Struttura, funzione e specificità tessutale dei geni delle mucine

Dimensione: px
Iniziare la visualizzazioe della pagina:

Download "Struttura, funzione e specificità tessutale dei geni delle mucine"


1 Struttura, funzione e specificità tessutale dei geni delle mucine c. BOTIP, E. SEREGNP, S. MASSARON', A.MARTINETIP, A. BONANATE', D. CANTARELLAI, A. CAPOBIANC02, E. BOMBARDIERI' 'Divisione di Medicina Nucleare, Istituto Nazionale per lo Studio e la Cura dei Tumori, MILANO 2 Laboratorio Analisi Cliniche, Ospedale S. Carlo, POTENZA INTRODUZIONE Le differenti molecole della famiglia delle mucine possiedono precise caratteristiche biochimiche in comune (1). Innanzitutto, le mucine sono costituite da un core proteico (apomucina) che presenta un peso molecolare variable da 40kD a 600kD. Tale scheletro proteico contiene un elevato numero di residui di treonina e serina cui sono legate preferenzialmente le catene glucidiche mediante legame 1-3 O-glicosidico (2). I carboidrati costituiscono più de1l'80% della molecola e la lunghezza delle catene glucidiche laterali varia da uno a più di 20 residui; i principali glucidi sono l'n-acetilgalattosammina, l'n-acetilglucosammina, il galattosio, il fucosio ed infine l'acido sialico (3, 4). Differenti geni apomucinici sono stati recentementi identificati ed è stato possibile evidenziare la loro struttura comune costituita da una porzione centrale affiancata da sequenze 5'-3' (5). Il dominio centrale dello scheletro proteico costituisce più dell'80% dell'intera sequenza aminoacidica codificata, ed è composta da sequenze ripetute ("tandem repeats") variabili per numero e composizione caratterizzate da un elevato numero di residui di serina, treonina e prolina. L'omologia di sequenza del dominio centrale fra i differenti membri della famiglia delle mucine è limitata e ciò significa che la sequenza e le dimensioni del dominio interno sono uniche per ogni tipo di mucina. Omologie di sequenza parziali sono invece presenti fra le differenti mucine nei domini delle regioni N e C- terminali. Molecole mucino-simili sembrano essere largamente diffuse in natura, ma la nostra conoscenza a riguardo è decisamente limitata a causa delle scarse informazioni presenti in letteratura per le specie non appartenenti alla classe dei mammiferi. Ad esempio, geni codificanti per molecole affini alle mucine negli eucarioti inferiori sono stati descritti in Leishmania major e Trypanosoma cruzi (6-8); in particolare in quest'ultimo organismo, che rappresenta l'agente eziologico della malattia di Chagas, è stato osservato che glicoproteine simili alle mucine svolgono un ruolo importante nell'interazione con la superficie delle cellule di mammifero durante il processo di invasione. Molto recentemente una glicoproteina mucino-simile con un peso molecolare apparente di 90kD, denominata mucina D, è stata descritta e parzialmente caratterizzata in cellule embrionali di Drosophila melanogaster (9). In questa s~e cie la mucina D sembra essere coinvolta nel processo di muta poichè la sua sintesi è regolata dall'ormone della muta degli insetti. Nei mammiferi le mucine sono largamente rappresentate, essendo riscontrabili nella maggior parte delle cellule epiteliali secretorie polarizzate (1, 2). Molecole simili alle mucine sono state anche osservate sulla superficie di cellule non-epiteliali, in particolare di origine ematica (10-14). Studi immunoistochimici e biochimici hanno consentito di ottenere interessanti informazioni riguardo alla struttura della componente carboidratica delle mucine epiteliali, ma fino a poco tempo fa molto poco si sapeva sulla struttura e composizione delle apomucine. Infatti l'approccio biochimico si è dimostrato inadeguato in quanto la maggior parte delle procedure di studio si basavano sulla deglicosilazione delle mucine che causava una degradazione massiva dello scheletro apomucinico (4, 15-18). Successivamente, l'avvento delle tecniche di biologia molecolare ha consentito finalmente di fare luce sulla componente apomucinica e i geni che la codificano. Questi studi hanno rivelato l'esistenza di differenti geni mucinici che codificano per almeno 8 apomucine (denominate rispettivamente MUC1, MUC2, MUC3, MUC4, MUC5, MUC5AC, MUC5B, MUC6 e MUC7). Grazie ai risultati ottenuti da studi genetici, immunologici e biochimici, è oggi possibile classificare le mucine in due gruppi principali : mucine associate alle membrane cellulari e mucine secretorie. A loro volta le mucine secretorie possono essere suddivise in due altri sottogruppi in base alla loro funzione fisiologica, cioè che vadano o meno a costituire il gel viscoso ch e ricopre la superficie dei tratti respiratorio, gastrointestinale e genitourinario. Questo gel mucinoso svolge importanti funzioni che includono il mantenimento della viscosità e la protezione contro insulti meccanici, chimici, fisici, biologici e contro l'azione di enzimi proteolitici e di variazione di ph (19-21). Di seguito verranno analizzate e discusse le principali caratteristiche delle differenti mucine, con particolare enfasi nei riguardi delle loro rispettive strutture, funzioni ed epressione dei geni che le codoficano. MUC1 MUC1 è tra le mucine associate alla membrana la più conosciuta, ed è chiamata anche "polymorphic epithelial mucin" (PEM) o "episialina". Il gene, che è stato il primo gene mucinico ad essere clonato e sequenziato nell'uomo e nei topi, è localizzato sul cromosoma 1 q21-24 e codifica per una glicoproteina ad elevato PM ( kd) di tran- LlGAN D ASSAY VOL. 1 NUMERO 4 ANNO 1996

2 smembrana altamente glicosilata (22-26). La mucina MUC1 risulta espressa in molti tessuti epiteliali normali (mammella, pancreas, polmone) ed in modo aberrante nei carcinomi di questi distretti (23-25, 27, 28). Il dominio centrale è caratteristico dei geni mucinici ed è costitutito da un numero variabile di tandem repeats (VNTR). L'analisi genica di MUC1 utilizzando un cdna ha rivelato la presenza di 7 esoni. Nel gene possono essere identificate 4 regioni: una regione N-terminale contenente una sequenza segnale idrofobica; un dominio centrale costitutito dalle tandem repeats; una regione C-terminale che codifica sequenze transmembrana e una porzione citoplasmatica di 69 aminoacidi. Il dominio centrale VNTR è localizzato nel secondo esone e consiste di 60 paia di basi ripetute che codificano per tandem repeats costituite da 20 aminoacidi (tabella 2). In ogni tandem repeat esistono 5 potenziali siti di O-glicosilazione, rappresentati dagli aminoacidi serina e treonina. MUC1 presenta un elevato grado di eterogeneità individuale sia a livello genico che di apomucina nel numero di tandem repeats, pertanto questo gene è altamente polimorfico nella popolazione (29-31). Questo polimorfismo suggerisce che la lunghezza del dominio VNTR è essenziale solo per il legame degli O-glicani ma non per la funzione della mucina stessa. In Fig. 1 è riportata la struttura del gene MUC1 e di altri due geni mucinici MUC2 e MUC5AC. Nella tabella 1 sono invece riportate le principali caratteristiche delle mucine epiteliali fino ad ora identificate. Riguardo alla biosintesi, è stato osservato che la molecola è inizialmente sintetizzata come un precursore ad alto peso molecolare nel reticolo endoplasmico; poi il precursore subisce un taglio proteolitico a carico della regione C-terminale della molecola con la conseguente formazione di due prodotti che rimangono associati, sebbene non siano legati da legami covalenti. Il primo prodotto, derivato dalla regione N-terminale, comprende la maggior parte del dominio extracellulare, mentre il secondo, più piccolo, è composto da soli 65 aminoacidi del dominio extracellulare (2, 32-35). E' probabile che tagli enzimatici addizionali siano necessari per il rilascio di MUC1 dalla superficie cellulare e che avvengano sulla superficie cellulare stessa o durante il processo di riciclaggio di proteine di membrana. E' stato dimostrato che le regioni transmembrana e citoplasmatica dell'apomucina MUC1 sono altamente conservate nella specie umana e in altre specie di mammifero, e ciò suggerisce un ruolo funzionale importante di queste regioni. In particolare è stato osservato che il dominio intracellulare C-terminale interagisce con i filamenti di actina del citoscheletro. Inoltre il dominio citoplasmatico di MUC1 è fortemente fosfori lato in serina e tale fosforilazione può essere aumentata mediante trattamento con vari fattori; questa evidenza suggerisce che la molecola può essere coinvolta nel trasferimento di segnali dall'ambiente esterno al citoplasma; questi segnali potrebbero essere di non-adesione e portare quindi alla perdita dei contatti cellula-cellula (36). Tuttavia su questo punto esistono delle controversie. Alcuni Autori ritengono infatti che MUC1 abbia funzioni antiadesive mediate tramite l'ingombro sterico e una carica globale negativa per la presenza dei residui di acidi sialici (36, 37). Tuttavia l'evidenza che il dominio extracellulare protru- de nm sopra la membrana plasmatica estendendosi maggiormente verso lo spazio pericellulare rispetto ad altre componenti, induce a pensare che la molecola possieda proprietà adesive favorendo l'adesione con quelle cellule che possiedono appropriati controrecettori. Questa ipotesi sembra essere confermata da un lavoro molto recente di Regimbald (38), in cui è stato dimostrato che MUC1 nelle cellule di carcinoma mammario rappresenterebbe il ligando per la molecola di adesione intercellulare endoteliale ICAM-1; quindi la mucina di membrana MUC1 medierebbe l'adesione delle cellule tumorali alle cellule endoteliali attraverso ICAM-1 e tale interazione può essere il momento critico nel processo di diffusione metastatica sistemica nel carcinoma mammario. Una esaltata espressione della mucina MUC1 d'altro canto può permettere alle cellule tumorali di eludere il sistema immunitario sia creando un possibile stato immunosoppressivo mediante induzione di un'anergia delle cellule-t, sia bloccando stericamente l'accesso delle cellule immunitarie effettrici verso altre componenti della membrana plasmatica delle cellule neoplastiche (39-41). Questa ipotesi spiegherebbe la prognosi sfavorevole associata ad una overespressione di MUC1 osservata in certi tumori umani. Vari studi sono attualmente in corso con l'obiettivo di identificare i meccanismi ed i fattori coinvolti nella regolazione dell' espressione genica di MUC1. Nella regione non codificante 5'(promotore) di questo gene sono state identificate numerose sequenze regolatorie. Inoltre nel gene sono stati descritti differenti siti di legame potenziale per fattori di trascrizione (es. SP1) e possibili sequenze consenso per il legame dei complessi recettoriali estrogenici e progestinici (42-44). Queste evidenze suggeriscono che l'espressione del gene MUC1 possa essere regolata dagli ormoni sessuali. Tale ipotesi ha trovato conferma in studi condotti sull'endometrio umano e di topo. Nell'endometrio umano i livelli di mrna specifico sono risultati bassi nella fase proliferativa e aumentano significativamente durante la fase secretoria, con una massima concentrazione nella fase d'impianto (45). Questo depone per una stimolazione della espressione del gene MUC1 da parte del progesterone esercitata in maniera diretta od indiretta. Nell'endometrio del topo la situazione è esattamente opposta, dove i più elevati livelli di MUC1 mrna si riscontrano nella fase estrogenica e pre-estrogenica, cioè quando i livelli ematici di estrogeni sono al loro massimo. I livelli più bassi di mrna si osservano invece nella fase d'impianto e durante questa fase l'espressione di MUC1 sembra modulata in senso negativo dal progesterone (46). Quindi è probabile che nel topo MUC1 agisca da barriera contro l'impianto dell'ovulo e che una diminuzione di espressione sia necessaria per generare una mucosa uterina recettiva. Anche il nostro gruppo, utilizzando come modello di studio cellule di carcinoma mammario ormone-dipendenti MCF7, si è dedicato allo studio in vitro della regolazione della espressione genica di MUC1 da parte di ormoni steroidei (estradiolo e progesterone) e di siero fetale privato della componente steroidea (47). I risultati nelle nostre mani indicano che i livelli di MUC1 mrna, determinati con la tecnica di northern-blot, sono maggiormente elevati in cellule coltivate in un medium contenente una concentra- LlGAND AS SAY VOL. 1 NUMERO 4 ANNO 1996

