloniche, attivando le vie metaboliche silenti. Inoltre, è stato osservato che l'espressione multipla delle apomucine è più frequente nel carcinoma gastrico avanzato che non in quello ai primi stadi. Attualmente, non è ancora chiaro se l'espressione multipla dei core peptidici di tali mucine rappresenti un indicatore di aggressività biologica o sia solo un evento secondario all'alterazione genetica spesso osservata nei tumori a stadio avanzato. Vari geni mucinici sono espressi nei tessuti intestinali e del colon normali. Come accennato prima, MUC1 è largamente espresso nelle cellule epiteliali, MUC2 è presente limitatamente alle cellule di globet, mentre MUC3 è distribuito uniformemente in tutto l'epitelio assorbente. La trasformazione neoplastica generalmente determina una riduzione dell'espressione di MUC2 e MUC3, accompagnata da un incremento della sintesi di MUC1 e MUC4 (74-76). Quest'ultima alterazione metabolica è stata descritta anche nel cancro polmonare. In un lavoro recente condotto dal nostro gruppo (28) è stata evidenziato come il gene MUC4 sia fortemente associato al cancro polmonare: infatti la espressione di MUC4, insieme a quella del gene MUC1, è risultata decisamente superiore nel tessuto polmonare tu morale rispetto alla controparte normale (tabella 4); in particolare, i più elevati livelli di RNA specifico sono stati osservati nell'istotipo adenocarcinoma che, come noto, è un tumore producente mucine. Ulteriori studi sono comunque necessari allo scopo di valutare il ruolo del gene MUC4 gene nel cancro polmonare e di correlare la sua espressione con altri parametri biologici, quali il grado istologico e lo stadio clinico. Nel carcinoma colo-rettale la diminuzione dell'espressione del gene MUC1 sembra avere un significato prognostico in quanto è associata alla progressione tumorale e agli stadi avanzati di malattia (77). Un significato prognostico della aumentata espressione di MUC1 è stato anche attribuito nel cancro della mammella (78-80). Molti autori, hanno dimostrato che pazienti con tumori ad elevata espressione di MUC1 spesso presentano una prognosi più sfavorevole, (cioè intervalli liberi da malattia più brevi e una sopravvivenza media generalmente ridotta). Risultati analoghi sono stati ottenuti in relazione alla espressione ectopica di MUC2, gene normalmente non espresso nei tessuti mammari (81). Tuttavia, va sottolineato che il peso dell'espressione aberrante di questi geni mucinici come indicatore prognostico nel cancro della mammella deve essere validato da ulteriori e più estesi studi clinici. RINGRAZIAMENTI Questo lavoro è stato in parte eseguito con il supporto finanziario del CNR-Prog. Finalizzato ACRO. Si ringrazia la Sig.ra Françoise Bonetti per la assistenza redazionale. BIBLIOGRAFIA 1. Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Jentoft N. Why are proteins O-glycosilated? Trends Biochem Sci, 1990; 15 : Ho SB, Kim YS. Carbohydrates antigens on cancer-associated mucin-like molecules. Semin Cancer Biol, 1992; 2: Carraway KL, Hull SR. Celi surface mucin type glycoproteins and mucin like domains. Glycobiol, 1991; 1 (2): Van K1inken BJ, Dekker J, Buller HA, Einerhand A W. Mucin gene structllre and expression: protection vs. adehsion. Am J Physiol, 1995 ; 269 (5): G Murray PJ, Spithill TW. Variants of Leishmania surface antigen derived from a mliltigenic family. J Biol Chem, 1991; 266: Di Noia 1M, Sanehes DO, Frase ACe. The protozoan Trypanosoma cruzi has a famili y of genes resembling the mucin genes of mammalian cells. J Biol Chem, 1995; 270 (41): Serrano AA, Sehenkman S, Yoshida N, Mehlert A, Richardson JM, Ferguson MA. The lipid structure of the glycosylphosphatidyliinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. J Biol Chem, 1995; 270 (45): Kramero AA, Arbatsky NP, Rozovsky YM, Mikhakeva EA, Polasskaya 00, Gvodev VA, Shibaev VN. MlIcin-type glycoprotein ti'om Drosohila Melanogaster embryonic cells: characterization of carbohydrate component. FEBS Lett, 1996; 378: Baumhueter S, Singer MS, Henzel W, Hemmerich S, Renz M, Rosen SD, Lasky LA. Bincling of L-selectin to the vasclilar sialomllcin CD34. Science, 1993; 262: Imai Y, Singer MS, Fennie e. lclentification of a carbohydrate-basecl enclothelial li gand for a lymphocyte homing receptor. J Cell Biol, 1996; I 13: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

7 12. Crommie D, Rosen SD. Biosynthesis of GlyCAM-l, a mucin-like ligand for L-selectin. J Bio1 Chem, 1995; 270 (8): Cheng J, Baurnhueter S, Cacalano G, Carver-Moore K, Thibodeaux H, Thomas R, Broxmeyer HE, Cooper S, Hague N, Moore M, Lasky LA. Hematopoietic defects in mice lacking the sialomucin CD34. Blood, 1996; 87(2): Hemmerich S, Leffler H, Rose SD. Structure of the O-glycans in GlyCAM-l, an endothelial-derived ligand for L-selectin. J Biol Chem, 1995; 270 (20): Sheehan JK, Thornton DJ, Somerville M, Carlstedt I. Mucin structure. The structure and heterogeneity of respiratory mucus glycoproteins. Am Rev Respir Dis, 1991; 144: S Davies JR, Hovenbers HW, Linden CJ, Howard R, Richardson PS, Shehan JK, Carlstedt I. Mucins in airway secretions from healthy and chronic bronchitic subjects. BiochemJ, 1996; 313: Reid L, Champ JR. Biochemical and histochemical nomenc1ature of mucus. Br Med Bull, 1978; 34: Bolshcer J, Veerman E, Van Niew Amerongen A, Tulp A, Verwperd D. Distinct populations of high-mr mucins secreted by different human sa1ivary glands discriminated by density-gradient electrophoresis. Biochem J, 1995; 309: Neutra MR, Forstner JF. Gastrointestinal mucus: synthesis, secretion, and function. In: Physiology of the gastrointestinal tract, edited by Johnson LR, pp , Raven press, New York, Allen A. Mucus: a protective secretion of complexity. Trends Biochem Sci, 1983; 8: Carlstedt I, Sheehan JK, Corfiels AP, Gallagher JT. Mucous glycoprotein: a gel of a problem. Essays Biochem, 1985; 20: Price MR, Tendler JB. Polymorphic epithelial mucins (PEM): molecular characteristics and association with breast cancer. The Breast, 1993; 2: Gendler SJ, Spicer AP, Lalani EN, Duhig T, Peat N, Burchell J, Pemberton L, Boshell M, Taylor-Papadimitriou J. Structure and biology of a carcinoma-associated mucin, MUCI. Am Rev Respir Dis, 1991; 144: S Swallow DM, Gendler S, Griffiths B, Kearney A, Povey S, Sheer D, Palmer RW, Taylor-Papadimitriou J. The hypervariable gene locus PUM, which encodes for the tumor-associated epithelial mucins, is located on chromosome I within the region Ig Ann Hum Genet, 1987; 51: Siddiqui J, Abe M, Hayes D, Shari E, Yunis E, Kufe D. Isolation and sequencing of a cdna coding for the human DF3 breast carcinoma-associated antigen. Proc NatI Acad Sci USA, 1988; 85: Peat N, Gendler SJ, Lalani EN, Duhig T, Taylor-Papadimitriou J. Tissue-specific expression of a human polymorphic epithelial mucin (MUCl) in transgenic mice. Cancer Res, 1992; 52: Girling A, Bartkova J, Burchell J, Gendler S, Gillet C, Taylor-Papadimitriou J. A core protein epitope of the polymorphic epithelial mucin detected by the monoc1onal antibody SM3 is selectively exposed in a range of primary carcinomas. Int J Cancer, 1989; 43: Seregni E, Botti C, Lombardo C, Cantoni A, Bogni A, Cataldo I, Bombardieri E. Pattern oi' mucin gene expression in normal and neoplastic lung tissues. Anticancer Res, 1996; 16: Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J, Gendler SJ. Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit. Biochem Bioph Res Comm, 1990; 173 (3) : IO Swallow DM, Gendler S, Griffiths B, Corney G, Taylor-Papadimitriou J, Bramwell ME. The human tumor-associated epithelial mucins are coded for by an expressed hypervariable gene locus PUM. Nature, 1987; 328: Gendler SJ, Burchell JM, Duhig T et al. Cloning of partial cdna encoding differentiation and tumour-associated mucin glycoproteins expressed by human mammary epithelium. Proc Nati Acad Sci USA, 1987; 84: Linsley PS, Kallestad JC, Horn D. Biosynthesis of high molecular weight breast carcinoma associated mucin glycoproteins. J Biol Chem, 1988; 263: Hilkens J, Buijs F. Biosynthesis of MAM-6, an epithelial sialomucin. J Biol Chem, 1988; 263: Hilkens J, Wesseling J, Vos HL. Episialin/MUCI: structure, modulation of cellular adhesion, promotion of invasion in vitro and cleft formation in vivo, and inhibition of immune cytolysis. Pl'Oceedings of the third International Workshop on Carcinoma-Assoeiated Mucin, 1994 Aug 7-11, Cambridge (UK). 35. Ligtenberg MJ, Kruijshaar L, Buijs F, van Meijer M, Litvinov SV, Hilkens.I. Cell-assoeiated episialin is a eomplex eontaining two pl'oteins derived from a eommon precurson. J Biol Chem, 1992; 267: Hilkens J, Ligtenberg MJL, Vos HL, Litvinov SV. Cell membrane assoeiated mucins and their adhesion modulating pl'operty. Trends Biochem Sci, 1992; 17: Ligtenberg MJL, Buijs F, Vos HL, Hilkens J. Suppression of cellular aggregation by high 1eve1s of episialin. Cancer Res, 1992; 52: Regimbald LH, Pilarski LM, Longeneker M, Reddish MA, Zimmermann G, Hugh Je. The breast mucin MUCI as a novel adhesion ligand for endothelial intercellular adhesion molecule I in breast cancer. Caneer Res, 1996; 56: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