3 Tabella i Principali caratteristiche delle mucine e dei loro prodotti Gene Localizzazione cromosomica Lunghezza tandem repeats (n. aa) Mucina codificata MUCI Iq21 20 Secretoria; di membrana MUC2 llpl5 233 Secretoria; costitutiva del gel MUC3 7q22 17 Secretoria; costitutiva del gel MUC4 3q29 16 Secretoria MUC5AC llpls 8 Secretoria; costitutiva del gel MUC5B IlplS variabile Secretoria; costituti va del gel MUC6 llpls 169 Secretoria; non costitutiva del gel MUC Secretoria; non costitutiva del gel Tabella 2 Sequenze aminoacidiche delle unità tandem repeats Gene MUCI MUC2 MUC3 MUC4 MUCSC MUC5B MUC6 MUC7 Sequenza GSTAPPAHGVTSAPDTRPAP PTTTPITTTTTDTPPPTPTGTQT HSTPSFTSSITTTETTS TSSASTGHATPLPVTD TTSTTSAP VARIABILE SPFSSTGPNTA TSFQTTTTYPTPSHPQTTLPTHVPPFSTSL VTPSTGTVITPTHA WM A TSAS IHSTPT GTIPPPTTLKA TGSTHTAPPMTPTTSGTSQAHSSFST AKTSTSLHSHTSSTHHPEVTPTSTTTITPNP TSTGTSTPVHATTSATSSRLPTPFTTHSPPTGS TTAAPPTPSATTPAPPSSSAPPG zione 10% di siero fetale privo di steroidi, rispetto ai livelli di mrna riscontrabili in cellule coltivate in medium contenente solo il 2% di siero. Non è chiaro quale sostanza presente nel siero eserciti un effetto stimolatorio su MUC1, ma è altamente probabile che sia coinvolto l'lnsulin-like growth factor-1 (IG F-1), dal momento che recettori per l'igf sono stati identificati nelle cellule MCF7 e che questo fattore di crescita risulta estremamente importante per la proliferazione delle cellule di carcinoma mammario e per il loro comportamento biologico. Per quanto riguarda l'estradiolo ed il progesterone, noi non abbiamo osservato alcuna variazione dei livelli di mrna specifico in cellule trattate a differenti concentrazioni di tali steroidi. Tuttavia la mancanza di una "up-regulation" osservabile può essere correlata al fatto che i tempi utilizzati nel nostro studio siano stati troppo lunghi (dal momento che una possibile stimolazione della espressione genica può verificarsi per tempi limitati solo nelle prime fasi del trattamento), oppure la concentrazione di siero usata (2%) che non è ottimale e non ha consentito una apprezzabile regolazione genica. tandem repeat è composto da 23 aminoacici con 14 siti potenziali di glicosilazione (tabella 2). Oltre al dominio centrale che codifica per i tandem repeats, è presente anche un altro dominio di 347 aminoacidi che codifica tandem repeats ad elevato contenuto di serina, treonina e ( MUC1 ) ( MUC2 ) ( MUC5AC ) MUC2 Il gene MUC2 codifica per una tipica mucina costitutiva del gel viscoso. Il cdna di MUC2 è stato isolato da una libreria genomica ottenuta da tessuto intestinale umano (48, 49). Analizzando la organizzazione del gene MUC2, si riscontrano sia omologie sia differenze rispetto al gene MUC1. Analogamente a MUC1, MUC2 presenta un dominio centrale VNTR ricco in serina, treonina e prolina. Ogni FiGURA i Organizzazione schematica dei geni mucinici MUCi, MUC2 e MUC5AC. VNTR: numero variabile di tandem repeats; TMD: dominio tram-membrana; CTD: dominio citoplasmatico; TSRD: dominio ad alto contenuto di treonina/cisteina; CRD: dominio ad alto contenuto di cisteina. ligand ASSAY VOL. 1 NUMERO 4 ANNO 1996

4 prolina. La caratteristica più importante del gene MUC2 comunque è rappresentata dalla presenza di quattro domini ad elevato contenuto di cisteina. Questi domini (3 nella regione N-terminale e 1 nella regione C-terminale) sono costitutiti da elementi ripetitivi che presentano un elevato grado di omologia col dominio codificante il fattore di pre-pro von Willebrand (vwf) (dominio D). I domini D sono coinvolti nella oligomerizzazione del vwf e del suo immagazzinamento negli organelli di accumulo (corpi di Weibel-Palade). E' molto probabile che i domini D nel gene MUC2 svolgano un ruolo analogo dei domini D del pre-pro vwf: in particolare i residui nella regione D sono coinvolti nella formazione di ponti disolfuro intra- ed extra molecolari. Di particolare rilievo è il fatto che il gene MUC2 è localizzato in un locus sul cromosoma 11p15, vicino ai geni che codificano le mucine MUC5AC, MUC5B e MUC6. Tutti questi geni risultano espressi nelle cellule in cui immunoistochimicamente è riscontrabile del muco. Pertanto qj.leste evidenze suggeriscono che questi geni mucinici sul cromosoma 11 p15 farebbero parte di una famiglia poligenica i cui membri codificano per mucine secretorie costitutive il gel di rivestimento. MUC2 è la mucina predominante nel tessuto intestinale dove viene prodotta dalle cellule caliciformi mucipare. Alcuni dettagli sono stati ottenuti riguardo alla sintesi della glicoproteina (50-52). Innanzitutto, MUC2 è sintetizzata dapprima a livello del reticolo endoplasmico ruvido (RER) come precursore proteico con un peso molecolare apparente di 600 kd e con un elevato contenuto di mannosio; molto probabilmente anche il processo di oligomerizazione avviene nel RER. Successivamente MUC2 è poi trasportata nell'apparato di Golgi dove avvengono le O-glicosilazioni e l'aggiunta di residui di acido sialico, di fucosio e solfati. La molecola neosintetizzata viene quindi immagazzinata in vescicole che poi matureranno in granuli definitivi di accumulo durante il trasporto verso la porzione apicale della cellula. Il contenuto dei granuli verrà alla fine riversato nel lume intestinale per esocitosi. Alcuni studi recenti, in cui come modello è stata utilizzata una linea cellulare di adenocarcinoma del colon umano, hanno dimostrato come la secrezione di MUC2 possa avvenire sia in condizioni basali e regolate, che in condizioni stimolate e non regolate. Varie sostanze hanno la capacità di stimolare la secrezione della mucina, tra le quali quelle colinergiche sembrano rivestire il ruolo più importante (53, 54). MUC3 Il gene che codifica per la mucina MUC3 è molto grande ed è localizzato sul cromosoma 7q22 (55, 56). Ogni tandem repeat del dominio centrale è composto da 51 nucleotidi che codificano un peptide ripetitivo di 17 aminoacidi con 12 siti potenziali di glicosilazione (tabella 2). Molto poco si sa riguardo alla sintesi ed epressione di MUC3. L'apomucina MUC3 è prodotta dalle cellule caliciformi mucipare e, in quantità maggiori, dalle cellule intestinali assorbenti (57, 58). A differenza di MUC2, la mucina MUC3 non viene immagazzinata in granuli, ma probabilmente in microvescicole che rilasciano il contenuto nel glicocalice o direttamente nel lume intestinale. Studi di immunoistochimica e di ibridizzazione in situ indicano che nelle cellule intestinali assorbenti l'espressione di MUC3 è regolata spazialmente (59) ; infatti le cellule epiteliali cominciano ad esprimere MUC3 durante la migrazione dagli strati inferiori delle cripte del Lieberkuhn verso la superficie del colon. MUC4 Il gene MUC4 è stato isolato da una libreria di cdna estratto da tessuto bronchiale (60-62). Il gene è localizzato sul cromosoma 3q29 e anch'esso presenta la regione VNTR. Ogni tandem repeat è composta da 16 aminoacidi con 8 siti potenziali di glicosilazione (tabella 2). Anche per il gene MUC4 le informazioni riguardo la struttura e la biologia di questa mucina non sono molte. I dati disponibili indicano comunque che MUC4 è una mucina secretoria sintetizzata dalla maggior parte delle cellule epiteliali e ghiandolari dei tratti respiratorio, digestivo e genito-urinario. MUC5 Oltre a MUC4 altri 3 cdna sono stati ottenuti dalla mucosa umana tracheobronchiale e mappati sul cromosoma 11 p15 (60,63). Questi tre geni sono stati chiamati, per la loro origine comune, MUC5A, MUC5B e MUC5C, rispettivamente. Ulteriori studi hanno dimostrato che MUC5A e MUC5C fanno parte di uno stesso gene, denominato MUC5AC e che questo gene è differente da MUC5B. Il gene MUC5AC è preferenzialmente espresso nel tratto respiratorio e nelle mucose gastrica (antro e fondo) e riproduttiva; per contro il gene MUC5B è fortemente espresso nelle ghiandole bronchiali. Nel gene MUC5AC è possibile distinguere un dominio VNTR composto di sequenze ripetute di 24 paia di basi che codificano per la sequenza aminoacidica TTVTIAP (64, 65) (tabella 2). Oltre al dominio VNTR, nella proteina MUC5AC sono presenti vari domini ricchi in cisteina. E' probabile che questi domini ad alto contenuto cisteinico svolgano un ruolo nel processo di polimerizzazione, analogamente a quanto descritto per il gene MUC2. In ogni caso comunque, a differenza di MUC2, i domini ricchi in cisteina sono inseriti nel dominio VNTR o in un dominio non-ripetitivo ricco in treonina/serina, per cui nella struttura dell'apomucina MUC5AC è possibile riconoscere un grande dominio altamente glicosilato che contiene dei subdomini ricchi in cisteina ma scarsamente glicosilati. Il gene MUC5B presenta una caratteristica unica rispetto agli altri geni mucinici; infatti è l'unico gene mucinico umano ad esibire lunghezze variabili delle unità nucleotidiche ripetute nel dominio VNTR. Il significato biologico di questo peptide degenerato è tuttora ignoto. MUC6 Il gene MUC6 è stato isolato e caratterizzato usando una libreria di cdna da tessuto gastrico umano (66). Oltre ai geni MUC2, MUCAC e MUC5B, MUC6 è il quarto gene ad essere localizzato nel locus 11 p15. La sequenza del cdna è caratterizzata dalla presenza di un dominio VNTR di cui la singola unità ripetuta è lunga 507 nucleotidi (169 aminoacidi) (tabella 2). La lunghezza della singola unità ripetuta rende MUC6 abbastanza peculiare fra le mucine. L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