8 39. Reddish MA, MacLean GD, Poppema S, Berg A, Longeneker BM. Pre-immunotherapy serum MUC-1 mucin level and CD69+ lymphocytes correlate with effects of synthetic sialyl-tn vaccine in active specific immunotherapy. Cancer Immunol Immunother: in presso 40. Hayes DF, Silberstein DS, Rodrique SW. DF3 antigen, a human epithelial celi mucin, inhibits adhesion of eosinophils to antibody-coated targets. J Immunol, 1990; 145: Ogata S, Maimonis PJ, Itzkowitz SH. Mucin bearing the cancer-associated sialosyl-tn antigen mediate inhibition of natural killer celi cytotoxicity. Cancer Res, 1992;52: Abe M, Kufe D. Characterization of cis-acting elements regulating transcripti on of the human DF3 breast carcinoma- associated antigen (MUC l) gene. Proc NatI Acad Sci USA, 1993; 90: Kovarik A, Peat N, Wilson D, Gendler SJ, Taylor-Papadimitriou J. Analysis of the tissue-specific promoter of the MUC I gene. J Biol Chem, 1993 ; 268 (13): Gollub EG, Waksman H, Goswami S, Marom Z. Mucin genes are reglliated by estrogen and dexamethasone. Biochem Bioph Res Commun, 1995; 217 (3): Hey NA, Graham RA, Seif MW, Aplin ID. The polymorphic epithelial mucin MUCI in human endometrium is regulated with maximal expression in the implantation phase. J Clin Endocrinol Metab, 1994; 78: Surveyor GA, Gendler SJ, Pemberton L, Das SK, Chakraborty I, Julian J, Pimental RA, Wegner CC, Dey SK, Carson DD. Expression and steroid hormonal control of MUC-l in the mouse uterus. Endocrinology, 1995; 136: Botti C, Seregni E, Lombardo C, Massaron S, Bombardieri E. Effects of steroid-free fetal serum and steroid supplementation on MUCI gene expression in human breast cancer celliine MCF7. Anticancer Res: in presso 48. Gum JR, Byrd JC, Hicks JW, Toribara NW, Lamport DT, Kim VS. Molecular cloning of human intestinal mucin cdnas. J Biol Chem, 1989; 264: Gum JR, Hicks.TV, Toribara NW, Siddiqlli B, Kim VS. Molecular cloning of human intestinal mucin (MUC2) cdna. ldentification of the amino terminus and overal! sequence similarity to prepro-von Willebrand factor. J Biol Chem, 1994; 269: Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Tytgat KMAJ, Buller HA, Opdam FJM, Kim YS, Einerhand A W, Dekker J. Biosynthesis of human coloni c mucin: MUC2 is the prominent secretory mucin. Gastroenterology, 1994; 107: McCool DJ, Forstner F, Forstner GG. Regulated and unregulated pathways for MUC2 mucin secretion in human colonic LS 180 adenocarcinoma cel!s are distinct. Biochem J, 1995; 312: Specian RD, Neutra MR. Mechanism of rapid mucus secretion in Gob1et cells stimulateel by acetylcholine. J Celi Biol, 1980; 85 : Phillips TE, Phillips TH, Neutra MR. Regulation of intestinal Goblet cell secretion. III. Isolated intestinal epithelium. Am J Physiol, 1984; 247: G674-G Fox MF, Lahbib F, Pratt W, Attwood J, Gum J, Kim YS, Swallow DM. Regiona1 loca li zation of the intestinal mucin gene MUC3 to chromosome 7q22. Ann Hum Genet, 1992; 56: Gum JR, Hicks JW, Swallow DM, Lagace RL, Byrd JC, Lamport DT, Siddiqui B, Kim VS. Molecular cloning of cdnas derived from a novel human intestinal mucin gene. Biochem Biophys Res Commlln, 1990; 171 : Ho SB, Niehans GA, Lyftogt C, Yan PS, Cherwitz DL, Gum ET, Dahiya R, Kim VS. Heterogeneity of mucin gene expression in normal and neoplastic tissues. CancerRes, 1993; 53: Niv Y, Bird JC, Ho SB, Dahiya R, Kim VS. Mucin synthesis and secretion in relation to spontaneous differentiation of colon cancer cells in vitro. Int J Cancer, 1992; 50: Chang SK, Dohrman AF, Basbaum CB, Ho SB, Tsuda T, Toribara NW, Gum.TR, Kim VS. Localization of mucin (MUC2 anel MUC3) messenger RNA anel peptiele expression in hllman normal intestine and colon cancer. Gastroenterology, 1994; 107: Aubert JP, Porchet N, Crepin M, Duterque-Coqullard M, Vergnes G, Mazzucca M, Debuire B, Peptiprez D, Degand P. Evidence for different hllman tracheo-bronchial mucin peptides deduced from nucleotide cdna sequences. Am J Respir Cel! Mol Bi ol, 1991;5: Gross MS, Guyonnet DV, Porchet N, Bernheim A, Aubert JP, Nguyen VC. Mucin 4 (MUC4) gene: regional assignment (3q29) ami RFLP analysis. Ann Genet, 1992; 35: Porchet N, Van Cong N, Dufosse J, Audie JP, Guyonnet-Duperat V, Gross MS, Denis C, Degand P, Bernheim A, Aubert JP. Moleclliar cloning and chromosomal localization of a novel hllman tracheobronchial mucin cdna containing tandemly repeated sequences of 48 base pairs. Biochem Biophys Res Commun, 1991; 175: Nguyen VC, Aubert JP, Gross MS, Porchet N, Degand P, Frezal J. Assignment of hllman tracheobronchial mucin gene(s) to II P 15 and a tracheobronchial mllcin-re1ated sequence to chromosome 13. HlIm Genet, 1990; 86: Guyonnet Duperat V, Audie.TP, Debailleul V, Laine A, Buisine MP, Galiegue-Zowitina S, Pigny P, Degnad P, Aubert JP, Porchet N. Characterization of the human mucin gene MUCAC: a consensus L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

9 cysteine-rich domain for I Ip15 mucin genes? Biochem J, 1995; 305 : Buisine MP, Janin A, Maunoury V, Audie JP, Delescaut MP, Copin MC, Colombel JF, Degand P, Aubert JP, Porchet N. Aberrant expression of a human mucin gene (MUC5AC) in rectosigmoid villous adenoma. Gastroenterology, 1996; l IO: Toribara NW, Roberton AM, Ho SB, Kuo WL, Gum E, Hicks JW, Gum JR, Byrd JC, Siddiqui B, Kim YS. Human gastric mucin. Identification 01' a unique species by expression cloning. J Biol Chem, 1993; 268: Ho SB, Roberton AM, Shekels LL, Lyftog CT, Niehans GA, Toribara NW. Expression cloning 01' gastric mucin complementary DNA and localization of mucin gene expression. Gastroenterology, 1995; 109: Bobek LA, Tsai H, Biesbrock AR, Levine MJ. Molecular cloning, sequence, and specificity of expression of the gene encoding the low molecular weight human salivary mucin (MUC7). J Biol Chem, 1993; 268 (27): Cohen RE, Arguirre A, Neiders A, Levine MJ, Jones PC, Reddy MS, Haar JG. Immunochemistry and immunogenicity oi' low molecular weight human. salivary mucin. Arch Oral Biol, 1991; 36: Troxler RF, Offner GD, Zhang F, Iontcheva I, Oppenheim FG. Molecular cjoning of a novel high molecular weight mucin (MG l) from human sublingual gland. Biochem Biophys Res Commun, 1995; 217 (3): Balague C, Gambus G, Carrato C, Porchet N, Aubert JP, Kim YS, Real FX. Altered expression of MUC2, MUC4, and MUC5 mucin genes in pancreas tissues and cancer celi lines. Gastroenterology, 1994; 106: Balague C, Audie JP, Porchet N, Real FX. In situ hybridization shows distinct patterns of mucin gene expression in normal, benign, and malignant pancreas tissues. Gastroenterology, 1995; 109: Ho SB, Shekels LL, Toribara NW, Kim YS, Lyftog C, Cherwitz DL, Niehans GA. Mlicin gene expression in normal, preneoplastic, and neopl astic hllman gastric epithelium. Cancer Res, 1995; 55: 268 I Audie JP, Janin A, Porchet N, Copin MC, Gosselin B, Aubert JP. Expression of hllman mucin genes in respiratory, digestive, and reprodllctive tracts ascertained by in situ hybridization. J Hi stochem Cytochem, 1993; 41: Ogata S, Uehara H, Chen A, Itzkowitz SH. Mucin gene expression in colonic ti ssues and ce li lines. Cancer Res, 1992; 52: Velcich A, Palumbo L, Jarry A, Laboisse C, Racevskis J, Augentlich L. Patterns or expression 01' lineage-specific markers dllring the in vitro-induced differentiation 01' HT29 colon carcinoma celis. Celi Growth &Differentiation, 1993; 6: Nakamori S, Ota DM, Cleary KR, Shirotani K, Irimura T. MUCI mllcin expression as a marker 01' progression and metastasis of human colorectal carcinoma. Gastroenterology, 1994; 106: Ellis IO, BelI J, Todd.IM, WilIiams M, Dowle C, Robins AR, Eison CW, Blamey RW, Baldwin RW. Evaluation of immunoreactivity with the monoclonal antibody NCRC-II in breast cancer. Br J Cancer, 1987; 56: Muir 1M, Reed RG, Stacker SA, Alexander AI, McKenzie IF, Bennet RC. The prognostic value of immunoperoxidase staining with monoclonal antibodies NCRC-l I and 3E1.2. Br J Cancer, 1991; 64: McGuckin MA, Walsh MD, Hohn BG, Ward BG, Wright RG. Prognostic significance of MUCI epithelial mucin expression in breast cancer. Hum Pathol, 1995; 26 (4): Walsh MD, McGuckin MA, Devine PL, Hohn BG, Wright RG. Expression of MUC2 epithelial mucin in breast carcinoma. J Clin Pathol, 1993; 46: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