5 Infatti, la lunghezza del tandem repeat risulta 5 volte superiore rispetto alle unità ripetute nelle altre mucine umane. Inoltre, il dominio VNTR è costituito da varie unità, con la conseguenza che l'apomucina MUC6 è molto grande. Osservazioni biochimiche suggeriscono che lo scheletro proteico di MUC6 abbia un PM superiore a 600kO, che, fra quelli riportati fino ad ora per le apomucine, è il più elevato. MUC6 e MUC5AC sono le due specie maggiormente rappresentate nello stomaco. Studi di immunoistochimica, comunque, hanno dimostrato che la distribuzione tessutale di queste due mucine è differente e rispettivamente esclusiva (67). Infatti, MUC5AC è sintetizzata dalla superficie delle cellule mucose dell'antro e del fondo, mentre MUC6 è prevalentemente espressa nelle cellule mucose delle ghiandole gastriche e nelle cellule delle ghiandole piloriche. Poichè le cellule epiteliali mucose gastriche producono una mucina neutra e le ghiandole mucose gastriche producono una mucina acida, è molto probabile che MUC5AC e MUC6 rappresentino i rispettivi scheletri proteici. MUC7 Il gene MUC7, demoninato anche MG2, è stato recentemente clonato e sequenziato usando una libreria genomica di cona da ghiandola salivare (68). MUC7 è localizzato sul cromosoma 4 e contiene tandem repeats di 23 residui aminoacidici (tabella 2). Inoltre due residui di cisteina precedono i tandem repeats. La più vistosa caratteristica di MUC7 è il suo basso peso molecolare. La regione trascritta infatti, comprendente 1131 nucleotidi, codifica una proteina di soli 377 aminoacidi, con un peso molecolare apparente di 39 ko. I primi 20 residui costituisco il pepetide principale, mentre i rimanenti aminoacidi costituiscon la proteina secretoria. La molecola è secreta come monomero e pertanto i due residui di cisteina, localizzati prima del dominio delle tandem repeats, sono probabilmente coinvolti nei ponti disolfuro intramolecolari. La espressione di MUC7 è tessuto e cellulo-specifica. Studi di ibridizzazione in situ hanno rivelato che questo gene è espresso nei tessuti della ghiandola salivare umana ed esclusivamente in quelli contenenti cellule acinari mucose (68, 69). MUC7 è presente, per esempio, nelle ghiandole sottolinguali e sottomandibolari ma non nelle ghiandole paratiroidee in cui sono presenti cellule acinari sierose. Recentemente, una nuova mucina ad alto PM (MG 1) è stata clonata e parzialmente sequenziata utiliz- zando una libreria di cona di ghiandola sottolinguale umana (70). La regione C-terminale contiene sequenze ricche in cisteina, e ciò suggerisce che anche questa mucina è secreta come polimero. Dati preliminari indicano che MG1 risulta fortemente espressa solo nelle ghiandole sottolinguali. ESPRESSIONE DEI GENI MUCINICI NEI TESSUTI TUMORALI Una delle caratteristiche più importanti della espressione dei geni mucinici è il loro grado di specificità cellulare e tessutale. Come abbiamo già affermato in precedenza, alcune mucine, come ad es. MUC1 e MUC4, sono espresse in differenti tessuti, mentre altre, come ad es. MUC2, MUC3 e MUC7 presentano una espressione cellulare più ristretta. Nella tabella 3 sono riportati i siti preferenziali di espressione relativi ad ogni gene apomucinico. Una problematica importante è se questa specificità di espressione è mantenuta anche in condizioni patologiche differenti, tra cui la trasformazione neoplastica. Studi di immunoistochimica con anticorpi specifici per ogni apomucina e di ibridizzazione in situ con sonde nucleotidiche specifiche hanno dato alcuni chiarimenti iniziali riguardo a questi aspetti. Attualmente sono disponibili dati sulla espressione dei geni mucinici nei tessuti pancreatici, gastrici ed intestinali normali e nelle controparti trasformate. Per quanto riguarda i tessuti di altri distretti le conoscenze nelle nostre mani sono ancora limitate. Studi di ibridazione in situ hanno dimostrato che le cellule degli acici pancreatici esprimono solamente MUC1, mentre i dotti pancreatici normali mostrano reattività anche per sonde anti-muc3 e MUC5B (57, 71, 72). Per contro, MUC2, MUC4 e MUC5AC generalmente non sono espressi in cellule pancreatiche normali. La trasformazione neo plastica del pancreas esocrino è accompagnata da modificazione del pannello di espressione dei geni mucinici. Infatti, in seguito alla trasformazione neoplastica si verifica un sovvertimento della espressione di tali geni, per cui spesso si può riscontrare nel tessuto tumorale la presenza di MUC2, MUC4, MUC5AC. Il significato di questa alterazione di espressione è tuttora oscuro. Tuttavia è possibile che l'espressione di MUC2 e MUC5AC derivi da una differenziazione gastrointestinale spesso osservata nei tessuti tumorali pancreatici. Un altro esempio interessante è costituito dall'epitelio gastrico (73). Come descritto precedentemente, tre geni mucinici, cioè MUC1, MUC5AC e MUC6 so no fortemente Tabella 3 Siti preferenziali di espressione delle mucine Gene MUCI MUC2 MUC3 MUC4 MUC5AC MUC5B MUC6 MUC7 Locali zzazione tessutale Superficie apicale della maggior parte delle cellule epiteliali polarizzate dei tratti respiratorio, diges ti vo e genitourinario, incluso il tessuto mammario Intestino tenue e colon (cellule caliciformi mucipare), epitelio bronchiale (cellule calicoformi mu cipare) Intestino tenue (cellule assorbenti) Cellule epiteliali e ghiandolari dei tratti respiratorio, diges ti vo e genitourinario Stomaco (superficie delle cellule mucipare); tratti res piratori e genitourinari Epitelio bronchiale; dotti pancreatici Stomaco (cellule mucipare e ghiandolari); piloro (ghiandole del Brunner) Ghiandole sali vari (cellule mu cipare) LlGAND ASSAY VOlo 1 NUMERO 4 ANNO 1996