EPITELI GHIANDOLARI. NON confondere con escrezione: espulsione dalla cellula di sostanze non più utilizzabili

EPITELI GHIANDOLARI. NON confondere con escrezione: espulsione dalla cellula di sostanze non più utilizzabili EPITELI GHIANDOLARI Sono costituiti da cellule specializzate nella secrezione: sintesi di molecole che vengono riversate all esterno della cellula PROTEINE, LIPIDI, MUCOPOLISACCARIDI, ORMONI NON confondere



I MARCATORI TUMORALI CLASSICI I MARCATORI TUMORALI CLASSICI Serenella Valaperta - Laboratorio Analisi Vanzago, 14 aprile 2011 Marcatore tumorale una sostanza misurabile quantitativamente nei tessuti e nei liquidi corporei, che possa


Molecular basis of the X-linked Dyskeratosis disease: insights from Drosophila

Molecular basis of the X-linked Dyskeratosis disease: insights from Drosophila Molecular basis of the X-linked Dyskeratosis disease: insights from Drosophila La ricerca è stata finalizzata allo studio della Discheratosi congenita X-linked (X-DC), una malattia genetica caratterizzata


scaricato da

scaricato da Recettori a tirosina chinasi I recettori a tirosina chinasi presentano vari domini Una regione di legame (extracellulare) Una regione transmembrana Una coda intracellulare con numerose tirosine scaricato


Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze

Dott. Elena Niccolai, PhD. Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Dott. Elena Niccolai, PhD Dipartimento di Medicina Sperimentale e Clinica Università degli Studi di Firenze Premio Gianfranco Del Prete per le malattie orfane, Firenze 8 novembre 2014 ADENOCARCINOMA PANCREATICO


RNA polimerasi operone. L operatore è il tratto

RNA polimerasi operone. L operatore è il tratto La regolazione genica nei procarioti Alcune proteine vengono prodotte dalla cellula ad un ritmo relativamente costante e l attività dei geni che codificano queste proteine non è regolata in modo sofisticato.


Biologia Cellulare e DNA «Bigino»

Biologia Cellulare e DNA «Bigino» Biologia Cellulare e DNA «Bigino» Giulio Barigelletti Premesse 2 Sempre più frequentemente si sente parlare di DNA, Proteine, Amminoacidi, etc., relazionati all esistenza dell essere umano.


Her-2 nel carcinoma mammario

Her-2 nel carcinoma mammario Her-2 nel carcinoma mammario Piera Balzarini U.O. Anatomia Patologica Università degli Studi di Brescia Spedali Civili di Brescia Il gene ERBB2 dà origine ad un recettore tirosin-chinasico appartenente


La trasduzione del segnale intracellulare

La trasduzione del segnale intracellulare La trasduzione del segnale intracellulare Chemical signaling mechanisms Amplification in signal transduction pathways Un aspetto importante è il controllo temporale del comportamento cellulare: il trasferimento


Reticolo endoplasmatico Apparato del Golgi Lisosomi

Reticolo endoplasmatico Apparato del Golgi Lisosomi Reticolo endoplasmatico Apparato del Golgi Lisosomi NELLA CELLULA eucariotica: Il Nucleo controlla le funzioni cellulari Il Citoplasma è sede di attività sintetiche e metaboliche della cellula Citoplasma


L endocitosi dell EGFR

L endocitosi dell EGFR L endocitosi dell EGFR IFOM per la scuola Lo Studente Ricercatore 2011 Muzio Giulia Istituto d Istruzione Superiore Maserati Voghera Gruppo di lavoro: Determinanti della trasformazione neoplastica e della





Legami chimici. Covalente. Legami deboli

Legami chimici. Covalente. Legami deboli Legami chimici Covalente Legami deboli Legame fosfodiesterico Legami deboli Legami idrogeno Interazioni idrofobiche Attrazioni di Van der Waals Legami ionici Studio delle macromolecole Lipidi


Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B

Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B I geni che codificano i recettori per gli antigeni (BCR e TCR) sono presenti in uno


IL-2R & IL-15R Alice Praduroux

IL-2R & IL-15R Alice Praduroux Università degli Studi di Torino Facoltà di Biotecnologie Molecolari Anno Accademico 2006/2007 Corso di Immunologia Molecolare IL-2R & IL-15R Alice Praduroux Classificazione Recettori appartenenti alla



NEUROENDOCRINI GENERICI L indagine immunoistochimica richiesta prevede l utilizzo di marcatori neuroendocrini generici NEUROENDOCRINI GENERICI Enolasi Neurono-Specifica (NSE) Sinaptofisina (SYN) Cromogranina generalmente di tipo


Controllo post-trascrizionale dell espressione genica

Controllo post-trascrizionale dell espressione genica Controllo post-trascrizionale dell espressione genica Livelli di controllo dell espressione genica Rivisitazione del concetto di gene Per gli organismi eucariotici più evoluti il dogma un gene = una proteina


PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle





Classi e sottoclassi di anticorpi

Classi e sottoclassi di anticorpi Classi e sottoclassi di anticorpi Anticorpi: classi e sottoclassi In base alla catena pesante gli anticorpi sono divisi in classi e sottoclassi Classi o isotipi IgA, IgD, IgE, IgG, IgM Sottoclassi IgA1


La brevettazione in campo medico e biotecnologico. Università degli Studi di Ferrara, 29 marzo 2007

La brevettazione in campo medico e biotecnologico. Università degli Studi di Ferrara, 29 marzo 2007 La brevettazione in campo medico e biotecnologico Università degli Studi di Ferrara, 29 marzo 2007 La brevettazione delle sequenze di acido nucleico Elena Comoglio Jacobacci & Partners S.p.A. Brevetti


LATTE E DERIVATI E TUMORE. Sabina Sieri Unità di Epidemiologia e Prevenzione Fondazione IRCCS Istituto Nazionale dei Tumori Milano

LATTE E DERIVATI E TUMORE. Sabina Sieri Unità di Epidemiologia e Prevenzione Fondazione IRCCS Istituto Nazionale dei Tumori Milano LATTE E DERIVATI E TUMORE Sabina Sieri Unità di Epidemiologia e Prevenzione Fondazione IRCCS Istituto Nazionale dei Tumori Milano MEDIE (g/die) DI CONSUMO DI LATTICINI IN ITALIA: INDAGINE INRAN-SCAI 2005


Schema dell apparato genitale femminile visto di fronte non sezionato (a) e in sezione (b) ciclo mestruale. Endometrio=mucosa uterina

Schema dell apparato genitale femminile visto di fronte non sezionato (a) e in sezione (b) ciclo mestruale. Endometrio=mucosa uterina Schema dell apparato genitale femminile visto di fronte non sezionato (a) e in sezione (b) ciclo Endometrio=mucosa uterina Le tonache mucose Tonache mucose La mucosa (o tonaca mucosa, o membrana mucosa)


Downloaded from. Migrazione cellulare

Downloaded from. Migrazione cellulare Downloaded from Migrazione cellulare Migrazione dei leucociti I leucociti migrano nei diversi tessuti dell organismo l interazione tra le cellule migranti e le cellule dei tessuti








SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza



GENETICA DEL TUMORE DEL COLON-RETTO GENETICA DEL TUMORE DEL COLON-RETTO EPIDEMIOLOGIA In tutto l'occidente, il cancro del colon-retto occupa, per incidenza, il secondo posto tra i tumori maligni, preceduto dal tumore al polmone nell'uomo


Tessuto epiteliale Tessuto connettivo Tessuto muscolare Tessuto nervoso TESSUTO

Tessuto epiteliale Tessuto connettivo Tessuto muscolare Tessuto nervoso TESSUTO Tessuto epiteliale TESSUTO Ogni cellula del nostro organismo ha lo stesso patrimonio genetico ma, allora, perché ogni cellula è diversa da un altra? Del messaggio genetico ricevuto ogni cellula legge un


Normale controllo della crescita cellulare

Normale controllo della crescita cellulare Normale controllo della crescita cellulare STOP STOP Cellula normale STOP Alterato controllo della crescita cellulare X STOP STOP Cellula tumorale STOP X Le cellule tumorali presentano alterazioni cromosomiche


Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon

Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Identificazione e studio delle Cellule Staminali Tumorali del carcinoma della mammella e dell adenocarcinoma del colon Carmelo Lupo Coordinatore Tecnico U.O. Anatomia Patologica e Patologia Molecolare


Scuola Universitaria Interfacoltà per le Biotecnologie Primo anno della Laurea specialistica in Biotecnologie molecolari Anno Accademico 2004-2005

Scuola Universitaria Interfacoltà per le Biotecnologie Primo anno della Laurea specialistica in Biotecnologie molecolari Anno Accademico 2004-2005 Scuola Universitaria Interfacoltà per le Biotecnologie Primo anno della Laurea specialistica in Biotecnologie molecolari Anno Accademico 2004-2005 ALESSIA PERINO La leptina è una piccola proteina non glicosilata


La Biopsia Prostatica: where are we going?

La Biopsia Prostatica: where are we going? La Biopsia Prostatica: where are we going? Sabato 28 Novembre 2015, Catania Dott. Michele Salemi Screening genetico correlato a rischio di carcinoma prostatico. BRCA1, BRCA2, TP53, CHEK2, HOXB13 e NBN:


La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per


Anticorpi monoclonali anti-egfr

Anticorpi monoclonali anti-egfr Università degli Studi di Torino Laurea Specialistica in Biotecnologie Molecolari Corso di Immunologia Prof.G.Forni Anticorpi monoclonali anti-egf Lara Fontani Famiglia recettori T erbb/her Ligandi EGF


Mediatore chimico. Recettore. Trasduzione del segnale. Risposta della cellula

Mediatore chimico. Recettore. Trasduzione del segnale. Risposta della cellula Mediatore chimico Recettore Trasduzione del segnale Risposta della cellula I mediatori chimici sono prodotti da cellule specializzate e sono diffusi nell organismo da apparati di distribuzione Sistemi


Segnali post-inserzionali

Segnali post-inserzionali Segnali post-inserzionali Ritenzione nel R.E. KDEL C-term RDEL KEEL Individuazione di recettori per KDEL tramite anticorpi di Seconda generazione Recupero di proteine localizzate nel reticolo endoplasmatico


Recettori di superficie

Recettori di superficie Recettori di superficie Esistono 3 classi principali di recettori di superficie 1. Recettori annessi a canali ionici 2. Recettori accoppiati alle proteine G 3. Recettori associati ad enzimi Recettori