6 Tabella 4 Positività di espressione del gene MUC4 nel tessuto polmonare normale e tumorale Espressione elevata (++) Espressione intermedia (+) Espressione debole (±) Espressione assente Tessuto normale Tessuto tumora[e 0/10 3/18 3/10 9/ [11 8 espressi nello stomaco in condizioni normali. Il carcinoma gastrico, ed in particolare il tipo intestinale, è associato ad una diminuzione dell'espressione di queste mucine e alla comparsa ectopica di mucine tipiche dell'intestino quali MUC2, MUC3 e MUC4. Come avviene nel carcinoma pancreatico, anche nel caso del carcinoma gastrico la spiegazione per questa aberrante espressione può essere ricercata nella capacità delle cellule tumorali di acquisire caratteristiche intestinali e coloniche, attivando le vie metaboliche silenti. Inoltre, è stato osservato che l'espressione multipla delle apomucine è più frequente nel carcinoma gastrico avanzato che non in quello ai primi stadi. Attualmente, non è ancora chiaro se l'espressione multipla dei core peptidici di tali mucine rappresenti un indicatore di aggressività biologica o sia solo un evento secondario all'alterazione genetica spesso osservata nei tumori a stadio avanzato. Vari geni mucinici sono espressi nei tessuti intestinali e del colon normali. Come accennato prima, MUC1 è largamente espresso nelle cellule epiteliali, MUC2 è presente limitatamente alle cellule di globet, mentre MUC3 è distribuito uniformemente in tutto l'epitelio assorbente. La trasformazione neoplastica generalmente determina una riduzione dell'espressione di MUC2 e MUC3, accompagnata da un incremento della sintesi di MUC1 e MUC4 (74-76). Quest'ultima alterazione metabolica è stata descritta anche nel cancro polmonare. In un lavoro recente condotto dal nostro gruppo (28) è stata evidenziato come il gene MUC4 sia fortemente associato al cancro polmonare: infatti la espressione di MUC4, insieme a quella del gene MUC1, è risultata decisamente superiore nel tessuto polmonare tu morale rispetto alla controparte normale (tabella 4); in particolare, i più elevati livelli di RNA specifico sono stati osservati nell'istotipo adenocarcinoma che, come noto, è un tumore producente mucine. Ulteriori studi sono comunque necessari allo scopo di valutare il ruolo del gene MUC4 gene nel cancro polmonare e di correlare la sua espressione con altri parametri biologici, quali il grado istologico e lo stadio clinico. Nel carcinoma colo-rettale la diminuzione dell'espressione del gene MUC1 sembra avere un significato prognostico in quanto è associata alla progressione tumorale e agli stadi avanzati di malattia (77). Un significato prognostico della aumentata espressione di MUC1 è stato anche attribuito nel cancro della mammella (78-80). Molti autori, hanno dimostrato che pazienti con tumori ad elevata espressione di MUC1 spesso presentano una prognosi più sfavorevole, (cioè intervalli liberi da malattia più brevi e una sopravvivenza media generalmente ridotta). Risultati analoghi sono stati ottenuti in relazione alla espressione ectopica di MUC2, gene normalmente non espresso nei tessuti mammari (81). Tuttavia, va sottolineato che il peso dell'espressione aberrante di questi geni mucinici come indicatore prognostico nel cancro della mammella deve essere validato da ulteriori e più estesi studi clinici. RINGRAZIAMENTI Questo lavoro è stato in parte eseguito con il supporto finanziario del CNR-Prog. Finalizzato ACRO. Si ringrazia la Sig.ra Françoise Bonetti per la assistenza redazionale. BIBLIOGRAFIA 1. Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Jentoft N. Why are proteins O-glycosilated? Trends Biochem Sci, 1990; 15 : Ho SB, Kim YS. Carbohydrates antigens on cancer-associated mucin-like molecules. Semin Cancer Biol, 1992; 2: Carraway KL, Hull SR. Celi surface mucin type glycoproteins and mucin like domains. Glycobiol, 1991; 1 (2): Van K1inken BJ, Dekker J, Buller HA, Einerhand A W. Mucin gene structllre and expression: protection vs. adehsion. Am J Physiol, 1995 ; 269 (5): G Murray PJ, Spithill TW. Variants of Leishmania surface antigen derived from a mliltigenic family. J Biol Chem, 1991; 266: Di Noia 1M, Sanehes DO, Frase ACe. The protozoan Trypanosoma cruzi has a famili y of genes resembling the mucin genes of mammalian cells. J Biol Chem, 1995; 270 (41): Serrano AA, Sehenkman S, Yoshida N, Mehlert A, Richardson JM, Ferguson MA. The lipid structure of the glycosylphosphatidyliinositol-anchored mucin-like sialic acid acceptors of Trypanosoma cruzi changes during parasite differentiation from epimastigotes to infective metacyclic trypomastigote forms. J Biol Chem, 1995; 270 (45): Kramero AA, Arbatsky NP, Rozovsky YM, Mikhakeva EA, Polasskaya 00, Gvodev VA, Shibaev VN. MlIcin-type glycoprotein ti'om Drosohila Melanogaster embryonic cells: characterization of carbohydrate component. FEBS Lett, 1996; 378: Baumhueter S, Singer MS, Henzel W, Hemmerich S, Renz M, Rosen SD, Lasky LA. Bincling of L-selectin to the vasclilar sialomllcin CD34. Science, 1993; 262: Imai Y, Singer MS, Fennie e. lclentification of a carbohydrate-basecl enclothelial li gand for a lymphocyte homing receptor. J Cell Biol, 1996; I 13: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

7 12. Crommie D, Rosen SD. Biosynthesis of GlyCAM-l, a mucin-like ligand for L-selectin. J Bio1 Chem, 1995; 270 (8): Cheng J, Baurnhueter S, Cacalano G, Carver-Moore K, Thibodeaux H, Thomas R, Broxmeyer HE, Cooper S, Hague N, Moore M, Lasky LA. Hematopoietic defects in mice lacking the sialomucin CD34. Blood, 1996; 87(2): Hemmerich S, Leffler H, Rose SD. Structure of the O-glycans in GlyCAM-l, an endothelial-derived ligand for L-selectin. J Biol Chem, 1995; 270 (20): Sheehan JK, Thornton DJ, Somerville M, Carlstedt I. Mucin structure. The structure and heterogeneity of respiratory mucus glycoproteins. Am Rev Respir Dis, 1991; 144: S Davies JR, Hovenbers HW, Linden CJ, Howard R, Richardson PS, Shehan JK, Carlstedt I. Mucins in airway secretions from healthy and chronic bronchitic subjects. BiochemJ, 1996; 313: Reid L, Champ JR. Biochemical and histochemical nomenc1ature of mucus. Br Med Bull, 1978; 34: Bolshcer J, Veerman E, Van Niew Amerongen A, Tulp A, Verwperd D. Distinct populations of high-mr mucins secreted by different human sa1ivary glands discriminated by density-gradient electrophoresis. Biochem J, 1995; 309: Neutra MR, Forstner JF. Gastrointestinal mucus: synthesis, secretion, and function. In: Physiology of the gastrointestinal tract, edited by Johnson LR, pp , Raven press, New York, Allen A. Mucus: a protective secretion of complexity. Trends Biochem Sci, 1983; 8: Carlstedt I, Sheehan JK, Corfiels AP, Gallagher JT. Mucous glycoprotein: a gel of a problem. Essays Biochem, 1985; 20: Price MR, Tendler JB. Polymorphic epithelial mucins (PEM): molecular characteristics and association with breast cancer. The Breast, 1993; 2: Gendler SJ, Spicer AP, Lalani EN, Duhig T, Peat N, Burchell J, Pemberton L, Boshell M, Taylor-Papadimitriou J. Structure and biology of a carcinoma-associated mucin, MUCI. Am Rev Respir Dis, 1991; 144: S Swallow DM, Gendler S, Griffiths B, Kearney A, Povey S, Sheer D, Palmer RW, Taylor-Papadimitriou J. The hypervariable gene locus PUM, which encodes for the tumor-associated epithelial mucins, is located on chromosome I within the region Ig Ann Hum Genet, 1987; 51: Siddiqui J, Abe M, Hayes D, Shari E, Yunis E, Kufe D. Isolation and sequencing of a cdna coding for the human DF3 breast carcinoma-associated antigen. Proc NatI Acad Sci USA, 1988; 85: Peat N, Gendler SJ, Lalani EN, Duhig T, Taylor-Papadimitriou J. Tissue-specific expression of a human polymorphic epithelial mucin (MUCl) in transgenic mice. Cancer Res, 1992; 52: Girling A, Bartkova J, Burchell J, Gendler S, Gillet C, Taylor-Papadimitriou J. A core protein epitope of the polymorphic epithelial mucin detected by the monoc1onal antibody SM3 is selectively exposed in a range of primary carcinomas. Int J Cancer, 1989; 43: Seregni E, Botti C, Lombardo C, Cantoni A, Bogni A, Cataldo I, Bombardieri E. Pattern oi' mucin gene expression in normal and neoplastic lung tissues. Anticancer Res, 1996; 16: Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J, Gendler SJ. Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit. Biochem Bioph Res Comm, 1990; 173 (3) : IO Swallow DM, Gendler S, Griffiths B, Corney G, Taylor-Papadimitriou J, Bramwell ME. The human tumor-associated epithelial mucins are coded for by an expressed hypervariable gene locus PUM. Nature, 1987; 328: Gendler SJ, Burchell JM, Duhig T et al. Cloning of partial cdna encoding differentiation and tumour-associated mucin glycoproteins expressed by human mammary epithelium. Proc Nati Acad Sci USA, 1987; 84: Linsley PS, Kallestad JC, Horn D. Biosynthesis of high molecular weight breast carcinoma associated mucin glycoproteins. J Biol Chem, 1988; 263: Hilkens J, Buijs F. Biosynthesis of MAM-6, an epithelial sialomucin. J Biol Chem, 1988; 263: Hilkens J, Wesseling J, Vos HL. Episialin/MUCI: structure, modulation of cellular adhesion, promotion of invasion in vitro and cleft formation in vivo, and inhibition of immune cytolysis. Pl'Oceedings of the third International Workshop on Carcinoma-Assoeiated Mucin, 1994 Aug 7-11, Cambridge (UK). 35. Ligtenberg MJ, Kruijshaar L, Buijs F, van Meijer M, Litvinov SV, Hilkens.I. Cell-assoeiated episialin is a eomplex eontaining two pl'oteins derived from a eommon precurson. J Biol Chem, 1992; 267: Hilkens J, Ligtenberg MJL, Vos HL, Litvinov SV. Cell membrane assoeiated mucins and their adhesion modulating pl'operty. Trends Biochem Sci, 1992; 17: Ligtenberg MJL, Buijs F, Vos HL, Hilkens J. Suppression of cellular aggregation by high 1eve1s of episialin. Cancer Res, 1992; 52: Regimbald LH, Pilarski LM, Longeneker M, Reddish MA, Zimmermann G, Hugh Je. The breast mucin MUCI as a novel adhesion ligand for endothelial intercellular adhesion molecule I in breast cancer. Caneer Res, 1996; 56: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