Her2/neu Il ruolo del Pertuzumab

Her2/neu Il ruolo del Pertuzumab Università degli Studi di Torino Corso di Laurea Specialistica in Biotecnologie Mediche Her2/neu Il ruolo del Pertuzumab Corso di Immunologia Molecolare Anno Accademico 2007/08 Elisa Migliore Her2 nelle


Fibrillina Sindrome di Marfan sindrome di Marfan sindrome di Marfan Sindrome di Marfan Fibrillina 1

Fibrillina Sindrome di Marfan sindrome di Marfan sindrome di Marfan Sindrome di Marfan Fibrillina 1 Genoma La determinazione e la conoscenza dell intera sequenza genomica è la condizione necessaria per comprendere la biologia di un determinato organismo Il genoma contiene le istruzioni (geni) per la


La mammella e il latte

La mammella e il latte La mammella e il latte Cenni di anatomia della ghiandola mammaria e suo sviluppo L escrezione e la secrezione dei componenti del latte L eiezione e la modalità di mungitura e i riflessi sulla qualità del


Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1

Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1 Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1 e loro applicazione in studi pre-clinici. Il trasferimento genico è una tecnologia


Appunti di istologia EPITELI GHIANDLARI. STUDENTI X L'UNIVERSITA' Testi e immagini raccolte da Roberta F. www.studxwebmedicina.altervista.

Appunti di istologia EPITELI GHIANDLARI. STUDENTI X L'UNIVERSITA' Testi e immagini raccolte da Roberta F. www.studxwebmedicina.altervista. Appunti di istologia EPITELI GHIANDLARI STUDENTI X L'UNIVERSITA' Testi e immagini raccolte da Roberta F. Ghiandole Cellule singole o organi specializzati nella produzione


Tipi di immunità acquisita.

Tipi di immunità acquisita. Tipi di immunità acquisita Caratteristiche dell immunità acquisita Espansione clonale Fasi della risposta immunitaria acquisita Specificità, memoria, risoluzione delle risposte immunitarie acquisite Immunità


Regione cerniera monomero regione cerniera

Regione cerniera monomero regione cerniera Regione cerniera Tutte le Ig, sia quelle secrete che quelle presenti sulla membrana plasmatica dei linfociti B, sono costituite da quattro catene proteiche, due pesanti (H, da heavy, in rosso nel disegno)


Il TCR è un eterodimero costituito da due catene polipeptidiche chiamate catena α ecatenaβ legate insieme da un ponte disolfuro. Entrambe le catene

Il TCR è un eterodimero costituito da due catene polipeptidiche chiamate catena α ecatenaβ legate insieme da un ponte disolfuro. Entrambe le catene I linfociti T sono le cellule dell immunità adattativa responsabili della protezione verso le infezioni ad opera dei microbi intracellulari. Essi derivano da cellule staminali del midollo osseo che si


Vettori di espressione

Vettori di espressione Vettori di espressione Vengono usati per: 1.Generare sonde di RNA 2.Produrre la proteina codificata Per fare questo viene utilizzato un promotore che risiede sul vettore, modificato per ottimizzare l interazione


Regolazione dell espressione genica EUCARIOTI

Regolazione dell espressione genica EUCARIOTI Regolazione dell espressione genica EUCARIOTI Regolazione della espressione genica Molte proteine sono comuni a tutte le cellule RNA polimerasi, proteine ribosomali, enzimi che regolano il metabolismo,


Le fibre alimentari sono: - l insieme eterogeneo e complesso di omo- ed eteropolisaccaridi - resistenti agli enzimi digestivi

Le fibre alimentari sono: - l insieme eterogeneo e complesso di omo- ed eteropolisaccaridi - resistenti agli enzimi digestivi Le fibre alimentari sono: - l insieme eterogeneo e complesso di omo- ed eteropolisaccaridi - resistenti agli enzimi digestivi Anche se non digerite, le fibre esercitano effetti importanti nel controllo


La regolazione genica nei virus

La regolazione genica nei virus La regolazione genica nei virus Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri I VIRUS INDICE Caratteristiche dei virus: il capside e il genoma virale Classificazione virale Fasi del ciclo riproduttivo


Analisi Molecolare di sequenze di acidi nucleici

Analisi Molecolare di sequenze di acidi nucleici Analisi Molecolare di sequenze di acidi nucleici 1. L Analisi di restrizione di frammenti o RFLP (Restriction Fragment Lenght Polymorphism) di DNA comporta lo studio delle dimensioni dei frammenti di DNA


STOMACO. A livello dello stomaco si verifica un limitato assorbimento di alimenti, soprattutto di acqua, di alcuni sali, di alcool e di alcuni farmaci

STOMACO. A livello dello stomaco si verifica un limitato assorbimento di alimenti, soprattutto di acqua, di alcuni sali, di alcool e di alcuni farmaci STOMACO Nel loro insieme i secreti delle ghiandole formano il succo gastrico, fortemente acido (ph circa 1). Nella mucosa gastrica sono disposte tra le ghiandole cellule mucose, che producono un muco che





Elettroforesi. Elettroforesi: processo per cui molecole cariche si separano in un campo elettrico a causa della loro diversa mobilita.

Elettroforesi. Elettroforesi: processo per cui molecole cariche si separano in un campo elettrico a causa della loro diversa mobilita. Elettroforesi Elettroforesi: processo per cui molecole cariche si separano in un campo elettrico a causa della loro diversa mobilita. A qualunque ph diverso dal pi le proteine hanno una carica netta quindi,



EPITHELIAL TO MESENCHYMAL TRANSITION (EMT) IN DEVELOPMENT AND DISEASES. Cristina Valacca 18 Maggio 2012 EPITHELIAL TO MESENCHYMAL TRANSITION (EMT) IN DEVELOPMENT AND DISEASES Cristina Valacca 18 Maggio 2012 DEFINIZIONE L'EMT è un processo biologico che consente a una cellula epiteliale di iniziare numerosi


Regolazione della trascrizione. Operoni catabolici nei procarioti (controllo negativo)

Regolazione della trascrizione. Operoni catabolici nei procarioti (controllo negativo) Regolazione della trascrizione Operoni catabolici nei procarioti (controllo negativo) I geni possono essere accesi e spenti In un organismo pluricellulare adulto, vi sono molti tipi di cellule differenti,


La traduzione: dall mrna alle proteine

La traduzione: dall mrna alle proteine La traduzione: dall mrna alle proteine Le infezioni batteriche sono una grave causa di malattie e morte in Europa e negli USA. Le infezioni batteriche si curano con antibiotici che colpiscono l espressione


Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16

Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16 Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16 L'immunoistochimica e' una tecnica ampiamente utilizzata per l'identificazione e la localizzazione di costituenti cellulari


La parte Fc delle Ig regola la vita media delle Ig, e quindi la quantità di Ig presenti in circolo e nei tessuti.