8 39. Reddish MA, MacLean GD, Poppema S, Berg A, Longeneker BM. Pre-immunotherapy serum MUC-1 mucin level and CD69+ lymphocytes correlate with effects of synthetic sialyl-tn vaccine in active specific immunotherapy. Cancer Immunol Immunother: in presso 40. Hayes DF, Silberstein DS, Rodrique SW. DF3 antigen, a human epithelial celi mucin, inhibits adhesion of eosinophils to antibody-coated targets. J Immunol, 1990; 145: Ogata S, Maimonis PJ, Itzkowitz SH. Mucin bearing the cancer-associated sialosyl-tn antigen mediate inhibition of natural killer celi cytotoxicity. Cancer Res, 1992;52: Abe M, Kufe D. Characterization of cis-acting elements regulating transcripti on of the human DF3 breast carcinoma- associated antigen (MUC l) gene. Proc NatI Acad Sci USA, 1993; 90: Kovarik A, Peat N, Wilson D, Gendler SJ, Taylor-Papadimitriou J. Analysis of the tissue-specific promoter of the MUC I gene. J Biol Chem, 1993 ; 268 (13): Gollub EG, Waksman H, Goswami S, Marom Z. Mucin genes are reglliated by estrogen and dexamethasone. Biochem Bioph Res Commun, 1995; 217 (3): Hey NA, Graham RA, Seif MW, Aplin ID. The polymorphic epithelial mucin MUCI in human endometrium is regulated with maximal expression in the implantation phase. J Clin Endocrinol Metab, 1994; 78: Surveyor GA, Gendler SJ, Pemberton L, Das SK, Chakraborty I, Julian J, Pimental RA, Wegner CC, Dey SK, Carson DD. Expression and steroid hormonal control of MUC-l in the mouse uterus. Endocrinology, 1995; 136: Botti C, Seregni E, Lombardo C, Massaron S, Bombardieri E. Effects of steroid-free fetal serum and steroid supplementation on MUCI gene expression in human breast cancer celliine MCF7. Anticancer Res: in presso 48. Gum JR, Byrd JC, Hicks JW, Toribara NW, Lamport DT, Kim VS. Molecular cloning of human intestinal mucin cdnas. J Biol Chem, 1989; 264: Gum JR, Hicks.TV, Toribara NW, Siddiqlli B, Kim VS. Molecular cloning of human intestinal mucin (MUC2) cdna. ldentification of the amino terminus and overal! sequence similarity to prepro-von Willebrand factor. J Biol Chem, 1994; 269: Strouss GJ, Dekker J. Mucin-type glycoproteins. Crit Rev Biochem Moi Biol, 1992; 27: Tytgat KMAJ, Buller HA, Opdam FJM, Kim YS, Einerhand A W, Dekker J. Biosynthesis of human coloni c mucin: MUC2 is the prominent secretory mucin. Gastroenterology, 1994; 107: McCool DJ, Forstner F, Forstner GG. Regulated and unregulated pathways for MUC2 mucin secretion in human colonic LS 180 adenocarcinoma cel!s are distinct. Biochem J, 1995; 312: Specian RD, Neutra MR. Mechanism of rapid mucus secretion in Gob1et cells stimulateel by acetylcholine. J Celi Biol, 1980; 85 : Phillips TE, Phillips TH, Neutra MR. Regulation of intestinal Goblet cell secretion. III. Isolated intestinal epithelium. Am J Physiol, 1984; 247: G674-G Fox MF, Lahbib F, Pratt W, Attwood J, Gum J, Kim YS, Swallow DM. Regiona1 loca li zation of the intestinal mucin gene MUC3 to chromosome 7q22. Ann Hum Genet, 1992; 56: Gum JR, Hicks JW, Swallow DM, Lagace RL, Byrd JC, Lamport DT, Siddiqui B, Kim VS. Molecular cloning of cdnas derived from a novel human intestinal mucin gene. Biochem Biophys Res Commlln, 1990; 171 : Ho SB, Niehans GA, Lyftogt C, Yan PS, Cherwitz DL, Gum ET, Dahiya R, Kim VS. Heterogeneity of mucin gene expression in normal and neoplastic tissues. CancerRes, 1993; 53: Niv Y, Bird JC, Ho SB, Dahiya R, Kim VS. Mucin synthesis and secretion in relation to spontaneous differentiation of colon cancer cells in vitro. Int J Cancer, 1992; 50: Chang SK, Dohrman AF, Basbaum CB, Ho SB, Tsuda T, Toribara NW, Gum.TR, Kim VS. Localization of mucin (MUC2 anel MUC3) messenger RNA anel peptiele expression in hllman normal intestine and colon cancer. Gastroenterology, 1994; 107: Aubert JP, Porchet N, Crepin M, Duterque-Coqullard M, Vergnes G, Mazzucca M, Debuire B, Peptiprez D, Degand P. Evidence for different hllman tracheo-bronchial mucin peptides deduced from nucleotide cdna sequences. Am J Respir Cel! Mol Bi ol, 1991;5: Gross MS, Guyonnet DV, Porchet N, Bernheim A, Aubert JP, Nguyen VC. Mucin 4 (MUC4) gene: regional assignment (3q29) ami RFLP analysis. Ann Genet, 1992; 35: Porchet N, Van Cong N, Dufosse J, Audie JP, Guyonnet-Duperat V, Gross MS, Denis C, Degand P, Bernheim A, Aubert JP. Moleclliar cloning and chromosomal localization of a novel hllman tracheobronchial mucin cdna containing tandemly repeated sequences of 48 base pairs. Biochem Biophys Res Commun, 1991; 175: Nguyen VC, Aubert JP, Gross MS, Porchet N, Degand P, Frezal J. Assignment of hllman tracheobronchial mucin gene(s) to II P 15 and a tracheobronchial mllcin-re1ated sequence to chromosome 13. HlIm Genet, 1990; 86: Guyonnet Duperat V, Audie.TP, Debailleul V, Laine A, Buisine MP, Galiegue-Zowitina S, Pigny P, Degnad P, Aubert JP, Porchet N. Characterization of the human mucin gene MUCAC: a consensus L1GAND ASSAY VOL. 1 NUMERO 4 ANNO 1996

9 cysteine-rich domain for I Ip15 mucin genes? Biochem J, 1995; 305 : Buisine MP, Janin A, Maunoury V, Audie JP, Delescaut MP, Copin MC, Colombel JF, Degand P, Aubert JP, Porchet N. Aberrant expression of a human mucin gene (MUC5AC) in rectosigmoid villous adenoma. Gastroenterology, 1996; l IO: Toribara NW, Roberton AM, Ho SB, Kuo WL, Gum E, Hicks JW, Gum JR, Byrd JC, Siddiqui B, Kim YS. Human gastric mucin. Identification 01' a unique species by expression cloning. J Biol Chem, 1993; 268: Ho SB, Roberton AM, Shekels LL, Lyftog CT, Niehans GA, Toribara NW. Expression cloning 01' gastric mucin complementary DNA and localization of mucin gene expression. Gastroenterology, 1995; 109: Bobek LA, Tsai H, Biesbrock AR, Levine MJ. Molecular cloning, sequence, and specificity of expression of the gene encoding the low molecular weight human salivary mucin (MUC7). J Biol Chem, 1993; 268 (27): Cohen RE, Arguirre A, Neiders A, Levine MJ, Jones PC, Reddy MS, Haar JG. Immunochemistry and immunogenicity oi' low molecular weight human. salivary mucin. Arch Oral Biol, 1991; 36: Troxler RF, Offner GD, Zhang F, Iontcheva I, Oppenheim FG. Molecular cjoning of a novel high molecular weight mucin (MG l) from human sublingual gland. Biochem Biophys Res Commun, 1995; 217 (3): Balague C, Gambus G, Carrato C, Porchet N, Aubert JP, Kim YS, Real FX. Altered expression of MUC2, MUC4, and MUC5 mucin genes in pancreas tissues and cancer celi lines. Gastroenterology, 1994; 106: Balague C, Audie JP, Porchet N, Real FX. In situ hybridization shows distinct patterns of mucin gene expression in normal, benign, and malignant pancreas tissues. Gastroenterology, 1995; 109: Ho SB, Shekels LL, Toribara NW, Kim YS, Lyftog C, Cherwitz DL, Niehans GA. Mlicin gene expression in normal, preneoplastic, and neopl astic hllman gastric epithelium. Cancer Res, 1995; 55: 268 I Audie JP, Janin A, Porchet N, Copin MC, Gosselin B, Aubert JP. Expression of hllman mucin genes in respiratory, digestive, and reprodllctive tracts ascertained by in situ hybridization. J Hi stochem Cytochem, 1993; 41: Ogata S, Uehara H, Chen A, Itzkowitz SH. Mucin gene expression in colonic ti ssues and ce li lines. Cancer Res, 1992; 52: Velcich A, Palumbo L, Jarry A, Laboisse C, Racevskis J, Augentlich L. Patterns or expression 01' lineage-specific markers dllring the in vitro-induced differentiation 01' HT29 colon carcinoma celis. Celi Growth &Differentiation, 1993; 6: Nakamori S, Ota DM, Cleary KR, Shirotani K, Irimura T. MUCI mllcin expression as a marker 01' progression and metastasis of human colorectal carcinoma. Gastroenterology, 1994; 106: Ellis IO, BelI J, Todd.IM, WilIiams M, Dowle C, Robins AR, Eison CW, Blamey RW, Baldwin RW. Evaluation of immunoreactivity with the monoclonal antibody NCRC-II in breast cancer. Br J Cancer, 1987; 56: Muir 1M, Reed RG, Stacker SA, Alexander AI, McKenzie IF, Bennet RC. The prognostic value of immunoperoxidase staining with monoclonal antibodies NCRC-l I and 3E1.2. Br J Cancer, 1991; 64: McGuckin MA, Walsh MD, Hohn BG, Ward BG, Wright RG. Prognostic significance of MUCI epithelial mucin expression in breast cancer. Hum Pathol, 1995; 26 (4): Walsh MD, McGuckin MA, Devine PL, Hohn BG, Wright RG. Expression of MUC2 epithelial mucin in breast carcinoma. J Clin Pathol, 1993; 46: LlGAND ASSAY VOL. 1 NUMERO 4 ANNO 1996


I MARCATORI TUMORALI CLASSICI I MARCATORI TUMORALI CLASSICI Serenella Valaperta - Laboratorio Analisi Vanzago, 14 aprile 2011 Marcatore tumorale una sostanza misurabile quantitativamente nei tessuti e nei liquidi corporei, che possa


Her-2 nel carcinoma mammario

Her-2 nel carcinoma mammario Her-2 nel carcinoma mammario Piera Balzarini U.O. Anatomia Patologica Università degli Studi di Brescia Spedali Civili di Brescia Il gene ERBB2 dà origine ad un recettore tirosin-chinasico appartenente


scaricato da

scaricato da Recettori a tirosina chinasi I recettori a tirosina chinasi presentano vari domini Una regione di legame (extracellulare) Una regione transmembrana Una coda intracellulare con numerose tirosine scaricato


Her2/neu Il ruolo del Pertuzumab

Her2/neu Il ruolo del Pertuzumab Università degli Studi di Torino Corso di Laurea Specialistica in Biotecnologie Mediche Her2/neu Il ruolo del Pertuzumab Corso di Immunologia Molecolare Anno Accademico 2007/08 Elisa Migliore Her2 nelle


IL-2R & IL-15R Alice Praduroux

IL-2R & IL-15R Alice Praduroux Università degli Studi di Torino Facoltà di Biotecnologie Molecolari Anno Accademico 2006/2007 Corso di Immunologia Molecolare IL-2R & IL-15R Alice Praduroux Classificazione Recettori appartenenti alla


L endocitosi dell EGFR

L endocitosi dell EGFR L endocitosi dell EGFR IFOM per la scuola Lo Studente Ricercatore 2011 Muzio Giulia Istituto d Istruzione Superiore Maserati Voghera Gruppo di lavoro: Determinanti della trasformazione neoplastica e della


Downloaded from. Migrazione cellulare

Downloaded from. Migrazione cellulare Downloaded from Migrazione cellulare Migrazione dei leucociti I leucociti migrano nei diversi tessuti dell organismo l interazione tra le cellule migranti e le cellule dei tessuti


DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2

DOMINI E MODULI 02/04/2014. Domini modulari delle proteine 2 Domini modulari delle proteine 1 Proteine della matrice DOMINI E MODULI La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette domini,


Il TCR è un eterodimero costituito da due catene polipeptidiche chiamate catena α ecatenaβ legate insieme da un ponte disolfuro. Entrambe le catene

Il TCR è un eterodimero costituito da due catene polipeptidiche chiamate catena α ecatenaβ legate insieme da un ponte disolfuro. Entrambe le catene I linfociti T sono le cellule dell immunità adattativa responsabili della protezione verso le infezioni ad opera dei microbi intracellulari. Essi derivano da cellule staminali del midollo osseo che si


Seminario. Domini modulari delle proteine 1

Seminario. Domini modulari delle proteine 1 Seminario Proteine della matrice DOMINI E MODULI Domini modulari delle proteine 1 La maggior parte dei peptidi consiste in disposizioni lineari di regioni globulari, ripiegate in modo indipendente, dette



7a. COMPARTIMENTI INTRACELLULARI 7a. COMPARTIMENTI INTRACELLULARI contiene materiale protetto da copyright, ad esclusivo uso personale; non è consentita diffusione ed utilizzo di tipo commerciale molte delle reazioni chimiche che avvengono


PROTEINE. Amminoacidi

PROTEINE. Amminoacidi PROTEINE Le proteine sono le macromolecole alla base delle attività cellulari. Sono oltre diecimila per cellula, dove svolgono differenti funzioni: Sono ad esempio: enzimi: aumentano la velocità delle






NEUROENDOCRINI GENERICI L indagine immunoistochimica richiesta prevede l utilizzo di marcatori neuroendocrini generici NEUROENDOCRINI GENERICI Enolasi Neurono-Specifica (NSE) Sinaptofisina (SYN) Cromogranina generalmente di tipo


Servizi di Ricerca a Terzi. Luglio 2015

Servizi di Ricerca a Terzi. Luglio 2015 Servizi di Ricerca a Terzi Luglio 2015 Chi siamo Vera Salus Ricerca S.r.l. (VSR) è una target discovery biotech company che mette a disposizione le proprie competenze e la propria strumentazione in qualità


Recettori di superficie

Recettori di superficie Recettori di superficie Esistono 3 classi principali di recettori di superficie 1. Recettori annessi a canali ionici 2. Recettori accoppiati alle proteine G 3. Recettori associati ad enzimi Recettori


Regione cerniera monomero regione cerniera

Regione cerniera monomero regione cerniera Regione cerniera Tutte le Ig, sia quelle secrete che quelle presenti sulla membrana plasmatica dei linfociti B, sono costituite da quattro catene proteiche, due pesanti (H, da heavy, in rosso nel disegno)


Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B

Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B Downloaded from Riarrangiamento dei geni per le Immunoglobuline e sviluppo dei linfociti B I geni che codificano i recettori per gli antigeni (BCR e TCR) sono presenti in uno


Citosol Ribosomi Sintesi proteica

Citosol Ribosomi Sintesi proteica CITOSOL (1) Citosol Ribosomi Sintesi proteica Biotecnologie_2012 Tutta la porzione non strutturata che costituisce la parte liquida del citoplasma. In esso si trovano in soluzione tutte le molecole necessarie


Innovazioni diagnostiche in oncologia: il ruolo del laboratorio

Innovazioni diagnostiche in oncologia: il ruolo del laboratorio Innovazioni diagnostiche in oncologia: il ruolo del laboratorio Inspired to innovate Dott.ssa Annamaria Passarelli Direttore di U.O.C. di Medicina di Laboratorio A USL RM G Tivoli Indicazioni per l impiego


La Biopsia Prostatica: where are we going?

La Biopsia Prostatica: where are we going? La Biopsia Prostatica: where are we going? Sabato 28 Novembre 2015, Catania Dott. Michele Salemi Screening genetico correlato a rischio di carcinoma prostatico. BRCA1, BRCA2, TP53, CHEK2, HOXB13 e NBN:


Citochine dell immunità specifica

Citochine dell immunità specifica Citochine dell immunità specifica Proprietà biologiche delle citochine Sono proteine prodotte e secrete dalle cellule in risposta agli antigeni Attivano le risposte difensive: - infiammazione (immunità


Anticorpi monoclonali anti-egfr

Anticorpi monoclonali anti-egfr Università degli Studi di Torino Laurea Specialistica in Biotecnologie Molecolari Corso di Immunologia Prof.G.Forni Anticorpi monoclonali anti-egf Lara Fontani Famiglia recettori T erbb/her Ligandi EGF




Controllo post-trascrizionale dell espressione genica

Controllo post-trascrizionale dell espressione genica Controllo post-trascrizionale dell espressione genica Livelli di controllo dell espressione genica Rivisitazione del concetto di gene Per gli organismi eucariotici più evoluti il dogma un gene = una proteina



EPITHELIAL TO MESENCHYMAL TRANSITION (EMT) IN DEVELOPMENT AND DISEASES. Cristina Valacca 18 Maggio 2012 EPITHELIAL TO MESENCHYMAL TRANSITION (EMT) IN DEVELOPMENT AND DISEASES Cristina Valacca 18 Maggio 2012 DEFINIZIONE L'EMT è un processo biologico che consente a una cellula epiteliale di iniziare numerosi


Mediatore chimico. Recettore. Trasduzione del segnale. Risposta della cellula

Mediatore chimico. Recettore. Trasduzione del segnale. Risposta della cellula Mediatore chimico Recettore Trasduzione del segnale Risposta della cellula I mediatori chimici sono prodotti da cellule specializzate e sono diffusi nell organismo da apparati di distribuzione Sistemi


Epithelial-Mesenchymal Transition in Cancer. Relevance of Periostin Splice Variants

Epithelial-Mesenchymal Transition in Cancer. Relevance of Periostin Splice Variants DISS. ETH NO. 19590 Epithelial-Mesenchymal Transition in Cancer Relevance of Periostin Splice Variants A dissertation submitted to the ETH Zurich For the degree of Doctor of Sciences Presented by Laura


Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1

Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1 Uso di vettori lentivirali per trasdurre linee cellulari di adenocarcinoma colorettale con shrnas silenzianti il gene herg1 e loro applicazione in studi pre-clinici. Il trasferimento genico è una tecnologia


Colture cellulari Modelli in vitro applicati alla nutrizione

Colture cellulari Modelli in vitro applicati alla nutrizione Colture cellulari Modelli in vitro applicati alla nutrizione ESEMPI: Valutazione dell attività biologica di fattori coinvolti nella regolazione della proliferazione cellulare e differenziazione cellulare


Fibrillina Sindrome di Marfan sindrome di Marfan sindrome di Marfan Sindrome di Marfan Fibrillina 1

Fibrillina Sindrome di Marfan sindrome di Marfan sindrome di Marfan Sindrome di Marfan Fibrillina 1 Genoma La determinazione e la conoscenza dell intera sequenza genomica è la condizione necessaria per comprendere la biologia di un determinato organismo Il genoma contiene le istruzioni (geni) per la








Meccanismi molecolari di trasduzione del segnale. Le vie di trasduzione del segnale sono molto specifiche ed estremamente sensibili.

Meccanismi molecolari di trasduzione del segnale. Le vie di trasduzione del segnale sono molto specifiche ed estremamente sensibili. Meccanismi molecolari di trasduzione del segnale. Le vie di trasduzione del segnale sono molto specifiche ed estremamente sensibili. La sensibilita delle vie di trasduzione dipende da 3 fattori: -l affinita



SOLUZIONI AI PROBLEMI DEL CAPITOLO 21. Domande concettuali SOLUZIONI AI PROBLEMI DEL CAPITOLO 21 Domande concettuali C1. La genomica strutturale studia la composizione di un genoma. Lo scopo è di mappare tutti i geni nel genoma e alla fine di determinare la sequenza


Funzioni delle proteine del sangue:

Funzioni delle proteine del sangue: PROTEINE DEL SANGUE Funzioni delle proteine del sangue: 1. Funzioni nutrizionali 2. Regolazione dell equilibrio acido base 3. Ripartizione dell acqua nei vari distretti 4. Funzione di trasporto 5. Coagulazione


ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma.

ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna Per ncdna si intende il DNA intronico, intergenico e altre zone non codificanti del genoma. ncdna è caratteristico degli eucarioti: Sequenze codificanti 1.5% del genoma umano Introni in media 95-97%


Anticorpi monoclonali Anti-EGFR. -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri. Valentina Anrò

Anticorpi monoclonali Anti-EGFR. -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri. Valentina Anrò Anticorpi monoclonali Anti-EGFR -Ruolo Biologico -Evidenze terapeutiche -Problemi -Sviluppi futuri Valentina Anrò Ruolo Biologico Epidermal Growth Factor Receptor Extracellular Domain Transmembrane Domain



REGOLAZIONE DELL ESPRESSIONE GENICA REGOLAZIONE DELL ESPRESSIONE GENICA Solo una piccola parte dei 4000 geni che costituiscono il genoma batterico o dei circa 30000 geni del genoma umano viene espressa in maniera costante (GENI COSTITUTIVI)


RNA polimerasi operone. L operatore è il tratto

RNA polimerasi operone. L operatore è il tratto La regolazione genica nei procarioti Alcune proteine vengono prodotte dalla cellula ad un ritmo relativamente costante e l attività dei geni che codificano queste proteine non è regolata in modo sofisticato.


Vettori di espressione

Vettori di espressione Vettori di espressione Vengono usati per: 1.Generare sonde di RNA 2.Produrre la proteina codificata Per fare questo viene utilizzato un promotore che risiede sul vettore, modificato per ottimizzare l interazione


Cura personalizzata del tumore del colon-retto metastatico: Che cosa è importante sapere

Cura personalizzata del tumore del colon-retto metastatico: Che cosa è importante sapere Cura personalizzata del tumore del colon-retto metastatico: Che cosa è importante sapere In sintesi In passato: la cura del cancro era decisa sulla base della sede di origine della neoplasia (seno, intestino,


Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a.

Università di Roma Tor Vergata - Corso di Laurea in Scienze Biologiche - Immunologia Molecolare - dott. Claudio PIOLI - a.a. Anticorpi generalità Riconoscimento antigene Anticorpi Molecole MHC Recettore per l Ag dei linfociti T (TCR) Anticorpi riconoscono diversi tipi di strutture antigeniche macromolecole proteine, lipidi,


SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione

SINTESI DELL RNA. Replicazione. Trascrizione. Traduzione SINTESI DELL RNA Replicazione Trascrizione Traduzione L RNA ha origine da informazioni contenute nel DNA La TRASCRIZIONE permette la conversione di una porzione di DNA in una molecola di RNA con una sequenza


Analisi Molecolare di sequenze di acidi nucleici

Analisi Molecolare di sequenze di acidi nucleici Analisi Molecolare di sequenze di acidi nucleici 1. L Analisi di restrizione di frammenti o RFLP (Restriction Fragment Lenght Polymorphism) di DNA comporta lo studio delle dimensioni dei frammenti di DNA


04/04/14. Fondamenti di biochimica Terza edizione. Le ghiandole principali del sistema endocrino. Capitolo 13 La segnalazione biochimica

04/04/14. Fondamenti di biochimica Terza edizione. Le ghiandole principali del sistema endocrino. Capitolo 13 La segnalazione biochimica Fondamenti di biochimica Terza edizione Donald Voet Judith G. Voet Charlotte W. Pratt La segnalazione biochimica Copyright 2013 Zanichelli editore S.p.A. Gli ormoni Conce& chiave 13.1 Gli ormoni endocrini


Alterata regolazione del ciclo cellulare: un nuovo meccanismo patologico coinvolto nella deplezione delle cellule T CD4+ nell infezione da HIV

Alterata regolazione del ciclo cellulare: un nuovo meccanismo patologico coinvolto nella deplezione delle cellule T CD4+ nell infezione da HIV Alterata regolazione del ciclo cellulare: un nuovo meccanismo patologico coinvolto nella deplezione delle cellule T CD4+ nell infezione da HIV ADULTS AND CHILDREN ESTIMATED TO BE LIVING WITH HIV/AIDS,


Corso di Biologia Molecolare

Corso di Biologia Molecolare Corso di Biologia Molecolare Dott.ssa Renata Tisi Dip. Biotecnologie e Bioscienze Ed. U4 Tel. 02 6448 3522 Acidi nucleici Il ruolo degli acidi nucleici è quello di custodire e trasmettere


frazionamento). Per ciascuna frazione è determinata la quantità di proteine totali e le unità di attività enzimatica della proteina di interesse.

frazionamento). Per ciascuna frazione è determinata la quantità di proteine totali e le unità di attività enzimatica della proteina di interesse. Ogni passaggio della procedura di purificazione determina la separazione delle proteine totali presenti nel campione in una serie di frazioni (frazionamento( frazionamento). Per ciascuna frazione è determinata


Distribuzione e composizione dei liquidi corporei

Distribuzione e composizione dei liquidi corporei Distribuzione e composizione dei liquidi corporei Cavità principali del corpo umano Dee Unglaub Silverthorn, Fisiologia umana 2010 Pearson Italia S.p.A Organizzazione generale dell organismo: un visione


Cenni storici. Tale tecnica trova largo impiego in tutte le aree di ricerca biologica:

Cenni storici. Tale tecnica trova largo impiego in tutte le aree di ricerca biologica: DNA Microarray: griglia di DNA costruita artificialmente, in cui ogni elemento della griglia riconosce una specifica sequenza target di RNA o cdna. Tale tecnica trova largo impiego in tutte le aree di


La regolazione genica nei virus

La regolazione genica nei virus La regolazione genica nei virus Lic. Scientifico A. Meucci Aprilia Prof. Rolando Neri I VIRUS INDICE Caratteristiche dei virus: il capside e il genoma virale Classificazione virale Fasi del ciclo riproduttivo


RD-100i. OSNA la nuova generazione nell analisi del linfonodo sentinella nel carcinoma mammario

RD-100i. OSNA la nuova generazione nell analisi del linfonodo sentinella nel carcinoma mammario RD-1i OSNA la nuova generazione nell analisi del linfonodo sentinella nel carcinoma mammario RD-1i OSNA la nuova generazione nell analisi del linfonodo sentinella nel carcinoma mammario La biopsia del


Continua. Peptidasi H 2 O

Continua. Peptidasi H 2 O Continua Peptidasi H 2 O Classificazione delle peptidasi 1. Meccanismo catalitico 2. Tipo di reazione catalizzata 3. Struttura molecolare e omologia 1. Meccanismo catalitico (mostrato per la chimotripsina)



DI REGOLAZIONE A DUE COMPONENTI LEZIONE 16 Sistemi di regolazione SISTEMI DI REGOLAZIONE A DUE COMPONENTI In che modo un batterio sente e risponde a specifici segnali provenienti dall ambiente? Per esempio, nel caso dell operone lac


IL 12R e IL 27R. Diego Alberti

IL 12R e IL 27R. Diego Alberti IL 12R e IL 27R Diego Alberti Caratteristiche generali IL 12R e IL 27R appartengono alla famiglia di citochine/recettori di tipo I La classe I di recettori è caratterizzata da 4 residui di cisteina conservati


Legame al GMPciclico COOH

Legame al GMPciclico COOH Moduli strutturali delle proteine Nelle proteine è possibile individuare alcune strutture caratterizzate da omologia, che svolgono particolari funzioni, e che si ritrovano in proteine diverse. Si può parlare


Lezioni di biotecnologie

Lezioni di biotecnologie Lezioni di biotecnologie 2 Lezione 2 Analisi del DNA e delle proteine 3 Analizzare DNA e proteine Per le applicazioni delle biotecnologie è di fondamentale importanza: 1. essere in grado di identificare


La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie

La trascrizione negli eucarioti. Prof. Savino; dispense di Biologia Molecolare, Corso di Laurea in Biotecnologie La trascrizione negli eucarioti Il promotore eucariotico L inizio della trascrizione negli eucarioti necessita della RNA polimerasi e dei fattori di trascrizione. Qualsiasi proteina sia necessaria per





Le cellule cancerose

Le cellule cancerose Le cellule cancerose Cosa è il cancro? Malattia che insorge in conseguenza di anomalie della funzionalità cellulare E la Seconda causa di morte si possono sviluppare in quasi tutti gli organi Le diverse


La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013

La sindrome di Lynch. Cancro colonrettale ereditario non poliposico o HNPCC. G. A. Pablo Cirrone. lunedì 11 marzo 2013 La sindrome di Lynch Cancro colonrettale ereditario non poliposico o HNPCC G. A. Pablo Cirrone 1 Caratteristiche generali I HNPCC (Hereditary Non-Polyposis Colonrectal Cancer) è caratterizzato dalla comparsa,





La biopsia del linfonodo sentinella nel carcinoma. Dott. S.Folli S.C. Senologia AUSL Forlì

La biopsia del linfonodo sentinella nel carcinoma. Dott. S.Folli S.C. Senologia AUSL Forlì La biopsia del linfonodo sentinella nel carcinoma duttale in situ: : si,no, forse Dott. S.Folli S.C. Senologia AUSL Forlì Definizione Il carcinoma duttale in situ della mammella è una


I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese

I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese I markers biologici come fattori predittivi di efficacia terapeutica nei tumori solidi: l esperienza di Varese Daniela Furlan U.O. Anatomia Patologica, Ospedale di Circolo e Fondazione Macchi, Varese Il


Incontro con bioinformatici

Incontro con bioinformatici Incontro con bioinformatici Giuseppe Macino Universita di Roma La Sapienza Quanto DNA e contenuto nei genomi di Amoeba dubia 670 miliardi c.b Zea maize 4 miliardi c.b. Homo sapiens 2,9 miliardi c.b Arabidopsis