La parte Fc delle Ig regola la vita media delle Ig, e quindi la quantità di Ig presenti in circolo e nei tessuti. La parte dell Ig che non lega l antigene (la parte Fc, viola chiaro nel disegno) è responsabile delle funzioni effettrici dell Ig e quindi ne determina l attività biologica. Quando un Ig ha legato un antigene,


Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a.

Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a. Anticorpi generalità Riconoscimento antigene Anticorpi Molecole MHC Recettore per l Ag dei linfociti T (TCR) Anticorpi riconoscono diversi tipi di strutture antigeniche macromolecole proteine, lipidi,



DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac


Presentazione dell antigene tramite TCR

Presentazione dell antigene tramite TCR Presentazione dell antigene tramite TCR Elena Adinolfi Il recettore della cellula T (TCR) Il TCR è il recettore per l antigene delle cellule T. In maniera analoga a quanto accade per le cellule B ad ogni


DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2 Domini modulari delle proteine 1 Proteine della matrice DOMINI E MODULI La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette domini,


Citochine dell immunità specifica

Citochine dell immunità specifica Citochine dell immunità specifica Proprietà biologiche delle citochine Sono proteine prodotte e secrete dalle cellule in risposta agli antigeni Attivano le risposte difensive: - infiammazione (immunità


Seminario. Domini modulari delle proteine 1

Seminario. Domini modulari delle proteine 1 Seminario Proteine della matrice DOMINI E MODULI Domini modulari delle proteine 1 La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette


Il mantenimento dell omeostasi cellulare dipende dai sistemi che permettono lo scambio di molecole tra citoplasma e liquido

Il mantenimento dell omeostasi cellulare dipende dai sistemi che permettono lo scambio di molecole tra citoplasma e liquido Il mantenimento dell omeostasi cellulare dipende dai sistemi che permettono lo scambio di molecole tra citoplasma e liquido extracellulare e dalla loro regolazione. Membrana cellulare Ogni cellula presenta


Traduzione dell informazione genetica (1)

Traduzione dell informazione genetica (1) Traduzione dell informazione genetica (1) 1 Traduzione dell informazione genetica (2) Il processo negli eucarioti richiede: 70 diverse proteine ribosomiali >20 enzimi che attivano i precursori degli amminoacidi





Si dividono in: N-glicosilate (su Asparagina) O-glicosilate (su Serina o Treonina. Raramente su Tirosina, idrossiprolina, idrossilisina)

Si dividono in: N-glicosilate (su Asparagina) O-glicosilate (su Serina o Treonina. Raramente su Tirosina, idrossiprolina, idrossilisina) GLICOSILAZIONE La glicosilazione è la modificazione PTM più diffusa. Circa il 50% delle proteine umane sono glicosilate Caratteristica di molte proteine della superficie cellulare e delle d proteine di


Determinazione del sesso Cromosomi sessuali

Determinazione del sesso Cromosomi sessuali Determinazione del sesso Cromosomi sessuali Negli Eucarioti un cromosoma del sesso è un cromosoma presente in forme diverse nei due sessi. Uno è un cromosoma "X", l'altro strutturalmente e funzionalmente



7a. COMPARTIMENTI INTRACELLULARI 7a. COMPARTIMENTI INTRACELLULARI contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale molte delle reazioni chimiche che avvengono


Corso di Laurea Magistrale in Medicina e Chirurgia Biofisica e Fisiologia I A.A. 2015-16

Corso di Laurea Magistrale in Medicina e Chirurgia Biofisica e Fisiologia I A.A. 2015-16 Corso di Laurea Magistrale in Medicina e Chirurgia Biofisica e Fisiologia I A.A. 2015-16 BIOFISICA DELLE MEMBRANE Negli organismi pluricellulari, a parte i tessuti tegumentari e gli epiteli assorbenti


La cellula. Copyright (c) by W. H. Freeman and Company

La cellula. Copyright (c) by W. H. Freeman and Company La cellula Gli organismi contengono organi, gli organi sono costituiti da tessuti, i tessuti sono composti da cellule e le cellule sono formate da molecole Evoluzione molecolare L evoluzione è un processo


Espressione di geni specifici per un determinato tumore

Espressione di geni specifici per un determinato tumore Espressione di geni specifici per un determinato tumore Paziente A: Non ha il cancro Espressione dei geni: Nessuna Biopsia Geni associati al cancro allo stomaco Paziente B: Ha un tumore allo stomaco Bassa


Funzioni delle proteine del sangue:

Funzioni delle proteine del sangue: PROTEINE DEL SANGUE Funzioni delle proteine del sangue: 1. Funzioni nutrizionali 2. Regolazione dell equilibrio acido base 3. Ripartizione dell acqua nei vari distretti 4. Funzione di trasporto 5. Coagulazione


Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato.

Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato. Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato. Correlazione tra fenotipo alterato, o a livello cellulare,


La regolazione genica nei eucarioti

La regolazione genica nei eucarioti La regolazione genica nei eucarioti Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri Differenziamento negli eucarioti pluricellulari Negli eucarioti le cellule specializzate dei vari tessuti contengono


EUCARIOTI. suddivisione del lavoro a livello cellulare

EUCARIOTI. suddivisione del lavoro a livello cellulare EUCARIOTI ORGANISMI UNICELLULARI alghe unicellulari protozoi ORGANISMI PLURICELLULARI suddivisione del lavoro a livello cellulare da cellule tutte uguali (prime fasi sviluppo embrionale) a popolazioni


I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici

I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici I composti organici della vita: carboidrati, lipidi, proteine e acidi nucleici La seta della tela di ragno è un insieme di macromolecole, dette proteine. Sono le caratteristiche fisico-chimiche di queste






ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) Il gene implicato nella SCA17 è il gene TATA box-binding protein (TBP) che fa parte del complesso della RNA polimerasi II ed è essenziale per dare inizio


Terapie a bersaglio molecolare nel tumore del polmone

Terapie a bersaglio molecolare nel tumore del polmone Terapie a bersaglio molecolare nel tumore del polmone Indice 1. Introduzione 2. Cosa sono le targeted therapies? 3. Come funzionano le targeted therapies? 4. Perché utilizzare le targeted therapies nel


Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)


SAGE: Serial Analysis of Gene Expression

SAGE: Serial Analysis of Gene Expression SAGE: Serial Analysis of Gene Expression L insieme di tutti gli mrna presenti in una cellula si definisce trascrittoma. Ogni trascrittoma ha una composizione complessa, con migliaia di mrna diversi, ciascuno


Maurizio Pianezza. La mia terapia anticancro. Maurizio Pianezza. Aspetti di

Maurizio Pianezza. La mia terapia anticancro. Maurizio Pianezza. Aspetti di Maurizio ianezza Aspetti di Biologia Molecolare Maurizio ianezza 1 - DUE ISOFROME IGF1 IGF2 IGF - INSULIN GROWTH FACTOR FATTORE INSULINICO - ISOFORMA RINCIALE IGF1 - ROTEINA FORMATA DA 70 AMINOACIDI SIMILE


Il flusso dell informazione genetica. DNA -->RNA-->Proteine

Il flusso dell informazione genetica. DNA -->RNA-->Proteine Il flusso dell informazione genetica DNA -->RNA-->Proteine Abbiamo visto i principali esperimenti che hanno dimostrato che il DNA è la molecola depositaria dell informazione genetica nella maggior parte


Corso di Biologia Molecolare

Corso di Biologia Molecolare Corso di Biologia Molecolare Dott.ssa Renata Tisi Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 Acidi nucleici Il ruolo degli acidi nucleici è quello di custodire e trasmettere


Struttura e funzioni della cellula. Corso di Biofisica, Università di Cagliari 1

Struttura e funzioni della cellula. Corso di Biofisica, Università di Cagliari 1 Struttura e funzioni della cellula 1 Riferimenti Books and others Biological Physics (updated 1 st ed.), Philip Nelson, Chap. 2 Physical Biology of the Cell, Phillips et al., Chap. 2 Movies Exercise 2


Dal DNA alle proteine: La trascrizione e la traduzione

Dal DNA alle proteine: La trascrizione e la traduzione Dal DNA alle proteine: La trascrizione e la traduzione DNA RNA Trascrizione RNA PROTEINE Traduzione Dove avvengono? GLI EUCARIOTI I PROCARIOTI Cambell, Reece Biologia ZANICHELLI Trascrizione Sintesi di


Il sistema endocrino

Il sistema endocrino Il sistema endocrino 0 I messaggeri chimici 0 I messaggeri chimici coordinano le diverse funzioni dell organismo Gli animali regolano le proprie attività per mezzo di messaggeri chimici. Un ormone è una



FORMAZIONE DELL ESSUDATO FORMAZIONE DELL ESSUDATO del flusso della permeabilità vascolare P idrostatica intravascolare fuoriuscita di proteine plasmatiche TRASUDAZIONE ESSUDAZIONE TUMOR Effetti della formazione dell essudato


04_12_08. Microscopia confocale. Esempio di analisi con focale: vedi il filmato corrispondente. Vedi filmato

04_12_08. Microscopia confocale. Esempio di analisi con focale: vedi il filmato corrispondente. Vedi filmato Citologia Animale e Vegetale (corso A - I. Perroteau) - microscopia confocale Microscopia confocale 1 Citologia Animale e Vegetale (corso A - I. Perroteau) - microscopia confocale Esempio di analisi con


Segnalazione cellulare e trasduzione del segnale. Comunicazione fra le cellule

Segnalazione cellulare e trasduzione del segnale. Comunicazione fra le cellule Segnalazione cellulare e trasduzione del segnale Comunicazione fra le cellule Le cellule comunicano e interagiscono tra loro tramite il fenomeno della segnalazione cellulare Una cellula segnalatrice produce


Meccanismi di controllo della proliferazione cellulare

Meccanismi di controllo della proliferazione cellulare Meccanismi di controllo della proliferazione cellulare Il ciclo cellulare è regolato dall azione di PROTOONCOGENI e (attivatori della proliferazione cellulare) GENI ONCOSOPPRESSORI (inibitori del ciclo


Anticorpi monoclonali Anti-EGFR. -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri. Valentina Anrò

Anticorpi monoclonali Anti-EGFR. -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri. Valentina Anrò Anticorpi monoclonali Anti-EGFR -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri Valentina Anrò Ruolo Biologico Epidermal Growth Factor Receptor Extracellular Domain Transmembrane Domain


ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma.

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna è caratteristico degli eucarioti: Sequenze codificanti 1.5% del genoma umano Introni in media 95-97%


1. Manifestano la loro azione negativa solo in età adulta avanzata

1. Manifestano la loro azione negativa solo in età adulta avanzata Perché invecchiamo? La selezione naturale opera in maniera da consentire agli organismi con i migliori assetti genotipici di tramandare i propri geni alla prole attraverso la riproduzione. Come si intuisce


Citosol Ribosomi Sintesi proteica

Citosol Ribosomi Sintesi proteica CITOSOL (1) Citosol Ribosomi Sintesi proteica Biotecnologie_2012 Tutta la porzione non strutturata che costituisce la parte liquida del citoplasma. In esso si trovano in soluzione tutte le molecole necessarie


L adattamento dei batteri. Strategie di adattamento

L adattamento dei batteri. Strategie di adattamento L adattamento dei batteri Strategie di adattamento mutazione trasferimento genico orizzontale regolazione dell espressione genica regolazione della trascrizione regolazione della traduzione regolazione


Proliferazione e morte cellulare sono eventi fisiologici

Proliferazione e morte cellulare sono eventi fisiologici MORTE CELLULARE Proliferazione e morte cellulare sono eventi fisiologici Omeostasi tissutale (di tessuti dinamici) Sviluppo embrionale Eliminazione di strutture corporee inutili - Fasi di scultura/rimodellamento