Dal paziente al gene malattia : il clonaggio posizionale del gene Met

Dal paziente al gene malattia : il clonaggio posizionale del gene Met Dal paziente al gene malattia : il clonaggio posizionale del gene Met Una storia di interazione fra Medicina e Ricerca a cura di Debora Angeloni, Ph.D., Settore di Medicina Scuola Estiva di Orientamento





Applicazioni biotecnologiche in systems biology

Applicazioni biotecnologiche in systems biology Applicazioni biotecnologiche in systems biology Lezione #6 Dr. Marco Galardini AA 2012/2013 Gene regulation analysis Lezione #6 Dr. Marco Galardini AA 2012/2013 Regolazione genica Elementi molecolari e


Proliferazione e morte cellulare sono eventi fisiologici

Proliferazione e morte cellulare sono eventi fisiologici MORTE CELLULARE Proliferazione e morte cellulare sono eventi fisiologici Omeostasi tissutale (di tessuti dinamici) Sviluppo embrionale Eliminazione di strutture corporee inutili - Fasi di scultura/rimodellamento


Si dividono in: N-glicosilate (su Asparagina) O-glicosilate (su Serina o Treonina. Raramente su Tirosina, idrossiprolina, idrossilisina)

Si dividono in: N-glicosilate (su Asparagina) O-glicosilate (su Serina o Treonina. Raramente su Tirosina, idrossiprolina, idrossilisina) GLICOSILAZIONE La glicosilazione è la modificazione PTM più diffusa. Circa il 50% delle proteine umane sono glicosilate Caratteristica di molte proteine della superficie cellulare e delle d proteine di

Dettagli FARMACODINAMICA La farmacodinamica può essere definita come lo studio degli effetti biochimici e fisiologici dei farmaci e dei loro meccanismi d azione. Gli obiettivi dell analisi





Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16

Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16 Laboratorio di Tecniche Microscopiche AA 2007-2008 Lezione 12 Marzo 2008 Ore 15-16 L'immunoistochimica e' una tecnica ampiamente utilizzata per l'identificazione e la localizzazione di costituenti cellulari


Dal DNA alle proteine: La trascrizione e la traduzione

Dal DNA alle proteine: La trascrizione e la traduzione Dal DNA alle proteine: La trascrizione e la traduzione DNA RNA Trascrizione RNA PROTEINE Traduzione Dove avvengono? GLI EUCARIOTI I PROCARIOTI Cambell, Reece Biologia ZANICHELLI Trascrizione Sintesi di



ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) ATASSIA SPINOCEREBELLARE 17 (SCA17) (OMIM #607136) Il gene implicato nella SCA17 è il gene TATA box-binding protein (TBP) che fa parte del complesso della RNA polimerasi II ed è essenziale per dare inizio


Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato.

Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato. Nei sistemi modello approcci di modificazione genetica che producono o sequenze genetiche alterate o espressione genetica alterata fenotipo alterato. Correlazione tra fenotipo alterato, o a livello cellulare,


Meccanismi di controllo della proliferazione cellulare

Meccanismi di controllo della proliferazione cellulare Meccanismi di controllo della proliferazione cellulare Il ciclo cellulare è regolato dall azione di PROTOONCOGENI e (attivatori della proliferazione cellulare) GENI ONCOSOPPRESSORI (inibitori del ciclo





Citoscheletro Microtubuli

Citoscheletro Microtubuli PROPRIETA DEI MICROTUBULI, FILAMENTI INTERMEDI E FILAMENTI DI ACTINA Citoscheletro Microtubuli Biotec _ 2011 Da G. Karp, BIOLOGIA CELLULARE E MOLECOLARE, 3a ed, CORRETTA Microtubuli Microfilamenti Filamenti


Strumenti e Tecniche di studio in patologia

Strumenti e Tecniche di studio in patologia Strumenti e Tecniche di studio in patologia Gli strumenti della patologia: Microscopia Biologia molecolare Indagini biochimiche Microscopia Ottica citopatologia ed istopatologia citochimica ed istochimica


Patologia e aspetti biologici nel carcinoma mammario metastatico

Patologia e aspetti biologici nel carcinoma mammario metastatico Patologia e aspetti biologici nel carcinoma mammario metastatico Cristina Riva Laura Cimetti Dipartimento di Morfologia Umana Università dell Insubria Varese Il 20-30% delle pazienti affette da carcinoma



LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI LEGA ITALIANA PER LA LOTTA CONTRO I TUMORI Il Consiglio Direttivo Nazionale LILT, nella seduta del 19 marzo 2015, ha formalmente approvato la documentazione relativa ai lavori della Commissione tecnico-scientifica



DELPLVTLPHPNLHGPEILDVPST EILDVPST Tesi di Laurea Triennale Anna Pezzutto Glicoproteine transmembrana eterodimeriche (α/β) 18 subunitàαe 8 β che si possono assemblare in 24 diversi eterodimeri Mediano interazioni cellula-cellula e cellula-matrice


Prof. Maria Alessandra Santucci

Prof. Maria Alessandra Santucci La famiglia Abl consiste di due isoforme Abl (1a e 1b ) e due isoforme Arg (1a e 1b). Le isoforme di tipo b contengono un sito di miristoilazione all N-teminale che manca nelle isoforme a. c-abl è una


Le cellule del corpo non vivono isolate ma si organizzano a formare tessuti

Le cellule del corpo non vivono isolate ma si organizzano a formare tessuti Le cellule del corpo non vivono isolate ma si organizzano a formare tessuti I tessuti studio dei tessuti: è compito dell I STOLOGIA (dal greco istos, tela e logos, discorso). I tessuti UN TESSUTO: è formato


Correlazione tra profilo genetico e biochimico di Pin1 nella malattia di Alzheimer

Correlazione tra profilo genetico e biochimico di Pin1 nella malattia di Alzheimer Correlazione tra profilo genetico e biochimico di Pin1 nella malattia di Alzheimer Beatrice Arosio Dipartimento di Medicina Interna, Università degli Studi di Milano U.O. di Geriatria, Fondazione IRCCS


Si tratta di corpiccioli di natura ribonucleoproteica che nel citoplasma di tutte le cellule presiedono ai processi di sintesi proteica.

Si tratta di corpiccioli di natura ribonucleoproteica che nel citoplasma di tutte le cellule presiedono ai processi di sintesi proteica. I R I BOSOM I I RIBOSOMI sono organuli citoplasmatici presenti in tutte le cellule, sia procariotiche che eucariotiche. Sono visibili al M.O. solo quando presenti in gran numero, (come capita nelle cellule


Regolazione dell espressione genica EUCARIOTI

Regolazione dell espressione genica EUCARIOTI Regolazione dell espressione genica EUCARIOTI Regolazione della espressione genica Molte proteine sono comuni a tutte le cellule RNA polimerasi, proteine ribosomali, enzimi che regolano il metabolismo,


Marcatori molecolari prognostici. Milo Frattini Istituto cantonale di patologia Locarno

Marcatori molecolari prognostici. Milo Frattini Istituto cantonale di patologia Locarno Marcatori molecolari prognostici Milo Frattini Istituto cantonale di patologia Locarno Legnano 24.03.2009 Cancro colorettale - Epidemiologia Il cancro colorettale è la seconda causa di morte per malattie


Un aiuto per prendere decisioni più informate 1-5

Un aiuto per prendere decisioni più informate 1-5 Un aiuto per prendere decisioni più informate 1-5 L'unico test che fornisce una valutazione accurata dell aggressività del cancro alla prostata Un prodotto di medicina prognostica per il cancro della prostata.



LA RICERCA SCIENTIFICA IN MEDICINA Associazione Culturale Micene 1 Congresso Nazionale Evoluzione della Scienza e della Tecnica LA RICERCA SCIENTIFICA IN MEDICINA Dr. Federico Selvaggi Università degli Studi G. d Annunzio Chieti/Pescara


Cosa sono i Macatori Tumorali?

Cosa sono i Macatori Tumorali? Marcatori tumorali Cosa sono i Macatori Tumorali? Sostanze biologiche sintetizzate e rilasciate dalle cellule tumorali o prodotte dall ospite in risposta alla presenza del tumore Assenti o presenti in


Lo Splicing dell RNA. Geni non interrotti

Lo Splicing dell RNA. Geni non interrotti Lo Splicing dell RNA I geni interrotti negli eucarioti si ritrovano in ogni classe: geni nucleari codificanti per proteine, rrna e trna. I geni interrotti sono presenti anche nei mitocondri e nei cloroplasti,


Domande relative alla specializzazione in: Biochimica clinica

Domande relative alla specializzazione in: Biochimica clinica Domande relative alla specializzazione in: Biochimica clinica Domanda #1 (codice domanda: n.403) : Nell'ibridazione fluorescente in situ (Fluorescent in situ hybridization "FISH"), che tipo di sonde fluorescenti


Introduzione. Colture cellulari in vitro: cellule isolate dal loro ambiente e messe in condizioni di vivere all'interno di un sistema definito

Introduzione. Colture cellulari in vitro: cellule isolate dal loro ambiente e messe in condizioni di vivere all'interno di un sistema definito Colture Cellulari Introduzione Colture cellulari in vitro: cellule isolate dal loro ambiente e messe in condizioni di vivere all'interno di un sistema definito strumento fondamentale per studi biochimici,


Amminoacidi e Proteine

Amminoacidi e Proteine Amminoacidi e Proteine Struttura generale di un α-amminoacido R = catena laterale AMMINOACIDI (AA) CELLULARI Gli amminoacidi presenti nella cellula possono essere il prodotto di idrolisi delle proteine


Differenziamento cellulare

Differenziamento cellulare Differenziamento cellulare Differenziamento: acquisizione progressiva di nuove caratteristiche che porta a tipi cellulari specifici (es cell muscolari, neuroni,.) Dopo la fecondazione lo zigote va incontro





Utilizzo dei vaccini in oncologia

Utilizzo dei vaccini in oncologia L E G U I D E Utilizzo dei vaccini in oncologia Fondazione Federico Calabresi Utilizzo dei vaccini in oncologia Michele Maio Luana Calabrò Arianna Burigo U.O.C. Immunoterapia Oncologica Azienda Ospedaliera
